HHsearch alignment for GI: 254780719 and conserved domain: PRK10577

>PRK10577 iron-hydroxamate transporter permease subunit; Provisional.
Probab=99.95  E-value=6.8e-25  Score=154.09  Aligned_cols=249  Identities=15%  Similarity=0.224  Sum_probs=170.8

Q ss_pred             HHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHCCH-----HHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999999987889999----99879996435899999999999995003-----667999999999999863103576
Q gi|254780719|r   10 LFSGIGIVLSTGPLGCFI----IWQRIAYFGDTIAHSALLGVALSLIFQLP-----LTICIFMIATLTSLVLLQIQKNEA   80 (260)
Q Consensus        10 ll~~~~~~~~~~~lG~~v----v~rr~s~~~~alsH~a~~Gial~~~l~~~-----~~~ga~~~~~l~al~i~~l~~~~~   80 (260)
T Consensus       400 ~l~A~l~Ga~La~aG~llQ~l~rNPLAsP~iLGissGA~lg~v~~~~~~~~~~~~~~~~~a~~Gal~~~~lv~~l~~~~~  479 (666)
T PRK10577        400 LLAALLAGALLAVAGVLLQRLTRNPLASPEVLGVSSGAALGVVLALFLVPGAGFGWLLAAALLGAAAALLLILLLARRHG  479 (666)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999999999999847988897354148649999999999988887899999999999999999999982579


Q ss_pred             CHHHHHH--HHHHHHHHHHHH-HHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH
Q ss_conf             5045699--999999999999-9996213200133344333244228767058999989999999842456654128889
Q gi|254780719|r   81 LSSDAIL--GVITHSTISLAL-VILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYE  157 (260)
Q Consensus        81 ~~~da~i--gi~~s~~~alg~-llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~  157 (260)
T Consensus       480 ~~~~~liL~Giaisa~~~Al~~~l~~~~~~~~~~~~~Wl~Gs~~~~~~~~~~~~~~~~~~~~~~~~~~~r~L~lL~LGd~  559 (666)
T PRK10577        480 FAPERLLLTGIALSALFTALLQILLASGDPRAAQLLTWLSGSTYGVTWAQALLLLIVAVILLAVALLLRRWLDLLPLGDD  559 (666)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHH
T ss_conf             98189999999999999999999998088879999999967624688889999999999999999999875723526989


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH----
Q ss_conf             9998089810677699999999999999998899999999999999997419989999999999999999999999----
Q gi|254780719|r  158 LAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS----  233 (260)
Q Consensus       158 ~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS----  233 (260)
T Consensus       560 ~A~sLGv~v~~~r~~~l~~a~llta~ava~~G~I~FVG-LiaPHiaR~l~g~~~~~~l~~sal~Ga~lll~aD~l~R~~~  638 (666)
T PRK10577        560 TARALGLPLTRARLALLLLAALLTAAATATVGPLSFVG-LMAPHLARMLGFRRARPQLLIAALLGALLMVLADWLGRTLL  638 (666)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99878997899999999999999999999705999999-97999999982888633899999999999999999884338


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             995588089999999999999987239
Q gi|254780719|r  234 LIFDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       234 ~~~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       639 ~P~eiPvGivtali-G~P~fl~Ll~r~  664 (666)
T PRK10577        639 FPYQIPAGLLAALI-GAPYFLWLLRKQ  664 (666)
T ss_pred             CCCCCCHHHHHHHH-HHHHHHHHHHCC
T ss_conf             86560299999999-999999986205