BLAST/PSIBLAST alignment of GI: 254780719 and GI: 209549966 at iteration 1
>gi|209549966|ref|YP_002281883.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 271
>gi|209535722|gb|ACI55657.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 271
 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 213/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV++TDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSSTDIALIWGGGLFVLVAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSATPEIMAVLASVIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255