BLAST/PSIBLAST alignment of GI: 254780719 and GI: 116252918 at iteration 1
>gi|116252918|ref|YP_768756.1| high-affinity zinc uptake system membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 271
>gi|115257566|emb|CAK08663.1| putative high-affinity zinc uptake system membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 271
 Score =  324 bits (831), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 213/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLLAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSPTPEIMAVLASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255