HHsearch alignment for GI: 254780719 and conserved domain: PRK09543

>PRK09543 znuB high-affinity zinc transporter membrane component; Reviewed.
Probab=100.00  E-value=0  Score=428.99  Aligned_cols=259  Identities=39%  Similarity=0.735  Sum_probs=256.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             00698999999999999987889999998799964358999999999999950036679999999999998631035765
Q gi|254780719|r    2 YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL   81 (260)
Q Consensus         2 ~~~f~~~all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~~~~~~ga~~~~~l~al~i~~l~~~~~~   81 (260)
T Consensus         1 ~~ef~~~a~la~~l~~~~~g~lG~f~vlrr~s~~gdalsH~~l~Gial~~l~~~~~~~~~~~~~ll~a~~i~~l~~~~~~   80 (261)
T PRK09543          1 MIELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIAVTLLLAGGLVWLEKRPQL   80 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             97789999999999999999887999996299998899999999999999997056799999999999999998713665


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             04569999999999999999962132001333443332442287670589999899999998424566541288899998
Q gi|254780719|r   82 SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKA  161 (260)
Q Consensus        82 ~~da~igi~~s~~~alg~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~A~~  161 (260)
T Consensus        81 ~~Da~igiv~s~~~algvilis~~~~~~~~l~~~LfG~il~v~~~dl~~~~~~~~~~~~~~~~~~r~l~~~~fD~~~A~~  160 (261)
T PRK09543         81 AIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAVTPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFV  160 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             23489999999999999989531578877732102303860899899999999999999999999999998289999988


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             08981067769999999999999999889999999999999999741998999999999999999999999999558808
Q gi|254780719|r  162 EGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG  241 (260)
Q Consensus       162 ~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~~~lp~g  241 (260)
T Consensus       161 ~Gi~v~~~~~~~~~lial~vv~~ik~VG~lLv~alLiiPaa~A~~~s~~~~~~~~~s~l~~~~~~~~Gl~~S~~~d~p~G  240 (261)
T PRK09543        161 DGVKLQRVKLLLMLVTALTIGVAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAG  240 (261)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             29988999999999999999999999999999999998999999997689999999999999999999999997299904


Q ss_pred             HHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999999987239
Q gi|254780719|r  242 PSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       242 ~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       241 ~~Ivl~~~~~f~lsli~k~  259 (261)
T PRK09543        241 PSVVLCAALLFILSMMKKQ  259 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999871