HHsearch alignment for GI: 254780719 and conserved domain: PRK09777

>PRK09777 fecD iron-dicitrate transporter subunit FecD; Reviewed.
Probab=99.94  E-value=1.2e-23  Score=147.18  Aligned_cols=250  Identities=11%  Similarity=0.094  Sum_probs=194.5

Q ss_pred             HHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH-----HHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999999878899----9999879996435899999999999995003-----667999999999999863103576
Q gi|254780719|r   10 LFSGIGIVLSTGPLGC----FIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----LTICIFMIATLTSLVLLQIQKNEA   80 (260)
Q Consensus        10 ll~~~~~~~~~~~lG~----~vv~rr~s~~~~alsH~a~~Gial~~~l~~~-----~~~ga~~~~~l~al~i~~l~~~~~   80 (260)
T Consensus        55 ~l~ail~G~~LalaG~llQ~l~rNpLA~P~iLGvssGA~l~~v~~~~~~~~~~~~~~~~~a~~gal~~~~~~~~l~~~~~  134 (318)
T PRK09777         55 LLLALFVGAALAVAGVLVQGIVRNPLASPDILGVNHAASLASVGALLLFPSLPVMWLPLLAFIGGMAGLILLKMLAGTHQ  134 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999999937988894275689889999999999987678999999999999999999999966787


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             504569999999999999999962-1320013334433324422876705899998999999984245665412888999
Q gi|254780719|r   81 LSSDAILGVITHSTISLALVILSF-MKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELA  159 (260)
Q Consensus        81 ~~~da~igi~~s~~~alg~llls~-~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~A  159 (260)
T Consensus       135 ~~~liL~Gi~is~~~~a~~~~l~~~~~~~~~~~~~Wl~Gsl~~~~w~~~~~~~~~~ii~~~~~~~~~~~l~~l~lGe~~A  214 (318)
T PRK09777        135 PMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIALPLLILLLPLSLSFCRDLDLLALGDARA  214 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             07999999999999999999999679899999999994054347889999999999999999999999714363693999


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----H
Q ss_conf             980898106776999999999999999988999999999999999974199899999999999999999999999----9
Q gi|254780719|r  160 KAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL----I  235 (260)
Q Consensus       160 ~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~----~  235 (260)
T Consensus       215 ~sLGvnv~~~r~~~l~~~~~l~a~~va~vG~I~FVG-Li~PhiaR~l~g~~~~~~lp~s~l~Ga~lll~aD~l~R~l~~p  293 (318)
T PRK09777        215 TTLGVSVPHTRFWALLLAVALTATGVAACGPISFIG-LVVPHLMRSLVGGRHRRLLPVSALTGALLLLLADLLARIIHPP  293 (318)
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             977997999999999999999999998025052498-6199999998088854189999999999999999999660666


Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5588089999999999999987239
Q gi|254780719|r  236 FDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       236 ~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       294 ~elPvGivtaliG~P~fi~ll~R~r  318 (318)
T PRK09777        294 LELPAGVLTAIIGAPWFVWLLVRMR  318 (318)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             5211999999998999999740379