HHsearch alignment for GI: 254780719 and conserved domain: PRK10441

>PRK10441 iron-enterobactin transporter membrane protein; Provisional.
Probab=99.93  E-value=8.9e-23  Score=142.53  Aligned_cols=250  Identities=12%  Similarity=0.040  Sum_probs=185.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-C----HHHHHHHHHHHHHHHHHHHHCCCC--CC
Q ss_conf             9999999999987889999998799964358999999999999950-0----366799999999999986310357--65
Q gi|254780719|r    9 ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-L----PLTICIFMIATLTSLVLLQIQKNE--AL   81 (260)
Q Consensus         9 all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~-~----~~~~ga~~~~~l~al~i~~l~~~~--~~   81 (260)
T Consensus        67 A~lvGaaLalsG~l~Q~l~rNPLA~P~ilGissGA~l~~vl~~~~~~~~~~~~~~~~a~~ga~~~~~~v~~l~~~~~~~~  146 (335)
T PRK10441         67 GLLAGGALGLAGALMQTLTRNPLADPGILGVNAGASFAIVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQL  146 (335)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999999999947988784164588889999999999998777899999999999999999999999748987


Q ss_pred             HH--HHHHHHHHHHHHHHHH-HHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             04--5699999999999999-99962132001333443332442287670589999899999998424566541288899
Q gi|254780719|r   82 SS--DAILGVITHSTISLAL-VILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYEL  158 (260)
Q Consensus        82 ~~--da~igi~~s~~~alg~-llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~  158 (260)
T Consensus       147 ~~~~liL~Giai~~~~~a~~~~l~~~~~~~~~~~~~Wl~Gsl~~~~w~~~~~~~~~~~~~~~~~~~~~~~L~~l~lGd~~  226 (335)
T PRK10441        147 SPVRLTLAGVALAAVLEGLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSLSLGSDT  226 (335)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             54999999999999999999999992979999999997777557778999999999999999999999999999779699


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH---H
Q ss_conf             9980898106776999999999999999988999999999999999974199899999999999999999999999---9
Q gi|254780719|r  159 AKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL---I  235 (260)
Q Consensus       159 A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~---~  235 (260)
T Consensus       227 A~sLGv~v~~~r~~~l~~a~ll~a~~Va~~G~IgFVG-Li~PHiaR~l~g~~~~~~lp~sal~Ga~lll~aD~~~R~~~p  305 (335)
T PRK10441        227 ATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIG-LMMPHMARWLVGADHRWSLPVTLLATPALLLFADIIGRLLVP  305 (335)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9868996999999999999999999999375386799-629999999818885408999999999999999999987566


Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5588089999999999999987239
Q gi|254780719|r  236 FDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       236 ~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       306 ~eiPvGiitaliG~P~fl-~Ll~r~  329 (335)
T PRK10441        306 GELRVSVVSAFIGAPVLI-FLVRRK  329 (335)
T ss_pred             CCCHHHHHHHHHHHHHHH-HHHHHC
T ss_conf             561099999999899999-999826