HHsearch alignment for GI: 254780719 and conserved domain: COG4214

>COG4214 XylH ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism].
Probab=91.36  E-value=0.82  Score=22.52  Aligned_cols=39  Identities=21%  Similarity=0.336  Sum_probs=33.8

Q ss_pred             HHHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             424566541288899998089810677699999999999
Q gi|254780719|r  144 KIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS  182 (260)
Q Consensus       144 ~~~r~l~~~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~  182 (260)
T Consensus       264 ~fGR~VyAiGGN~eAA~LSGInv~r~t~~vF~~mGvl~A  302 (394)
T COG4214         264 VFGRRVYAIGGNPEAARLSGINVERVTLLVFVIMGVLAA  302 (394)
T ss_pred             EEEEEEEEECCCHHHHHHCCCCEEEHHHHHHHHHHHHHH
T ss_conf             220489872698788986487501046899999789999