HHsearch alignment for GI: 254780719 and conserved domain: TIGR03409

>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=93.19  E-value=0.48  Score=23.81  Aligned_cols=62  Identities=15%  Similarity=0.136  Sum_probs=42.8

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             422876705899998999999984-----24566541288899998089810677699999999999
Q gi|254780719|r  121 LAVNTTDILLIWGIGFLNIMILFK-----IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS  182 (260)
Q Consensus       121 l~v~~~dv~~~~~~~~~~~~~l~~-----~~r~l~~~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~  182 (260)
T Consensus       138 ~~~~~~~~~~~~~~~~~~~~l~~~l~rT~~G~~lrAi~~n~~aA~~~GInv~r~~~~af~is~~lag  204 (291)
T TIGR03409       138 LSLPYNRLFIIVLALAVLLALALLLYRTRLGLRVRAVTQNRVMAAALGINTRRVDALTFALGSGIAG  204 (291)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             2231999999999999999999998378565888887247999998599899999999999999999