HHsearch alignment for GI: 254780719 and conserved domain: COG4779

>COG4779 FepG ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.44  E-value=3.9e-13  Score=89.86  Aligned_cols=200  Identities=14%  Similarity=0.181  Sum_probs=150.5

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCC-CHHHH--HHHHHHHHHH-HHHHHHHHHC-CCCHHHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             67999999999999863103576-50456--9999999999-9999999621-320013334433324422876705899
Q gi|254780719|r   58 TICIFMIATLTSLVLLQIQKNEA-LSSDA--ILGVITHSTI-SLALVILSFM-KWVNTDLTSFLFGDILAVNTTDILLIW  132 (260)
Q Consensus        58 ~~ga~~~~~l~al~i~~l~~~~~-~~~da--~igi~~s~~~-alg~llls~~-~~~~~~l~~~LfG~il~v~~~dv~~~~  132 (260)
T Consensus       134 ~~aAi~GGi~TA~avylla~r~g~~~~~RLIivGIGvgA~L~a~n~~ll~~a~le~A~ta~lW~aGSLn~~~W~~v~p~~  213 (346)
T COG4779         134 ALAAIAGGIVTALAVYLLAWRNGTIGGFRLIIVGIGVGAMLVAFNTWLLVQADLEQAMTAGLWLAGSLNGLTWAHVLPSL  213 (346)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             99999866899999999998237767638999940199999999988974402988899999854884557688888899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             99899999998424566541288899998089810677699999999999999998899999999999999997419989
Q gi|254780719|r  133 GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPE  212 (260)
Q Consensus       133 ~~~~~~~~~l~~~~r~l~~~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~  212 (260)
T Consensus       214 ~~~~vi~p~~~~l~R~lr~lEmGDd~A~~LGV~vertRL~~ilvaV~lta~aTaaAGPIaFIA-LaAPQ-iArrL~~t~g  291 (346)
T COG4779         214 LILAVILPAAAYLVRRLRLLEMGDDIACALGVSVERTRLLMILVAVALTAAATAAAGPIAFIA-LAAPQ-IARRLSGTAG  291 (346)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEHHHHHHHHHHHHHHHHHHHHCCCCHHHHH-HCCHH-HHHHHHCCCC
T ss_conf             999999999999998888876015677651735328889999999999999997346534565-52369-9999735899


Q ss_pred             HHHHHHHHHHHHHH----HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999----9999999995588089999999999999987239
Q gi|254780719|r  213 NMAILATIIGILGI----IIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       213 ~~~~~s~~~g~~~~----~~G~~lS~~~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       292 v~L~~~almGa~LLlaADll~q~l~~~~~lPVG~-vT~~lGG~Yl~~LL~r~  342 (346)
T COG4779         292 VSLLAAALMGALLLLAADLLAQHLFTPYRLPVGV-VTVSLGGIYLIWLLIRE  342 (346)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEE-EEEECCHHHHHHHHHHH
T ss_conf             3058889988799999999997436231377057-87531459999999998