HHsearch alignment for GI: 254780719 and conserved domain: COG4139

>COG4139 BtuC ABC-type cobalamin transport system, permease component [Coenzyme metabolism].
Probab=99.00  E-value=3.9e-08  Score=62.53  Aligned_cols=224  Identities=16%  Similarity=0.219  Sum_probs=147.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHC--CHH----HHHHHHHHHHHHHHHHHH
Q ss_conf             99999999998788999999879996435899999999--------9999950--036----679999999999998631
Q gi|254780719|r   10 LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGV--------ALSLIFQ--LPL----TICIFMIATLTSLVLLQI   75 (260)
Q Consensus        10 ll~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gi--------al~~~l~--~~~----~~ga~~~~~l~al~i~~l   75 (260)
T Consensus        60 ~lAv~~vGAsLAVsGAvm----QaL~~N~LAEPGllGVs~GA~Valv~~vL~~~~l~~~~a~~~~Ai~GALl~TliLl~~  135 (326)
T COG4139          60 TLAVLLVGAALAVSGAVM----QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRF  135 (326)
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHHCCCCCCCCEEEECCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             899999727888708999----9996586668763431588409999999974775758999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC-----CCH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             0357650456999999999999999996213-----200---13334433324422876705899998999999984245
Q gi|254780719|r   76 QKNEALSSDAILGVITHSTISLALVILSFMK-----WVN---TDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWK  147 (260)
Q Consensus        76 ~~~~~~~~da~igi~~s~~~alg~llls~~~-----~~~---~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r  147 (260)
T Consensus       136 aRr~~lTa-----rLLLvGVALGIi~~A~mTWA~YFS~sL~LRQLMYWmMG~~~GVdW~Q~~L~La-~~PvvIWl~~Qg~  209 (326)
T COG4139         136 ARRHLSTS-----RLLLAGVALGIICSALMTWAIYFSTSLDLRQLMYWMMGGFGGVDWRQSWLMLA-LIPVLIWICCQSR  209 (326)
T ss_pred             HHHHHHHH-----HHHHHHHHHHHHHHHHHHHEEEEECCCCHHHHHHHHHCCCCCCCHHHHHHHHH-HHHHHHHHHCCCC
T ss_conf             99999898-----99999999999888785620031065269999999967756742999989999-9778886101676


Q ss_pred             HHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             66541288899998089810677699999999999999998899999999999999997419989999999999999999
Q gi|254780719|r  148 PLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGII  227 (260)
Q Consensus       148 ~l~~~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~  227 (260)
T Consensus       210 vLn~l~LGE~~ArQLG~~lh~~R~~LvLAi~llVG~SVAL~GvIgFiG-LViPHiLRLt~~td~RlLLp~~Al~Ga~~Ll  288 (326)
T COG4139         210 PLNMLALGEISARQLGLPLWFWRNVLVLATGWMVGVSVALAGAIGFIG-LVIPHILRLCGLTDHRLLLPGCALAGASALL  288 (326)
T ss_pred             CCHHHHCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCCCCCCCHHHHCCHHHH
T ss_conf             314776251468872971899999999999999868999752776766-7688999983574232012514650327999


Q ss_pred             HHHHHHHH----HCCCCHHHH
Q ss_conf             99999999----558808999
Q gi|254780719|r  228 IGLYGSLI----FDTPSGPSI  244 (260)
Q Consensus       228 ~G~~lS~~----~~lp~g~~I  244 (260)
T Consensus       289 ~AD~vARlaL~S~ELPiGVVT  309 (326)
T COG4139         289 LADIVARLALASAELPIGVVT  309 (326)
T ss_pred             HHHHHHHHHHCCCCCCCEEEE
T ss_conf             999999987123677732687