HHsearch alignment for GI: 254780719 and conserved domain: COG4606

>COG4606 CeuB ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.55  E-value=3.1e-14  Score=95.88  Aligned_cols=248  Identities=17%  Similarity=0.202  Sum_probs=191.8

Q ss_pred             HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHC--C---HHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             999999999878899----99998799964358999999999999950--0---36679999999999998631035765
Q gi|254780719|r   11 FSGIGIVLSTGPLGC----FIIWQRIAYFGDTIAHSALLGVALSLIFQ--L---PLTICIFMIATLTSLVLLQIQKNEAL   81 (260)
Q Consensus        11 l~~~~~~~~~~~lG~----~vv~rr~s~~~~alsH~a~~Gial~~~l~--~---~~~~ga~~~~~l~al~i~~l~~~~~~   81 (260)
T Consensus        54 ~aIlLaG~smsvaGLIMQ~ltqNrFv~PstaGT~e~A~LGill~l~~fp~a~~~~kmlvA~v~al~Gt~~F~~~l~ri~~  133 (321)
T COG4606          54 LAILLAGSSMSVAGLIMQQLTQNRFVEPSTAGTTESAKLGILLSLLLFPSASLLIKMLVAFVFALAGTLLFMMILRRIKL  133 (321)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999430888999999999854766886544487877507677555078728999999999999999999999975563


Q ss_pred             HH---HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             04---569999999999999999962132001333443332442287670589999899999998424566541288899
Q gi|254780719|r   82 SS---DAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYEL  158 (260)
Q Consensus        82 ~~---da~igi~~s~~~alg~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~  158 (260)
T Consensus       134 k~~i~VPLiGIm~Ggvi~sitTFiAy~~dllQ~l~~W~~G~Fs~v~~Gr-YElL~i~~~l~i~ay~~AdrfTi~GmGedf  212 (321)
T COG4606         134 KDVLFVPLIGIMFGGVISSITTFIAYRFDLLQSLGAWLQGDFSGVLRGR-YELLWISIPLAILAYLFADRFTIAGMGEDF  212 (321)
T ss_pred             CCEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCC-EEEEHHHHHHHHHHHHHHHHEEEECCCHHH
T ss_conf             4547632499998859999999999999999986687607538775153-256167899999999986032452055666


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH----HHHHHHHHHHHH
Q ss_conf             9980898106776999999999999999988999999999999999974199899999999999----999999999999
Q gi|254780719|r  159 AKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIG----ILGIIIGLYGSL  234 (260)
Q Consensus       159 A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g----~~~~~~G~~lS~  234 (260)
T Consensus       213 s~NLGLnY~~v~~igl~iValitsvVvvtVG~lPFLG-LIvPNiVs~~~GDnLr~~lp~val~Ga~~VL~CDIigRvii~  291 (321)
T COG4606         213 SVNLGLNYNRVVNIGLFIVALITSVVVVTVGMLPFLG-LIVPNIVSLYRGDNLRQNLPWVALLGALFVLLCDIIGRVIIF  291 (321)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCEEEEEECCCCCCE-EEHHHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHCCEEEE
T ss_conf             6650724999999999999997503799985765121-411247789845544323559999731999999864236875


Q ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             95588089999999999999987239
Q gi|254780719|r  235 IFDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       235 ~~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       292 PyEipis~~~GViGs~vFl~LllR~~  317 (321)
T COG4606         292 PYEIPISLILGVIGSAVFLLLLLRGR  317 (321)
T ss_pred             EEECCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             55131678799888999999998135