HHsearch alignment for GI: 254780719 and conserved domain: PRK09535

>PRK09535 btuC corrinoid ABC transporter permease; Reviewed.
Probab=99.94  E-value=7.4e-24  Score=148.43  Aligned_cols=250  Identities=14%  Similarity=0.163  Sum_probs=191.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH----HHHHHHHHHHHHHHHHHHHCCCCC-CHH
Q ss_conf             999999999998788999999879996435899999999999995003----667999999999999863103576-504
Q gi|254780719|r    9 ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP----LTICIFMIATLTSLVLLQIQKNEA-LSS   83 (260)
Q Consensus         9 all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~~~----~~~ga~~~~~l~al~i~~l~~~~~-~~~   83 (260)
T Consensus       102 A~lvGaaLavaG~lmQ~l~RNPLAdP~iLGVssGA~lga~~~i~l~~~~~~~~~~~af~gal~~~~~v~~l~~~~g~~~~  181 (366)
T PRK09535        102 GATVGFSLAIAGAVMQGFFRNPMADPSIIGVSSGAAVGAVAFIVLPLVVPFGLQAAAFAGALIAAFTVYLIATRNGRTPT  181 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             99999999999999999728888697287999999999999999988888999999999999999999999980688875


Q ss_pred             H--HHHHHHHHHHHHHHH-HHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             5--699999999999999-9996213200133344333244228767058999989999999842456654128889999
Q gi|254780719|r   84 D--AILGVITHSTISLAL-VILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAK  160 (260)
Q Consensus        84 d--a~igi~~s~~~alg~-llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~A~  160 (260)
T Consensus       182 ~~LiL~Giavs~~~~Al~~~l~~~~~~~~~~~~~Wl~Gsl~~~~w~~v~~~~~~~~i~~~~~~~~~r~L~~L~lGde~A~  261 (366)
T PRK09535        182 ATLLLAGVAVQTFLGAVISFLLLHSGESIRRAVYWLMGHLHGSTWGDVRAALPVVVVGFVVLLAYARDLNVLLLGEEDAH  261 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCHHHHH
T ss_conf             99999999999999999999997481768999999977157898889999999999999999999996420213959998


Q ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH--HHCC
Q ss_conf             80898106776999999999999999988999999999999999974199899999999999999999999999--9558
Q gi|254780719|r  161 AEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL--IFDT  238 (260)
Q Consensus       161 ~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~--~~~l  238 (260)
T Consensus       262 sLGvnv~~~r~~~l~la~llta~~Va~~G~IgFVG-Li~PHiaR~l~g~~~r~llp~saL~Ga~lll~aD~laR~~p~El  340 (366)
T PRK09535        262 TLGIEVERTKRILLAAASVVTAAAVAVAGVIGFVG-LIVPHAMRLLVGPDHRILLPTSALAGASFLVATDTVARSGATEP  340 (366)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             78998899999999999999999999334164698-60899999992888434999999999999999999756486445


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8089999999999999987239
Q gi|254780719|r  239 PSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       239 p~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       341 PvGivtalIG~P~f-l~LL~rr  361 (366)
T PRK09535        341 PVGIITAALGAPFF-LYLLRKR  361 (366)
T ss_pred             CHHHHHHHHHHHHH-HHHHHHH
T ss_conf             49999999989999-9999840