HHsearch alignment for GI: 254780719 and conserved domain: COG4177

>COG4177 LivM ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism].
Probab=92.75  E-value=0.56  Score=23.45  Aligned_cols=209  Identities=16%  Similarity=0.234  Sum_probs=92.3

Q ss_pred             HHHHHHHHHH---HHHHHHC-----CHHHHHHHH---HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC-
Q ss_conf             5899999999---9999950-----036679999---999999998631035765045699999999999999999621-
Q gi|254780719|r   38 TIAHSALLGV---ALSLIFQ-----LPLTICIFM---IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFM-  105 (260)
Q Consensus        38 alsH~a~~Gi---al~~~l~-----~~~~~ga~~---~~~l~al~i~~l~~~~~~~~da~igi~~s~~~alg~llls~~-  105 (260)
T Consensus        56 slGha~F~glGAY~~a~l~~~~~g~~~~~~~l~~~~~~~al~g~l~g~p~lR--l~g~ylaI~Tla~~~~~~~~~~~~~~  133 (314)
T COG4177          56 SLGHAAFFGLGAYTAALLLARLLGGLSFWLALLLGGLVAALLGLLLGLPALR--LRGDYLAIVTLAFGEIFRILLLNATE  133 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHCHH
T ss_conf             1477999998999999998887513428999999999999999999879999--85289999999999999999971667


Q ss_pred             -CCCHHHHHH----HHHHHHHHCCHHHHHHHH-HHHHHHHHHHH-----HHHHHHHHHCCCHHHHHHCCCCCCHHHHHHH
Q ss_conf             -320013334----433324422876705899-99899999998-----4245665412888999980898106776999
Q gi|254780719|r  106 -KWVNTDLTS----FLFGDILAVNTTDILLIW-GIGFLNIMILF-----KIWKPLLATTVNYELAKAEGMQPEKIKLIFI  174 (260)
Q Consensus       106 -~~~~~~l~~----~LfG~il~v~~~dv~~~~-~~~~~~~~~l~-----~~~r~l~~~~fD~~~A~~~Gi~v~~~~~l~~  174 (260)
T Consensus       134 ~tgG~~Gl~~i~~~~l~g~~--~~~~~~y~~~l~~l~l~~~~~~~l~~S~~Gr~l~AiRedE~~a~alG~n~~~~Kl~aF  211 (314)
T COG4177         134 LTGGENGLSGIPRPTLLGFP--SRARGLYYLALLLLLLTLLVLERLVRSPFGRALRAIREDEIAARALGINVTRYKLLAF  211 (314)
T ss_pred             HHCCCCCCCCCCCHHHCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCHHHHHHCCCCHHHHHHHHH
T ss_conf             51998771268833230555--3029999999999999999999986497033686661578999985998899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH----HHHHH-----HHCCCC---H
Q ss_conf             9999999999999889999999-999999999741998999999999999999999----99999-----955880---8
Q gi|254780719|r  175 MITSLMISVSIKFIGITLITSL-LILPTVTARRFSTSPENMAILATIIGILGIIIG----LYGSL-----IFDTPS---G  241 (260)
Q Consensus       175 ~l~al~v~~~v~~vG~llv~al-lv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G----~~lS~-----~~~lp~---g  241 (260)
T Consensus       212 ~isa~~A----GiAGaL~a~~~~~v~p~~f~----~~~S~~~l~~vvlGG~Gt~~G~v~Ga~l~~~~~~~l~~~~~~~~~  283 (314)
T COG4177         212 VISAAIA----GIAGALYALYLGFVSPESFS----FTLSIEVLAMVVLGGAGTLFGALLGAVLVVLLKELLRGLLPRPVE  283 (314)
T ss_pred             HHHHHHH----HHHHHHHHHHHCEECCHHCC----HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHH
T ss_conf             9999999----99999999981503800253----999999999999847643188999999999999999762453158


Q ss_pred             HHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999998723
Q gi|254780719|r  242 PSIIITSLFLFILSFFYK  259 (260)
Q Consensus       242 ~~Iv~~~~~~f~~~~~~~  259 (260)
T Consensus       284 ~~-~~v~G~llvlv~l~~  300 (314)
T COG4177         284 YR-LLVFGLLLVLVVLFR  300 (314)
T ss_pred             HH-HHHHHHHHHHHHHHC
T ss_conf             99-999999999999983