HHsearch alignment of GI: 254780719 and MMDB domain: 2nq2_A_1-93_262-307

>2nq2_A (A:1-93,A:262-307) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}
Probab=93.45  E-value=0.37  Score=24.04  Aligned_cols=61  Identities=13%  Similarity=0.252  Sum_probs=51.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999889999----------999999999999741998999999999999999999999999
Q gi|254780719|r  174 IMITSLMISVSIKFIGITLI----------TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI  235 (260)
Q Consensus       174 ~~l~al~v~~~v~~vG~llv----------~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~  235 (260)
                      -++.++.+..+....|.++-          ++ ++.|+...+..++++|..++.|.++|.......-.+|-.
T Consensus        65 R~l~a~lvGa~LaiaG~imQ~l~RNPLAdFvG-LivPHi~r~lvG~~~~~~ip~s~l~Ga~~l~~aD~~~R~  135 (139)
T 2nq2_A           65 RILTALCVGAGLALSGVVLQGIFRNPLVNWVG-LIIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNVARS  135 (139)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCTTCCSST-THHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999860489898889-879999999618886419999999999999999999856