HHsearch alignment for GI: 254780719 and conserved domain: PRK11228

>PRK11228 fecC iron-dicitrate transporter permease subunit; Provisional.
Probab=99.94  E-value=1.5e-23  Score=146.78  Aligned_cols=250  Identities=12%  Similarity=0.123  Sum_probs=186.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH------HHHHHHHHHHHHHHHHHHHCC--CCC
Q ss_conf             999999999998788999999879996435899999999999995003------667999999999999863103--576
Q gi|254780719|r    9 ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP------LTICIFMIATLTSLVLLQIQK--NEA   80 (260)
Q Consensus         9 all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~~~------~~~ga~~~~~l~al~i~~l~~--~~~   80 (260)
T Consensus        58 ailvGa~La~aG~llQ~l~rNPLA~P~iLGissGA~lg~~~~~~l~~~~~~~~~~~~~a~~g~~~~~~~v~~l~~~~~~~  137 (323)
T PRK11228         58 AVLIGASLALAGALLQTLTHNPLASPSLLGINSGAALAMALTSALSPTPFAGYSLSFIAACGGGLSWLLVMTAGGGWRHT  137 (323)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999946988896302045799999999999998888899999999999999999999999862678


Q ss_pred             CHH--HHHHHHHHHHHHHH-HHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH
Q ss_conf             504--56999999999999-999996213200133344333244228767058999989999999842456654128889
Q gi|254780719|r   81 LSS--DAILGVITHSTISL-ALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYE  157 (260)
Q Consensus        81 ~~~--da~igi~~s~~~al-g~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~  157 (260)
T Consensus       138 ~~~~~liL~Giais~~~~a~~~~l~~~~~~~~~~~~~Wl~Gsl~~~~w~~v~~~~~~~~i~~~~~~~~~~~L~~l~lGd~  217 (323)
T PRK11228        138 HDRNRLILAGIALSALCMALTRITLLLAEDHAYGIFYWLAGGVSHARWQEVWQLLPFVVTAVPVVLLLANQLNLLNLSDS  217 (323)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             87189999999999999999999999481999999999955666888999999999999999999999987056745959


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH---
Q ss_conf             99980898106776999999999999999988999999999999999974199899999999999999999999999---
Q gi|254780719|r  158 LAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL---  234 (260)
Q Consensus       158 ~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~---  234 (260)
T Consensus       218 ~A~sLGv~v~~~r~~~l~~~~~l~a~~va~~G~I~FVG-LivPhiaR~l~g~~~~~~lp~sal~Ga~lll~aD~iaR~l~  296 (323)
T PRK11228        218 TAHTLGVNLTRLRLVVNMLVLLLVGACVSVAGPVAFIG-LLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADLLARALA  296 (323)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH-HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99878997999999999999999999996677162298-50999999981888751799999999999999999986615


Q ss_pred             -HHCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             -95588089999999999999987239
Q gi|254780719|r  235 -IFDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       235 -~~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       297 ~p~eiPvGivta~i-GaP~fi~Ll~Rr  322 (323)
T PRK11228        297 FPGELPAGAVLALI-GAPCFVWLARRR  322 (323)
T ss_pred             CCCCCCHHHHHHHH-HHHHHHHHEECC
T ss_conf             66531099999999-899999831017