HHsearch alignment for GI: 254780719 and conserved domain: pfam00950

>pfam00950 ABC-3 ABC 3 transport family.
Probab=100.00  E-value=0  Score=420.31  Aligned_cols=258  Identities=32%  Similarity=0.603  Sum_probs=254.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             00698999999999999987889999998799964358999999999999950036679999999999998631035765
Q gi|254780719|r    2 YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL   81 (260)
Q Consensus         2 ~~~f~~~all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~~~~~~ga~~~~~l~al~i~~l~~~~~~   81 (260)
T Consensus         1 ~y~F~~~All~~ll~~~~~~~lG~~vv~rr~s~~~~alsH~al~Giala~~l~~~~~l~a~~~~~l~a~~i~~l~~~~~~   80 (258)
T pfam00950         1 QYEFMQRALLASILVSLACGILGSFLVLRRQSLMGDALSHAVLPGVALAFFLGINPLIGAFLFGLIAAVAIGYLRRNSRL   80 (258)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             96579999999999999999998999995099998899999999999999992319999999999999999999851676


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             04569999999999999999962132001333443332442287670589999899999998424566541288899998
Q gi|254780719|r   82 SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKA  161 (260)
Q Consensus        82 ~~da~igi~~s~~~alg~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~A~~  161 (260)
T Consensus        81 ~~da~igi~~s~~~algvll~s~~~~~~~~~~~~LfG~il~v~~~dl~~~~~~~~~~l~~~~~~~r~l~~~~fD~~~A~~  160 (258)
T pfam00950        81 KEDTAIGIVFSSFLALGLLLISLIKGSAVDLDHYLFGNILGISQEDLIQIAIITAIILLLLLLFWKELLLITFDPDHAKV  160 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             04799999999999999999975678765523787336976787789999999999999999999999999608999998


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             08981067769999999999999999889999999999999999741998999999999999999999999999558808
Q gi|254780719|r  162 EGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG  241 (260)
Q Consensus       162 ~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~~~lp~g  241 (260)
T Consensus       161 ~Gi~~~~~~~~~~~lial~vv~~~~~vG~lLv~allv~Paa~A~~~s~s~~~~~~~s~~~~~~~~~~Gl~lS~~~~lp~g  240 (258)
T pfam00950       161 IGLPVQFLYLLLLILLALTIVVAMQAVGAILVIALLITPAATARLLTRSFESMMLIASAIGMVSSVAGLLLSYYFDTPTG  240 (258)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             28861378999999999999999999999999999997999999997799999999999999999999999998299904


Q ss_pred             HHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999998723
Q gi|254780719|r  242 PSIIITSLFLFILSFFYK  259 (260)
Q Consensus       242 ~~Iv~~~~~~f~~~~~~~  259 (260)
T Consensus       241 ~~Iv~~~~~~f~~~~~fs  258 (258)
T pfam00950       241 PVIVLIATLLFLISFAFA  258 (258)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999979