BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter,
permease protein [Candidatus Liberibacter asiaticus str. psy62]
         (260 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040396|gb|ACT57192.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 260

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC
Sbjct: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI
Sbjct: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM
Sbjct: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS
Sbjct: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSIIITSLFLFILSFFYKK
Sbjct: 241 GPSIIITSLFLFILSFFYKK 260


>gi|315121884|ref|YP_004062373.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495286|gb|ADR51885.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 263

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/256 (81%), Positives = 238/256 (92%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +YNEFFIRALF+GIGI+LSTGPLGCFI+WQR+ YFGDTIAHSALLGVA SL+  LPL +C
Sbjct: 2   IYNEFFIRALFAGIGIILSTGPLGCFIVWQRMTYFGDTIAHSALLGVAFSLMLNLPLPLC 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           IFM+A LTS++LLQIQK+E ++SDAILGVITHSTIS++L++LSFM WVNTDLTSFLFGDI
Sbjct: 62  IFMVAALTSIILLQIQKSEFIASDAILGVITHSTISISLIMLSFMTWVNTDLTSFLFGDI 121

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+NT DI++IW +G LNI+IL KIWK LLATTVNYELAKAEGMQPEK+KLIF MIT+LM
Sbjct: 122 LAINTNDIIIIWSVGILNIVILIKIWKSLLATTVNYELAKAEGMQPEKVKLIFTMITALM 181

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           IS+SIKFIGITLITSLLILPTVTARRF+TSPENM IL T+IGILG+I+GLYGSLIFDTPS
Sbjct: 182 ISISIKFIGITLITSLLILPTVTARRFATSPENMVILTTVIGILGVILGLYGSLIFDTPS 241

Query: 241 GPSIIITSLFLFILSF 256
           GPSIIITSL  FILSF
Sbjct: 242 GPSIIITSLIFFILSF 257


>gi|241205422|ref|YP_002976518.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859312|gb|ACS56979.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 271

 Score =  325 bits (832), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 214/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLVAMAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSPTPEIMAVLASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255


>gi|116252918|ref|YP_768756.1| high-affinity zinc uptake system membrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257566|emb|CAK08663.1| putative high-affinity zinc uptake system membrane protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 271

 Score =  324 bits (831), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 213/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLLAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSPTPEIMAVLASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255


>gi|327188698|gb|EGE55898.1| zinc uptake ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 316

 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 212/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 46  MLDDFFVRAILAGIGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 105

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 106 VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 165

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 166 LAVSTTDIALIWGGGLFVLVALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 225

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG   ++ GL+GSL +DTPS
Sbjct: 226 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAAAVVGGLFGSLTYDTPS 285

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 286 GPSIVVAALVLFILS 300


>gi|209549966|ref|YP_002281883.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535722|gb|ACI55657.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 271

 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 213/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV++TDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSSTDIALIWGGGLFVLVAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSATPEIMAVLASVIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255


>gi|190892433|ref|YP_001978975.1| zinc ABC transporter permease [Rhizobium etli CIAT 652]
 gi|190697712|gb|ACE91797.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 271

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 212/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLVALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALVLFILS 255


>gi|86358316|ref|YP_470208.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CFN
           42]
 gi|86282418|gb|ABC91481.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CFN
           42]
          Length = 270

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 211/255 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   +  +  +W+PLLA TVN ELA+AEG++PE  +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLAAIAWLWRPLLAATVNAELAEAEGLRPEGARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVLASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255


>gi|218673631|ref|ZP_03523300.1| zinc uptake ABC transporter, permease protein [Rhizobium etli GR56]
          Length = 271

 Score =  322 bits (825), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 211/255 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TDI LIWG G   +  L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSRTDIALIWGGGLFVLAALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALILFILS 255


>gi|325292920|ref|YP_004278784.1| High-affinity zinc uptake system membrane protein znuB
           [Agrobacterium sp. H13-3]
 gi|325060773|gb|ADY64464.1| High-affinity zinc uptake system membrane protein znuB
           [Agrobacterium sp. H13-3]
          Length = 272

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 212/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +GIG+ L+ GPLGCF++W+R+AYFGDT+AHSALLGVALSL+ Q+ L + 
Sbjct: 1   MFDDFFVRAMIAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLLLQINLIVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++L+ +Q+ +ALS+DA+LG+++HS +++ LVI++FM WV  DL SFLFGDI
Sbjct: 61  VFLVASAVSILLIFLQRRQALSADALLGILSHSALAIGLVIVAFMSWVRIDLVSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +DI LIWG G + ++ +  +W+ LLA+TVN ELA+AEG+ PE+ KLIF ++ +L+
Sbjct: 121 LAVTRSDIALIWGGGLVVLVSMVFLWRSLLASTVNTELAEAEGLNPERAKLIFTLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MA++A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGIMLITSLLIIPAATARRFSSTPEVMAVVASLIGAVAVVGGLFGSLSYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ ++ LF++S
Sbjct: 241 GPSIVVAAVILFVIS 255


>gi|15965666|ref|NP_386019.1| high-affinity zinc uptake system membrane ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307315675|ref|ZP_07595204.1| ABC-3 protein [Sinorhizobium meliloti BL225C]
 gi|307321424|ref|ZP_07600822.1| ABC-3 protein [Sinorhizobium meliloti AK83]
 gi|15074847|emb|CAC46492.1| Probable high-affinity zinc uptake system membrane ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306892969|gb|EFN23757.1| ABC-3 protein [Sinorhizobium meliloti AK83]
 gi|306898662|gb|EFN29327.1| ABC-3 protein [Sinorhizobium meliloti BL225C]
          Length = 275

 Score =  295 bits (754), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 205/255 (80%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+  L L + 
Sbjct: 1   MLDDFFIRALVAGIGIAMVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLMDLNLMVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A++ S++LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFIVASVVSVLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI ++WG G L I  L  +W+PLLA+TVN ELA+AEG+ PE+ +  F+++ +L+
Sbjct: 121 LAVSRADIDIVWGGGILVIFALVYLWRPLLASTVNPELAEAEGLNPERARFFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRF++SPE MA+ A++IG + +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFASSPEVMAVCASLIGAVAVAGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF+LS
Sbjct: 241 GPSIVVAALVLFVLS 255


>gi|159184796|ref|NP_354525.2| ABC transporter, membrane spanning protein (zinc) [Agrobacterium
           tumefaciens str. C58]
 gi|159140084|gb|AAK87310.2| ABC transporter, membrane spanning protein (zinc) [Agrobacterium
           tumefaciens str. C58]
          Length = 272

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 212/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +GIG+ L+ GPLGCF++W+R+AYFGDT+AHSALLGVALSL+ QL L + 
Sbjct: 1   MFDDFFVRAMVAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLLLQLNLIVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++L+ +Q+ +ALSSDA+LG+++HS +++ LVI++FM WV  DL SFLFGDI
Sbjct: 61  VFLVASAVSILLIFLQRRQALSSDALLGILSHSALAIGLVIVAFMSWVRIDLVSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +DI LIWG G + I+ +  +W+ LLA+TVN ELA+AEG+ PE+ KLIF ++ +L+
Sbjct: 121 LAVTRSDIALIWGGGLVVIVSMVFLWRSLLASTVNTELAEAEGLNPERSKLIFTLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MA++A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGIMLITSLLIIPAATARRFSSTPEVMAVVASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ ++ LF++S
Sbjct: 241 GPSIVVAAVILFVIS 255


>gi|163759796|ref|ZP_02166880.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Hoeflea phototrophica DFL-43]
 gi|162282754|gb|EDQ33041.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Hoeflea phototrophica DFL-43]
          Length = 295

 Score =  288 bits (737), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 130/255 (50%), Positives = 195/255 (76%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RA+ +GIG+ L  GPLGCFI+W+R+AYFGDT++H+ALLGVAL+ +F++ +T+ 
Sbjct: 13  MLDDFFTRAVLAGIGVALVAGPLGCFIVWRRLAYFGDTLSHAALLGVALAFLFEINITLA 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F ++   S+ LL +QK   LSSDA+LG++ HS ++L LV+L+FM WV  DL  FLFGDI
Sbjct: 73  VFAVSACVSIALLLLQKRATLSSDALLGLLAHSALALGLVVLAFMTWVRMDLMGFLFGDI 132

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IW  G + ++IL  IW+P  A TVN ELA+AE M P++  +IF+++ + +
Sbjct: 133 LAVSRIDVGIIWLGGAIVLVILALIWRPFFAATVNRELAEAENMNPDRANIIFMLLMAAV 192

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+K +G+ LIT++LI+P   ARRF++ PE MAILA +IG   ++ GL+GSL +DTP+
Sbjct: 193 IAISMKIVGVLLITAMLIIPAAAARRFASGPEQMAILAAVIGAASVVGGLFGSLEWDTPA 252

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF+LS
Sbjct: 253 GPSIVVAALGLFVLS 267


>gi|306845404|ref|ZP_07477978.1| zinc ABC transporter, permease protein [Brucella sp. BO1]
 gi|306274147|gb|EFM55963.1| zinc ABC transporter, permease protein [Brucella sp. BO1]
          Length = 286

 Score =  288 bits (736), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVISGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|256252720|ref|ZP_05458256.1| zinc ABC transporter, permease protein [Brucella ceti B1/94]
 gi|261219798|ref|ZP_05934079.1| zinc ABC transporter permease [Brucella ceti B1/94]
 gi|260918382|gb|EEX85035.1| zinc ABC transporter permease [Brucella ceti B1/94]
          Length = 284

 Score =  288 bits (736), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|225628414|ref|ZP_03786448.1| ABC 3 transport family protein [Brucella ceti str. Cudo]
 gi|237817488|ref|ZP_04596479.1| ABC 3 transport family protein [Brucella abortus str. 2308 A]
 gi|225616260|gb|EEH13308.1| ABC 3 transport family protein [Brucella ceti str. Cudo]
 gi|237787323|gb|EEP61540.1| ABC 3 transport family protein [Brucella abortus str. 2308 A]
          Length = 292

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 140/255 (54%), Positives = 204/255 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 22  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 81

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 82  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 141

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 142 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 201

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 202 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 261

Query: 243 SIIITSLFLFILSFF 257
           SI++ +L +FILS  
Sbjct: 262 SIVVAALAIFILSLL 276


>gi|222086277|ref|YP_002544809.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
 gi|221723725|gb|ACM26881.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
          Length = 275

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 212/255 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTI+HSALLGVALSL+FQL LT+ 
Sbjct: 1   MFDDFFLRAVVAGVGLALTTGPLGCFIIWRRMAYFGDTISHSALLGVALSLLFQLNLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +Q+ +ALS+DA+LG+++H+T+++ LVI++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSILLLFLQRRQALSADALLGILSHATLAIGLVIVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +IWG G   +  +  +W+PLLA+TVN ELA+AEG++PE+ KL F+++ +++
Sbjct: 121 LAVSRADIAMIWGGGLFVLAAIAWLWRPLLASTVNPELAEAEGLRPERAKLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LIT+LLI+P  TARRF+ +PE MA+ A+++G + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITALLIIPAATARRFAATPEMMAVFASLVGAVAVVGGLFGSLRYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFI S
Sbjct: 241 GPSIVVAALILFIFS 255


>gi|17988520|ref|NP_541153.1| high-affinity zinc uptake system membrane protein ZNUB [Brucella
           melitensis bv. 1 str. 16M]
 gi|260544127|ref|ZP_05819948.1| ABC transporter, family 3 [Brucella abortus NCTC 8038]
 gi|260759378|ref|ZP_05871726.1| ABC 3 transporter [Brucella abortus bv. 4 str. 292]
 gi|261216561|ref|ZP_05930842.1| ABC-3 protein [Brucella ceti M13/05/1]
 gi|261313966|ref|ZP_05953163.1| ABC-3 protein [Brucella pinnipedialis M163/99/10]
 gi|261749687|ref|ZP_05993396.1| ABC 3 type transporter [Brucella suis bv. 5 str. 513]
 gi|261752931|ref|ZP_05996640.1| ABC-3 type transporter [Brucella suis bv. 3 str. 686]
 gi|265989286|ref|ZP_06101843.1| ABC-3 protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265996861|ref|ZP_06109418.1| ABC-3 protein [Brucella ceti M490/95/1]
 gi|265998975|ref|ZP_06111513.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|17984313|gb|AAL53417.1| high-affinity zinc uptake system membrane protein znub [Brucella
           melitensis bv. 1 str. 16M]
 gi|260097398|gb|EEW81272.1| ABC transporter, family 3 [Brucella abortus NCTC 8038]
 gi|260669696|gb|EEX56636.1| ABC 3 transporter [Brucella abortus bv. 4 str. 292]
 gi|260921650|gb|EEX88218.1| ABC-3 protein [Brucella ceti M13/05/1]
 gi|261302992|gb|EEY06489.1| ABC-3 protein [Brucella pinnipedialis M163/99/10]
 gi|261739440|gb|EEY27366.1| ABC 3 type transporter [Brucella suis bv. 5 str. 513]
 gi|261742684|gb|EEY30610.1| ABC-3 type transporter [Brucella suis bv. 3 str. 686]
 gi|262551158|gb|EEZ07319.1| ABC-3 protein [Brucella ceti M490/95/1]
 gi|262999955|gb|EEZ12645.1| ABC-3 protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091478|gb|EEZ16014.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
          Length = 284

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 14  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 74  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 134 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 194 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 253

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 254 SIVVAALAIFILS 266


>gi|62317943|ref|YP_223796.1| zinc ABC transporter permease [Brucella abortus bv. 1 str. 9-941]
 gi|83269920|ref|YP_419211.1| sodium/dicarboxylate ABC transporter [Brucella melitensis biovar
           Abortus 2308]
 gi|161621166|ref|YP_001595052.1| 29 kDa membrane protein in psaA 5'region [Brucella canis ATCC
           23365]
 gi|163845443|ref|YP_001623098.1| hypothetical protein BSUIS_B1351 [Brucella suis ATCC 23445]
 gi|189023194|ref|YP_001932935.1| ABC transporter, family 3 [Brucella abortus S19]
 gi|225686871|ref|YP_002734843.1| zinc ABC transporter permease [Brucella melitensis ATCC 23457]
 gi|254691627|ref|ZP_05154881.1| zinc ABC transporter, permease protein [Brucella abortus bv. 6 str.
           870]
 gi|254698174|ref|ZP_05160002.1| zinc ABC transporter, permease protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254699249|ref|ZP_05161077.1| zinc ABC transporter, permease protein [Brucella suis bv. 5 str.
           513]
 gi|254702368|ref|ZP_05164196.1| zinc ABC transporter, permease protein [Brucella suis bv. 3 str.
           686]
 gi|254706511|ref|ZP_05168339.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711204|ref|ZP_05173015.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           B2/94]
 gi|254711805|ref|ZP_05173616.1| zinc ABC transporter, permease protein [Brucella ceti M644/93/1]
 gi|254714873|ref|ZP_05176684.1| zinc ABC transporter, permease protein [Brucella ceti M13/05/1]
 gi|254731619|ref|ZP_05190197.1| zinc ABC transporter, permease protein [Brucella abortus bv. 4 str.
           292]
 gi|256015884|ref|YP_003105893.1| zinc ABC transporter, permease protein [Brucella microti CCM 4915]
 gi|256030167|ref|ZP_05443781.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           M292/94/1]
 gi|256042849|ref|ZP_05445795.1| zinc ABC transporter, permease protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059820|ref|ZP_05450014.1| zinc ABC transporter, permease protein [Brucella neotomae 5K33]
 gi|256112191|ref|ZP_05453112.1| zinc ABC transporter, permease protein [Brucella melitensis bv. 3
           str. Ether]
 gi|256158350|ref|ZP_05456250.1| zinc ABC transporter, permease protein [Brucella ceti M490/95/1]
 gi|256256814|ref|ZP_05462350.1| zinc ABC transporter, permease protein [Brucella abortus bv. 9 str.
           C68]
 gi|260166782|ref|ZP_05753593.1| zinc ABC transporter, permease protein [Brucella sp. F5/99]
 gi|260564088|ref|ZP_05834573.1| ABC transporter, family 3 [Brucella melitensis bv. 1 str. 16M]
 gi|260568729|ref|ZP_05839198.1| ABC transporter, family 3 [Brucella suis bv. 4 str. 40]
 gi|260757257|ref|ZP_05869605.1| ABC 3 transporter [Brucella abortus bv. 6 str. 870]
 gi|260762621|ref|ZP_05874953.1| ABC 3 transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883061|ref|ZP_05894675.1| zinc ABC transporter permease [Brucella abortus bv. 9 str. C68]
 gi|261318795|ref|ZP_05957992.1| ABC-3 protein [Brucella pinnipedialis B2/94]
 gi|261319432|ref|ZP_05958629.1| ABC-3 protein [Brucella ceti M644/93/1]
 gi|261323799|ref|ZP_05962996.1| zinc ABC transporter permease [Brucella neotomae 5K33]
 gi|261756158|ref|ZP_05999867.1| ABC transporter [Brucella sp. F5/99]
 gi|265987198|ref|ZP_06099755.1| zinc ABC transporter permease [Brucella pinnipedialis M292/94/1]
 gi|265993618|ref|ZP_06106175.1| zinc ABC transporter permease [Brucella melitensis bv. 3 str.
           Ether]
 gi|294852953|ref|ZP_06793625.1| zinc transport system permease [Brucella sp. NVSL 07-0026]
 gi|297250165|ref|ZP_06933866.1| zinc transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|62198136|gb|AAX76435.1| ZnuB, zinc ABC transporter, permease protein [Brucella abortus bv.
           1 str. 9-941]
 gi|82940194|emb|CAJ13247.1| ABC transporter, family 3:Sodium:dicarboxylate symporter [Brucella
           melitensis biovar Abortus 2308]
 gi|161337977|gb|ABX64281.1| 29 kDa membrane protein in psaA 5'region [Brucella canis ATCC
           23365]
 gi|163676166|gb|ABY40276.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021768|gb|ACD74489.1| ABC transporter, family 3 [Brucella abortus S19]
 gi|225642976|gb|ACO02889.1| zinc ABC transporter, permease protein [Brucella melitensis ATCC
           23457]
 gi|255998544|gb|ACU50231.1| zinc ABC transporter, permease protein [Brucella microti CCM 4915]
 gi|260151731|gb|EEW86824.1| ABC transporter, family 3 [Brucella melitensis bv. 1 str. 16M]
 gi|260155394|gb|EEW90475.1| ABC transporter, family 3 [Brucella suis bv. 4 str. 40]
 gi|260673042|gb|EEX59863.1| ABC 3 transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677365|gb|EEX64186.1| ABC 3 transporter [Brucella abortus bv. 6 str. 870]
 gi|260872589|gb|EEX79658.1| zinc ABC transporter permease [Brucella abortus bv. 9 str. C68]
 gi|261292122|gb|EEX95618.1| ABC-3 protein [Brucella ceti M644/93/1]
 gi|261298018|gb|EEY01515.1| ABC-3 protein [Brucella pinnipedialis B2/94]
 gi|261299779|gb|EEY03276.1| zinc ABC transporter permease [Brucella neotomae 5K33]
 gi|261736142|gb|EEY24138.1| ABC transporter [Brucella sp. F5/99]
 gi|262764488|gb|EEZ10520.1| zinc ABC transporter permease [Brucella melitensis bv. 3 str.
           Ether]
 gi|264659395|gb|EEZ29656.1| zinc ABC transporter permease [Brucella pinnipedialis M292/94/1]
 gi|294818608|gb|EFG35608.1| zinc transport system permease [Brucella sp. NVSL 07-0026]
 gi|297174034|gb|EFH33398.1| zinc transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|326411287|gb|ADZ68351.1| ABC transporter, family 3 [Brucella melitensis M28]
 gi|326554576|gb|ADZ89215.1| ABC transporter, family 3 [Brucella melitensis M5-90]
          Length = 286

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|23500839|ref|NP_700279.1| zinc ABC transporter permease [Brucella suis 1330]
 gi|23464502|gb|AAN34284.1| zinc ABC transporter, permease protein [Brucella suis 1330]
          Length = 286

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|150396899|ref|YP_001327366.1| ABC-3 protein [Sinorhizobium medicae WSM419]
 gi|150028414|gb|ABR60531.1| ABC-3 protein [Sinorhizobium medicae WSM419]
          Length = 275

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 207/255 (81%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+  L L + 
Sbjct: 1   MLDDFFIRALVAGIGIAMVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLMDLNLMVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFVVASAVSVLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI ++WG G L +  L  +W+PLLA+TVN ELA+AEG++PE+ +L F+++ +L+
Sbjct: 121 LAVSRADIDIVWGGGILVVFALVYLWRPLLASTVNPELAEAEGLKPERARLFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS+SPE MA+LA++IG + +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFSSSPETMAVLASLIGAVAVAGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF+LS
Sbjct: 241 GPSIVVAALALFVLS 255


>gi|265985846|ref|ZP_06098581.1| ABC-3 protein [Brucella sp. 83/13]
 gi|264664438|gb|EEZ34699.1| ABC-3 protein [Brucella sp. 83/13]
          Length = 284

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 14  DDFFTRAIIAGIGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 74  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 134 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 194 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 253

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 254 SIVVAALAIFILS 266


>gi|306841290|ref|ZP_07474001.1| zinc ABC transporter, permease protein [Brucella sp. BO2]
 gi|306288692|gb|EFM60023.1| zinc ABC transporter, permease protein [Brucella sp. BO2]
          Length = 286

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWQPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|254720787|ref|ZP_05182598.1| zinc ABC transporter, permease protein [Brucella sp. 83/13]
 gi|306838500|ref|ZP_07471339.1| zinc ABC transporter, permease protein [Brucella sp. NF 2653]
 gi|306406421|gb|EFM62661.1| zinc ABC transporter, permease protein [Brucella sp. NF 2653]
          Length = 286

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|153011493|ref|YP_001372707.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563381|gb|ABS16878.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
          Length = 273

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 206/262 (78%), Gaps = 2/262 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RA+ +G+G+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + + I 
Sbjct: 1   MLDDFFTRAIIAGVGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINMMIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDI
Sbjct: 61  VFAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLVAFMTWVRVDLLSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI  I+G G   + +L  +W+P LA TV+ ++A+AEGM P   +++F+++ +++
Sbjct: 121 LAVSRMDIAFIYGGGVFVLAVLAWLWRPFLAATVSEDIARAEGMNPALSRIVFMLLLAIV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MAILA++IG  G+I GLYGS+ FDTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFSSTPEQMAILASLIGAAGVIGGLYGSIHFDTPS 240

Query: 241 GPSIIITSLFLFILSF--FYKK 260
           GPSI++ +L +FILS    +K+
Sbjct: 241 GPSIVVAALAIFILSLLPLHKR 262


>gi|222148616|ref|YP_002549573.1| ABC transporter membrane spanning protein (zinc) [Agrobacterium
           vitis S4]
 gi|221735602|gb|ACM36565.1| ABC transporter membrane spanning protein (zinc) [Agrobacterium
           vitis S4]
          Length = 270

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 135/255 (52%), Positives = 206/255 (80%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +G+G+ L+ GPLGCF+IW+R+AYFGDT+AHS+LLGVALSL+F + LT+ 
Sbjct: 1   MMDDFFVRALLAGVGLALTVGPLGCFVIWRRMAYFGDTMAHSSLLGVALSLLFSVNLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A + SL+LL +Q    LS+DA+LG+++H+T+++ LV+++FM WV  DL ++LFGDI
Sbjct: 61  VFLVAAIVSLLLLLLQNRRGLSADALLGILSHATLAIGLVLVAFMTWVRVDLMAYLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   DI  +W  G   I+ L  +W+PLLA TVN ++A+AEG++P + +LIF+++ +++
Sbjct: 121 LAVTPQDIATVWIGGLGVILCLCLLWRPLLAATVNEDVAEAEGLRPARARLIFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LIT+LLI+P  TARRFS +PE MA+LA++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGILLITALLIIPAATARRFSMTPEIMAVLASVIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LFILS
Sbjct: 241 GPSIVVAALVLFILS 255


>gi|261215429|ref|ZP_05929710.1| ABC 3 transporter [Brucella abortus bv. 3 str. Tulya]
 gi|260917036|gb|EEX83897.1| ABC 3 transporter [Brucella abortus bv. 3 str. Tulya]
          Length = 284

 Score =  284 bits (727), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 14  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++++T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 74  AVAVAISAILLLLQRRHTLSADSLLGILSYATLSLGLVLMAFMTWVRVDLLSFLFGDILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 134 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 194 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 253

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 254 SIVVAALAIFILS 266


>gi|239834412|ref|ZP_04682740.1| ABC 3 transport family protein [Ochrobactrum intermedium LMG 3301]
 gi|239822475|gb|EEQ94044.1| ABC 3 transport family protein [Ochrobactrum intermedium LMG 3301]
          Length = 299

 Score =  284 bits (727), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 137/260 (52%), Positives = 205/260 (78%), Gaps = 2/260 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +G+G+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+L+F + L I +F
Sbjct: 29  DDFFTRAIIAGVGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALVFDINLMIGVF 88

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 89  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLVAFMTWVRVDLLSFLFGDILA 148

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G   + +L  +W+P LA TV+ ++A+AEGM P   +++F+++ +++I+
Sbjct: 149 VSRMDIAFIYGGGVFVLAVLAWLWRPFLAATVSEDIARAEGMNPALSRIVFMLLLAIVIA 208

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MAILA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 209 IAMKIVGILLITSLLIIPAATARRFASTPEQMAILASLIGAAGVIGGLYGSIHFDTPSGP 268

Query: 243 SIIITSLFLFILSF--FYKK 260
           SI++ +L +FILS    +K+
Sbjct: 269 SIVVAALAIFILSLLPLHKR 288


>gi|254695077|ref|ZP_05156905.1| zinc ABC transporter, permease protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 286

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 204/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++++T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSYATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|227822309|ref|YP_002826280.1| zinc ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
 gi|227341309|gb|ACP25527.1| zinc ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
          Length = 273

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 150/255 (58%), Positives = 209/255 (81%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+ +L L I 
Sbjct: 1   MLDDFFVRALVAGIGIAVVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLLELNLMIS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  SL+LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFIVASAVSLLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +IWG G L I+ L  +W+PLLA+TVN ELA+AEG++PE+ +L F+++ +L+
Sbjct: 121 LAVSEADIDIIWGGGILVILSLVYLWRPLLASTVNPELAEAEGLKPERARLFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRF+TSPE MAI+A++IG L +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFATSPEVMAIIASLIGALAVTGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF+LS
Sbjct: 241 GPSIVVAALALFVLS 255


>gi|148558596|ref|YP_001257989.1| zinc ABC transporter permease [Brucella ovis ATCC 25840]
 gi|148369881|gb|ABQ62753.1| zinc ABC transporter, permease protein [Brucella ovis ATCC 25840]
          Length = 286

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 203/253 (80%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +F
Sbjct: 16  DDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGVF 75

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDILA
Sbjct: 76  AVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDILA 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  DI  I+G G L +  L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I+
Sbjct: 136 VSRIDIAFIYGGGALILAALAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSGP
Sbjct: 196 IAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSGP 255

Query: 243 SIIITSLFLFILS 255
           SI++ +L +FILS
Sbjct: 256 SIVVAALAIFILS 268


>gi|218678262|ref|ZP_03526159.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CIAT
           894]
          Length = 213

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 174/212 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+T DI LIWG G   +  L  +W PLLA TVN ELA+AEG++PE+ +  F+++ +++
Sbjct: 121 LAVSTRDIALIWGGGLFVLAALAWLWTPLLAATVNAELAEAEGLKPERARFFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPE 212
           I++++K +GI LITSLLI+P   ARRFS +PE
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPE 212


>gi|110636328|ref|YP_676536.1| hypothetical protein Meso_4004 [Mesorhizobium sp. BNC1]
 gi|110287312|gb|ABG65371.1| ABC-3 protein [Chelativorans sp. BNC1]
          Length = 273

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/255 (54%), Positives = 202/255 (79%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ +  GPLGCF++W+R+AYFGDT+AHSALLGVALS +F++ LT  
Sbjct: 1   MLDDFFTRALVAGIGLAMVVGPLGCFVVWRRMAYFGDTMAHSALLGVALSFLFEINLTAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A L SL LL +Q++  LS+DA+LG+++HST++L LV+++FM W+  DL +FLFGDI
Sbjct: 61  VFVVAALASLALLFLQRHGTLSTDALLGILSHSTLALGLVMVAFMSWIRIDLMAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +I+G G L +++L  +W+PLLA TVN E+A AEGM+PE+ + IF+++ + M
Sbjct: 121 LAVSRMDIAMIYGGGALVLLVLAWLWRPLLAATVNPEIAAAEGMRPERARFIFMLLMAAM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P    RRF+++PE MAI A+I G + +I GL  SL FDTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAGRRFASTPEIMAIAASIAGAIAVIGGLTASLQFDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF+LS
Sbjct: 241 GPSIVVAALILFLLS 255


>gi|254456376|ref|ZP_05069805.1| ABC transporter, membrane spanning protein (zinc) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083378|gb|EDZ60804.1| ABC transporter, membrane spanning protein (zinc) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 267

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 189/247 (76%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FFIRALF+GIGI L TGPLGCF++W+R++YFGDT+AHSALLGV ++  F L + I 
Sbjct: 1   MFDDFFIRALFAGIGIALVTGPLGCFVVWRRLSYFGDTLAHSALLGVTIAYTFDLNIAIS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+I+++ +L+L+Q+QK   L  DA+LG++ HS++++ LV++ F+ ++  D+   LFGDI
Sbjct: 61  VFLISSIIALILIQLQKKTNLPGDALLGLLAHSSLAVGLVVIGFLTFIRFDIMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVN  DIL+IW  G + +++L  IWKPL A+TVNYELA+AEG+ P++ K IF ++ + +
Sbjct: 121 LAVNINDILIIWSGGAIILIVLKLIWKPLFASTVNYELAEAEGLNPDRAKAIFTILMAAV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++SIK +G+ LIT +LI+P   AR  S SP+ M I + I G+L +++GL+ SL F+T S
Sbjct: 181 IAISIKMVGLLLITGMLIIPAAMARNISDSPQKMVIYSIIGGLLSVVLGLFTSLEFNTSS 240

Query: 241 GPSIIIT 247
           GPSII+ 
Sbjct: 241 GPSIIVA 247


>gi|330814341|ref|YP_004358580.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487436|gb|AEA81841.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 261

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 199/260 (76%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +G+GI L TGPLGCF+IW+R+++FGDT++H+ALLGV  S+ F + +++ 
Sbjct: 1   MIDDFFIRALIAGVGIALVTGPLGCFVIWRRLSFFGDTLSHAALLGVTFSISFDINISLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+++++ +++L+++QKN  L+ DA+LG++ HS++++ LV+L F+ ++  D+   LFGDI
Sbjct: 61  VFIVSSIVAIILIRLQKNTNLAGDALLGLLAHSSLAIGLVVLGFLSFIRFDIMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V  +D+L+IW  G + I+IL  IWKPL A+TVNYE+A+AEG+ PEK  ++F ++ + +
Sbjct: 121 LSVTLSDLLIIWIGGAVIILILSLIWKPLFASTVNYEIAEAEGLSPEKYNILFTILMAAI 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++SIK +G+ LIT ++I+P   AR  S SP+ M I++ I G+L ++IGLY SL  +TPS
Sbjct: 181 IAISIKMVGLLLITGMMIIPAAAARNLSNSPKQMVIISIIFGLLSVLIGLYASLEINTPS 240

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSII TSL  FILS F  K
Sbjct: 241 GPSIITTSLLFFILSLFRLK 260


>gi|294085792|ref|YP_003552552.1| zinc ABC transporter membrane spanning protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665367|gb|ADE40468.1| ABC transporter, membrane spanning protein, zinc [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 285

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 198/255 (77%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+  GIG+ L  GPLGCFIIW+++AYFGDT++HSALLGVAL+L+F++ +T+ 
Sbjct: 1   MFDDFFVRAVIGGIGVALVAGPLGCFIIWRKLAYFGDTLSHSALLGVALALLFEVNVTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+++   SL+L+ +Q+  +LSSDA+LG++ HS +++ LV L+FM WV  DL  FLFGDI
Sbjct: 61  VFVVSVAVSLMLVFLQRRASLSSDALLGLLAHSALAVGLVTLAFMTWVRVDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L++ T D+ +IWG G   +++L  IW+ L A TV+YELA AEG +P+ + +IF+++ + +
Sbjct: 121 LSITTFDLAIIWGGGMSVLVVLMVIWRALFAATVSYELALAEGAKPDHVNIIFMILMAGV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+VS+K +G+ LIT+LLI+P  TARR S+SPE MA  A +IG++ +  GL+GSL  DTP+
Sbjct: 181 IAVSLKIVGVLLITALLIIPAATARRLSSSPEQMAFFAILIGVISVWFGLFGSLELDTPA 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L  FILS
Sbjct: 241 GPSIVVAALICFILS 255


>gi|117926459|ref|YP_867076.1| ABC transporter [Magnetococcus sp. MC-1]
 gi|117610215|gb|ABK45670.1| ABC-3 protein [Magnetococcus sp. MC-1]
          Length = 272

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 190/256 (74%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+N+F + A  +G+G+ L +GPLGCF++W+R+AYFGDT+AH ALLGVAL LI  L LT+ 
Sbjct: 1   MWNDFMLLAWVAGVGVALVSGPLGCFVVWRRMAYFGDTMAHGALLGVALGLIMALNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++    +L+LL +Q N  +S D +LG+++HS +SL LV LSFM  +  DL ++LFGDI
Sbjct: 61  VVLVCIAIALILLMLQSNSRVSGDTLLGILSHSALSLGLVGLSFMSGLRVDLMAYLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+  I+G G L +++L++IW PLLA T++  LA+AEG+   +I+LIF+++ +++
Sbjct: 121 LAVSWQDLGWIYGGGALVLLLLWRIWNPLLALTLHEGLARAEGVPVTQIRLIFMLLIAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+V++K +GI LITSLLI+P   AR  S SPE MA  A ++G+L +  GL+GSL +DTPS
Sbjct: 181 IAVAMKIVGILLITSLLIVPAAAARNLSRSPEQMAGWAVVVGVLAVSGGLWGSLNWDTPS 240

Query: 241 GPSIIITSLFLFILSF 256
           GPSI++  L LF+LS 
Sbjct: 241 GPSIVVVGLGLFLLSL 256


>gi|328544323|ref|YP_004304432.1| Zinc ABC transporter permease [polymorphum gilvum SL003B-26A1]
 gi|326414065|gb|ADZ71128.1| Zinc ABC transporter, permease protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 281

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 190/255 (74%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ L  GPLGCFI+W+R+AYFGDT++H+ALLGVAL+ + Q+ +T  
Sbjct: 1   MLDDFFTRALVAGIGVALVAGPLGCFIVWRRLAYFGDTLSHAALLGVALAFLLQVDITFA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++  L SL+LL +Q+   LSSDA+LG++ HS+++L LV L+FM WV  DL  FLFGDI
Sbjct: 61  VFVVCALVSLLLLVLQRRGTLSSDALLGLLAHSSLALGLVCLAFMTWVRMDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V+  DI +I+  G   + +L  IW+PL A TV+ ELA+AEGM P +  L+F+++ + +
Sbjct: 121 LSVSRLDITVIYLGGAAVLGVLAWIWRPLFAATVSVELAEAEGMNPRRANLVFMLLMAGV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +G+ LIT+LLI+P  TARR S+ PE MA LA + G   +  GLYGSL FDTPS
Sbjct: 181 IAIAMKIVGVLLITALLIIPAATARRLSSGPEQMAALAALAGATAVGAGLYGSLAFDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ ++ LF +S
Sbjct: 241 GPSIVVAAMGLFGVS 255


>gi|262276954|ref|ZP_06054747.1| high-affinity zinc uptake system membrane protein ZnuB [alpha
           proteobacterium HIMB114]
 gi|262224057|gb|EEY74516.1| high-affinity zinc uptake system membrane protein ZnuB [alpha
           proteobacterium HIMB114]
          Length = 268

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +G+G+ L TGP+GCF IW+R+++FGDT+AHSALLGV ++L F+L +   
Sbjct: 1   MLDDFFIRALIAGLGVSLITGPMGCFTIWKRLSFFGDTLAHSALLGVTMALTFELNIPFA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+I+++ +++LL +QKN  L  DA+LG++ HS+++  LV++ F+  +  D+   LFGDI
Sbjct: 61  VFVISSIIAVMLLSLQKNTRLPGDALLGLLAHSSLATGLVVIGFLSNIRFDVMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVN  DIL+IW  G + ++IL  IWK L A TVNY+LA+AEGM+P++  +IFI++ + M
Sbjct: 121 LAVNKIDILIIWIGGAIILIILKFIWKSLFAATVNYDLAEAEGMKPDRANVIFIILMAAM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+++IK +G+ LIT +LI+P   AR  S SP  M IL+ + GI+ + IGL+ SL F++PS
Sbjct: 181 IAIAIKMVGLLLITGMLIMPAAMARNLSDSPTKMVILSIVGGIMSVSIGLFASLEFNSPS 240

Query: 241 GPSIIITSLFLFILSFF-YKK 260
           GPSII  +L LF+LS   +KK
Sbjct: 241 GPSIITAALILFLLSLINFKK 261


>gi|114706090|ref|ZP_01438993.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Fulvimarina pelagi HTCC2506]
 gi|114538936|gb|EAU42057.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Fulvimarina pelagi HTCC2506]
          Length = 284

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 129/255 (50%), Positives = 193/255 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG  L  GPLGCFI+W+R+AYFGDT++H+ALLGVAL+L+F++ + + 
Sbjct: 1   MLDDFFTRALIAGIGTALVAGPLGCFIVWRRLAYFGDTLSHAALLGVALALLFEVNIELA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F ++   ++ LL +QK  A+SSDA+LG+++HS +++ LV+L+FM WV  DL  FLFGDI
Sbjct: 61  VFAVSGCVAIALLLLQKRAAVSSDALLGLLSHSALAIGLVVLAFMTWVRVDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +IW  G L + IL  IW+PL A TVN ELA AEGM P +  ++F+++ + +
Sbjct: 121 LAVSKMDIAIIWFGGALVLAILAMIWRPLFAATVNRELAAAEGMNPGRANVVFMLLMAAV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+K +G+ LIT++LI+P  TARR +  PE MA++A  +G + ++ GL+GSL +DTP+
Sbjct: 181 IAISMKIVGVLLITAMLIIPAATARRLAPGPEQMAMIAAAVGAMAVMGGLFGSLEWDTPA 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L  FILS
Sbjct: 241 GPSIVVAALCFFILS 255


>gi|307946706|ref|ZP_07662041.1| ABC transporter, membrane spanning protein [Roseibium sp.
           TrichSKD4]
 gi|307770370|gb|EFO29596.1| ABC transporter, membrane spanning protein [Roseibium sp.
           TrichSKD4]
          Length = 275

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 193/255 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +GIG     GPLGCFI+W+R+AYFGDT+AH+ALLGVALSL+ +L  T+ 
Sbjct: 1   MLDDFFVRALVAGIGGAAVAGPLGCFIVWRRMAYFGDTLAHAALLGVALSLLLELNTTMT 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F ++   +L +L +++ + LSSDA+LG+++HS ++L LV L+FM WV  DLT  LFGDI
Sbjct: 61  VFGVSVTIALTMLGLRRTQTLSSDALLGLLSHSALALGLVCLAFMTWVRVDLTGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TDIL I+  G   ++ L+ IW+ L A TVN +LA AEGM+PEK+ ++F+++ + +
Sbjct: 121 LAVSKTDILTIYAGGSAVLVFLWLIWRRLFAATVNPDLAAAEGMEPEKVNIVFMLLMAAV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +G+ LIT+LLI+P  +ARR +  PE+MA++A++IG + ++ GL  SL  DTP+
Sbjct: 181 IAIAMKVVGVLLITALLIIPAASARRIAVGPEHMAVIASVIGAVAVVGGLQASLRLDTPA 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++    LF++S
Sbjct: 241 GPSIVVAGTILFLVS 255


>gi|218514279|ref|ZP_03511119.1| zinc uptake ABC transporter, permease protein [Rhizobium etli 8C-3]
          Length = 190

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 108/190 (56%), Positives = 161/190 (84%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLVALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGI 190
           I++++K +GI
Sbjct: 181 IAIAMKIVGI 190


>gi|54308246|ref|YP_129266.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum SS9]
 gi|46912674|emb|CAG19464.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum SS9]
          Length = 261

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 186/257 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFDINLNLALII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCMVLAVILVSLQKQKYVATDTLLGILAHSALSLGLVAVSFLDHVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++ I+G G L +  L  +W+PLL+ T+N ++A+ EG+  + ++L  +++  ++I+V
Sbjct: 123 TTADLMWIYGGGILVLGALIALWRPLLSMTINEDMAQVEGVNVDLMRLALMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA +A++IGI+ + IGL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPEMMACMASVIGIIAVFIGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +F+LS   + 
Sbjct: 243 VVVAAAAMFMLSQLRRA 259


>gi|90411604|ref|ZP_01219614.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum 3TCK]
 gi|90327494|gb|EAS43847.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum 3TCK]
          Length = 261

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 186/257 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFDINLNLALII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCMVLAVILVSLQKQKYVATDTLLGILAHSALSLGLVAVSFLDHVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++ I+G G L +  L  +W+PLL+ T+N ++A+ EG+  + ++L  +++  ++I+V
Sbjct: 123 TTADLMWIYGGGILVLGALITLWRPLLSMTINEDMAQVEGVNVDLMRLALMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA +A++IGI+ + IGL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPEMMACMASVIGIIAVFIGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +F+LS   + 
Sbjct: 243 VVVAAAAMFMLSQLKRA 259


>gi|254474046|ref|ZP_05087439.1| zinc ABC transporter, permease protein [Pseudovibrio sp. JE062]
 gi|211956935|gb|EEA92142.1| zinc ABC transporter, permease protein [Pseudovibrio sp. JE062]
          Length = 271

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 184/244 (75%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RA+ +GIG+ L  GPLGCF++W+R+AYFGDT++HSALLGVAL+ +  + L + + 
Sbjct: 2   DDFILRAMLAGIGLALVAGPLGCFVVWRRMAYFGDTMSHSALLGVALAFLLNINLMLGVL 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +    SL LL +QK  +LS+DA+LG+++HS ++L +V+++FM  V  DL S LFGDILA
Sbjct: 62  AVTVTVSLCLLILQKRGSLSTDALLGLLSHSALALGMVLIAFMSHVRFDLLSLLFGDILA 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I+    + + +++ +W+PLLA+TVN ELA+AEG  P+  +LIF+++ + +I+
Sbjct: 122 VGNEDVIAIYACAAVILGLMYFLWRPLLASTVNRELAEAEGFNPDLTQLIFMVMMAAIIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +G+ LIT+LLI+P  TAR F+ +PE MA+ +++IG+  +++GL GSL FD+ SGP
Sbjct: 182 IAMKIVGVLLITALLIIPAATARWFARTPEQMAVASSVIGVASVVLGLEGSLQFDSASGP 241

Query: 243 SIII 246
           SI++
Sbjct: 242 SIVV 245


>gi|304394485|ref|ZP_07376406.1| high-affinity zinc uptake system membrane ABC transporter protein
           [Ahrensia sp. R2A130]
 gi|303293395|gb|EFL87774.1| high-affinity zinc uptake system membrane ABC transporter protein
           [Ahrensia sp. R2A130]
          Length = 260

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 181/254 (71%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F IRA  + +G+ L  GPLGCF+IW+R++YFGDT+AH ALLGVALS +  L     +F
Sbjct: 2   DDFLIRAGVAAVGVALVAGPLGCFVIWRRLSYFGDTLAHGALLGVALSFLLGLAPVAIVF 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++    +L L  +Q++ AL+SDAILG+++H +++L +V +  M W+  DLT  LFGDILA
Sbjct: 62  LVCAFIALALFALQRDGALASDAILGILSHGSLALGMVAIGAMSWLRVDLTGLLFGDILA 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           VN  DIL IW  G + + +L  IW  L A TVN ++A AEG QPE+I L+F+++ + +I+
Sbjct: 122 VNMNDILTIWIGGAVCLAVLVLIWNRLFAATVNGDIAAAEGQQPERITLVFMLLVAGVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +G+ LIT+LLI+P  T+RR + +PE MA++A+++G    ++GL+ SL +D  +GP
Sbjct: 182 IAMKVVGVLLITALLIVPAATSRRLAHTPEAMAVVASLLGAASAVLGLWASLQWDVQAGP 241

Query: 243 SIIITSLFLFILSF 256
           +I++ +L LF+ S 
Sbjct: 242 AIVVAALVLFVGSL 255


>gi|117618931|ref|YP_858178.1| zinc uptake ABC transporter, permease protein ZnuB [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117560338|gb|ABK37286.1| zinc uptake ABC transporter, permease protein ZnuB [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 259

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 184/258 (71%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ + 
Sbjct: 2   DSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAVV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L+
Sbjct: 62  VCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLLS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I+
Sbjct: 122 VQPMDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGVRVDVLRCVLMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFSRTPEQMAGFAALIGCLAVLGGLLLSWYQDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS F K 
Sbjct: 242 SVVVCATSLFILSQFKKA 259


>gi|330445474|ref|ZP_08309126.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489665|dbj|GAA03623.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 261

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 189/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL ++LFGD+LAV
Sbjct: 63  CCLVLAVILVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            TTDIL I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++LI +++  ++I+V
Sbjct: 123 TTTDILWIYCGGAIVLGLLIFLWRPLLSMTISEEMAQVEGVNVDLMRLILMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE+MA+LA+++G + + +GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPESMAVLASVLGAIAVCLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  +F+LS   +
Sbjct: 243 VVVSAAAMFMLSQLKR 258


>gi|145297629|ref|YP_001140470.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850401|gb|ABO88722.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 259

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 184/258 (71%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ + 
Sbjct: 2   DSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAVV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L+
Sbjct: 62  VCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLLS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I+
Sbjct: 122 VQPVDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGVRVDVLRCVLMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFSQTPEQMAGFAALIGCLAVLGGLSLSWYQDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +FILS F K 
Sbjct: 242 SVVVCATSMFILSQFKKA 259


>gi|330828239|ref|YP_004391191.1| high affinity zinc ABC transporter permease [Aeromonas veronii
           B565]
 gi|328803375|gb|AEB48574.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas veronii B565]
          Length = 259

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 184/258 (71%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ + 
Sbjct: 2   DSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAVV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L+
Sbjct: 62  VCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLLS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I+
Sbjct: 122 VQPMDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGIRVDVLRCVLMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFSQTPEQMAGFAALIGCLAVLGGLTLSWYQDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LF+LS F + 
Sbjct: 242 SVVVCATSLFVLSQFKRA 259


>gi|311696414|gb|ADP99287.1| zinc ABC transporter, permease protein [marine bacterium HP15]
          Length = 270

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 181/254 (71%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + + 
Sbjct: 9   DDFFWRALIGGLGVALVAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNLGVI 68

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + ++ L+ + +   L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+LA
Sbjct: 69  ITCVVLAMALVLLSRTRTLATDTLLGILAHSALAIGLVTLSFMPDVRVDLTGLLFGDLLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  D+L I+G   L I++L  +W+ LL +T++ ELA+ EG+  E+++L+ +++ SL+I+
Sbjct: 129 MSREDLLWIYGGAALIIILLAVLWQGLLMSTIHEELARVEGVAVERLRLVLMLMFSLVIA 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +G+ LIT+LLI+P  TARR + +PE MA +A   G + +  GL  S   DTP+GP
Sbjct: 189 VAMKIVGVLLITALLIIPAATARRLAHNPEIMAAMAVGFGFVAVSGGLSLSWHLDTPAGP 248

Query: 243 SIIITSLFLFILSF 256
           S+++T+  +F+L +
Sbjct: 249 SVVVTAFAVFLLVY 262


>gi|269103071|ref|ZP_06155768.1| zinc ABC transporter permease protein ZnuB [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268162969|gb|EEZ41465.1| zinc ABC transporter permease protein ZnuB [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 261

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 188/257 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI L  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIALIAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL ++LFGD+LAV
Sbjct: 63  CCLALAVILVTLQKQKLVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            TTD+  I+G G L + +L  +W+PLL+ T+N E+A+ EG+  + ++L+ +++  L+I+V
Sbjct: 123 TTTDLYWIYGGGVLVLGMLVWLWRPLLSMTINEEMAQVEGINVDLMRLLLMLMVGLVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE MA LA+IIG + ++ GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPEMMACLASIIGAIAVVGGLILSWQYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++++  LFILS F K 
Sbjct: 243 VVVSAAALFILSQFKKS 259


>gi|89073525|ref|ZP_01160048.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium sp. SKA34]
 gi|89050789|gb|EAR56270.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium sp. SKA34]
          Length = 261

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 187/252 (74%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLVLAVILVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+L I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++L+ +++  ++I+V
Sbjct: 123 TTNDLLWIYCGGAVVLALLIYLWRPLLSMTISEEMAQVEGVNVDLMRLLLMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE+MA+ A+IIG + +++GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPESMAVFASIIGAIAVVLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           +++++  +FILS
Sbjct: 243 VVVSAAAMFILS 254


>gi|118588122|ref|ZP_01545532.1| ABC transporter, family 3:Sodium:dicarboxylate symporter [Stappia
           aggregata IAM 12614]
 gi|118439744|gb|EAV46375.1| ABC transporter, family 3:Sodium:dicarboxylate symporter [Stappia
           aggregata IAM 12614]
          Length = 275

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 192/256 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ L  GPLGCFIIW+R+AYFGDT++H+ALLGVALSL+  +  T+ 
Sbjct: 1   MLDDFFTRALIAGIGVALVAGPLGCFIIWRRMAYFGDTLSHAALLGVALSLLLNVNTTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  ++ L ++VL+ +++++ LSSDA+LG+++HS ++L LV L+FM WV  DL   LFGDI
Sbjct: 61  VGAVSILLAVVLMALRRSDTLSSDALLGLLSHSALALGLVCLAFMTWVRVDLLGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   DI +I+G G L + +L  IW+ L A TV+ +LA  EG++PE+ +LIF+++T+++
Sbjct: 121 LAVTPLDIAMIYGGGALVLTVLVVIWRRLFAATVSPDLAAGEGLKPEQTELIFMLLTAIV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+K IG  LIT+LLI+P   ARR S SPE MA +A + G   ++ GLY SL +DTPS
Sbjct: 181 IAISLKIIGALLITALLIIPAAAARRLSASPEQMAFIAALTGAAAVVGGLYSSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSF 256
           GPSI++ ++ LF++S 
Sbjct: 241 GPSIVVAAMALFVVSL 256


>gi|90417865|ref|ZP_01225777.1| permease component, ABC-type Zn2+/Mn2+ transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337537|gb|EAS51188.1| permease component, ABC-type Zn2+/Mn2+ transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 274

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 198/255 (77%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +GIGI L  GPLGCF++W+R+AYFGDT+AHSALLGVALS  F++ L + 
Sbjct: 1   MLDDFFVRAVLAGIGIALVAGPLGCFVVWRRMAYFGDTMAHSALLGVALSTAFEIDLMLG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A + +  L+ +Q+   LS+DA+LG+++HST++L LV+++FM WV  DL  FLFGDI
Sbjct: 61  VFGVAAIVAAALVLLQRRGGLSTDALLGILSHSTLALGLVLIAFMTWVRIDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+L I+  G + ++ +  +W+PLLA+TV+ ELA+AEG+ PE+ + +F+++ +L+
Sbjct: 121 LAVSRVDLLAIYLGGVVILVGMLFLWRPLLASTVSAELAEAEGLSPERTRFLFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRF+ +PE MA+LA  +G      GL+GSL FDTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFAATPELMALLAAGVGAAAAAGGLFGSLHFDTPS 240

Query: 241 GPSIIITSLFLFILS 255
           GPSI++ +L LF++S
Sbjct: 241 GPSIVVAALALFLVS 255


>gi|114320353|ref|YP_742036.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226747|gb|ABI56546.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 273

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/254 (43%), Positives = 179/254 (70%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RAL +G G+    GPLG F++W+R+AYFGDT+AHSALLGVAL  +  L + + I 
Sbjct: 2   DDFLLRALLAGFGLAAVAGPLGSFVVWRRMAYFGDTLAHSALLGVALGFLIGLNVNLGIL 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++    +++L+ ++  + L+ D ILG++ HST+SL LV L+F++ V  DL ++LFGDILA
Sbjct: 62  LVCGALAVLLVVLRSRQRLADDTILGIMAHSTLSLGLVSLAFLEHVRVDLMAYLFGDILA 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  T++  IW  G   + +L  IW+PLL  T++ ELA+AEG+    ++L+F+ + + +I+
Sbjct: 122 VGPTELWWIWLGGLAVLGVLALIWRPLLTMTLHEELARAEGVPLLPMQLLFMGLMAGVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++  +GI L+TSLLI+P  TAR F+ +PE MA+LA+++G L +  GL GS  +D P+GP
Sbjct: 182 IAMNIVGILLVTSLLIIPAATARLFARTPEQMAVLASLLGCLAVAGGLRGSWNWDLPTGP 241

Query: 243 SIIITSLFLFILSF 256
           +I++T+  LF L+ 
Sbjct: 242 AIVVTATLLFTLAM 255


>gi|90580059|ref|ZP_01235867.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Vibrio angustum S14]
 gi|90438944|gb|EAS64127.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Vibrio angustum S14]
          Length = 261

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 189/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++VL+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLVLAVVLVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+L I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++L+ +++  ++I+V
Sbjct: 123 TTNDLLWIYCGGAVVLALLIYLWRPLLSMTISEEMAQVEGVNVDLMRLLLMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE+MA+LA+IIG + +++GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPESMAVLASIIGAIAVVLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  +F+LS   +
Sbjct: 243 VVVSAAAMFMLSQLKR 258


>gi|148978242|ref|ZP_01814760.1| zinc ABC transporter, permease protein [Vibrionales bacterium
           SWAT-3]
 gi|145962543|gb|EDK27820.1| zinc ABC transporter, permease protein [Vibrionales bacterium
           SWAT-3]
          Length = 261

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/262 (43%), Positives = 186/262 (70%), Gaps = 10/262 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ----LPLTI 59
           EF + ++ +G+GI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +F     L L I
Sbjct: 3   EFLLPSILAGLGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLFNINLYLALLI 62

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           C  M+A L    L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD
Sbjct: 63  CCLMLAVL----LVTLQKQKLVATDTLLGILAHSALSLGLVAVSFLDNVRVDLMSYLFGD 118

Query: 120 ILAVNTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           +LAV+ TD++ I+ G G +  ++L   W+PLL+TTVN +LA  +G+  + ++LI +++  
Sbjct: 119 LLAVSPTDLVFIYAGAGVIG-LVLAIFWRPLLSTTVNEDLAAVDGINIDLMRLILMLLVG 177

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           ++I+V +KF+G  ++TSLLI+P  TAR+FS++PE MA+ A+IIG + +  GL  S  +DT
Sbjct: 178 IVIAVGMKFVGALIMTSLLIIPAATARKFSSTPEQMALFASIIGSIAVCGGLSLSWFYDT 237

Query: 239 PSGPSIIITSLFLFILSFFYKK 260
           P+GPS++I++  +F+LS   K 
Sbjct: 238 PAGPSVVISAAAMFMLSQMVKS 259


>gi|87120942|ref|ZP_01076834.1| high-affinity zinc uptake system membrane protein ZnuB [Marinomonas
           sp. MED121]
 gi|86163780|gb|EAQ65053.1| high-affinity zinc uptake system membrane protein ZnuB [Marinomonas
           sp. MED121]
          Length = 268

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 178/253 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +   RAL  G+G+    GPLG F++W+R+AYFGDT+AHSALLGV+L  +F++ L + +  
Sbjct: 3   DLLFRALLGGLGVAAVAGPLGAFVVWRRMAYFGDTLAHSALLGVSLGFLFEINLNLAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +LVL+ +QK   +++D +LG++ HS++SL LV +SF+  +  DL ++LFGD+LA+
Sbjct: 63  LCVGLALVLVTLQKKHIIATDTLLGILAHSSLSLGLVAVSFLDNIRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+  I+  G L + +L   WKPLLA TVN ELAK EG   E I+L+ +++ +L+I+V
Sbjct: 123 GTQDLYWIYSGGLLVLALLALFWKPLLAVTVNEELAKVEGYPVEAIRLLLMLLVALVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSL+I+P  TAR+ S SP  MA +A+++G L +  GL  S  +DTP+GPS
Sbjct: 183 AMKIVGVLLITSLMIIPAATARKLSRSPVQMASVASLLGCLAVSGGLLASFQWDTPAGPS 242

Query: 244 IIITSLFLFILSF 256
           +++ +  LF+L++
Sbjct: 243 VVVCAAVLFLLAY 255


>gi|326793511|ref|YP_004311331.1| ABC-type transporter integral membrane subunit [Marinomonas
           mediterranea MMB-1]
 gi|326544275|gb|ADZ89495.1| ABC-type transporter, integral membrane subunit [Marinomonas
           mediterranea MMB-1]
          Length = 265

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 177/253 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E   RAL  G+G+    GPLG F++W+R+AYFGDT+AHSALLG+AL  +F + L + I +
Sbjct: 3   ELMFRALVGGLGVAAIAGPLGAFVVWRRMAYFGDTLAHSALLGIALGFLFDVNLNLAIIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +  L+ +QK   +++D +LG++ HS++SL +V +SF+  V  DL S+LFGD+LAV
Sbjct: 63  LCVGLAAALVTLQKKHIIATDTLLGILAHSSLSLGMVAVSFLDDVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I+G G   +++L   WKPLLA TVN ELAK EG   E  +L+ +++ +L+I++
Sbjct: 123 SQNDLYWIYGGGIAVLLLLAVFWKPLLAMTVNEELAKVEGYPVETTRLLLMLLVALVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSL+I+P  TAR+ S +P  MA +A++IG L +  GL+ S  +DTP+GPS
Sbjct: 183 AMKIVGVLLITSLMIIPAATARKLSQTPVQMASMASLIGCLSVCGGLWASYQWDTPTGPS 242

Query: 244 IIITSLFLFILSF 256
           +++ +  LF++++
Sbjct: 243 VVVCAATLFLVAY 255


>gi|254784318|ref|YP_003071746.1| high-affinity zinc uptake system membrane protein ZnuB
           [Teredinibacter turnerae T7901]
 gi|237685117|gb|ACR12381.1| high-affinity zinc uptake system membrane protein ZnuB
           [Teredinibacter turnerae T7901]
          Length = 265

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 179/251 (71%)

Query: 10  LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTS 69
           L +G+GI    GPLG F++W+R++YFGDT+AHSAL+GVAL +   + LT+ + +   + S
Sbjct: 14  LIAGMGIAAIAGPLGSFVVWRRMSYFGDTLAHSALVGVALGVFAGINLTLAMVLGGVVVS 73

Query: 70  LVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDIL 129
           L L Q+QK  +L++D +LG+++HS+++L L+ +S +     +L S+LFGD+L VN +D+L
Sbjct: 74  LSLWQLQKQRSLAADTLLGILSHSSLALGLIGVSLLASAKVNLFSYLFGDLLTVNASDLL 133

Query: 130 LIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIG 189
           +I+  G + + +L   W+PLL T ++ +LA+ EG+  EK++L+ +++ +++I++S+K +G
Sbjct: 134 MIYLGGMICLALLVFFWRPLLMTAIDEDLARVEGIAVEKLRLLLMVLMAVVIALSMKLVG 193

Query: 190 ITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSL 249
           + LIT+LLI+P  TARR + SPE MA+LA  IG++ ++ GL+ S++ D P+GP I++ + 
Sbjct: 194 VLLITALLIIPAATARRLTQSPEAMALLAASIGVIAVVGGLFASVVLDVPAGPGIVLCAA 253

Query: 250 FLFILSFFYKK 260
            LF+LS     
Sbjct: 254 ALFVLSLLKHA 264


>gi|84393474|ref|ZP_00992230.1| zinc ABC transporter, permease protein [Vibrio splendidus 12B01]
 gi|84375902|gb|EAP92793.1| zinc ABC transporter, permease protein [Vibrio splendidus 12B01]
          Length = 261

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 184/256 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +F + L   + +
Sbjct: 3   EFLLPSILAGLGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLFNINLYFALLI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLMLAVLLVTLQKQKLVATDTLLGILAHSALSLGLVAVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    +  ++L   W+PLL+TTVN +LA  +G+  + ++LI +++  ++I+V
Sbjct: 123 SPTDLVFIYAGAAVIGLVLAIFWRPLLSTTVNEDLAAVDGINIDLMRLILMLLVGIVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+F+ +PE MA LA++IG + +  GL  S  +DTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKFANTPEQMAFLASVIGSIAVFGGLSLSWFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I++  +F+LS  Y+
Sbjct: 243 VVISAAAMFMLSQMYR 258


>gi|260776447|ref|ZP_05885342.1| zinc ABC transporter permease protein ZnuB [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260607670|gb|EEX33935.1| zinc ABC transporter permease protein ZnuB [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 261

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 107/256 (41%), Positives = 178/256 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L   + +
Sbjct: 3   EFLLPSILAGLGIAAIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYFALIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +Q+ + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAFILVALQRQQLVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    L   IL   W+ LLATTVN +LA  EG   + ++L+ +++  L+I++
Sbjct: 123 SPTDLVYIYAGAALVSAILVYFWRSLLATTVNEDLAAVEGHNVDLMRLVLMIMVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TARRFS +PE MAI A+ IG + +++GL  S  +DTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARRFSRTPEQMAITASFIGAVAVLLGLSLSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I++  +F+LS  Y+
Sbjct: 243 VVISATAMFMLSQLYR 258


>gi|149376893|ref|ZP_01894648.1| high-affinity zinc uptake system membrane protein ZnuB
           [Marinobacter algicola DG893]
 gi|149358785|gb|EDM47254.1| high-affinity zinc uptake system membrane protein ZnuB
           [Marinobacter algicola DG893]
          Length = 270

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 181/258 (70%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + + 
Sbjct: 9   GDFFWRALIGGLGVALIAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNVGVI 68

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + ++ L+   +++ L++D +LG++ HS +++ LV LSFM  +  DLT  LFGD+LA
Sbjct: 69  VTCVVLAIALVLFSRSKTLATDTLLGILAHSALAIGLVTLSFMPDIRVDLTGLLFGDLLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  D+L I+G   L + +L  +W+ LL +T++ ELA+ EG+  E+++L+ +++ S++I+
Sbjct: 129 MSRNDLLWIYGGALLILALLTVLWRGLLMSTIHEELARVEGVPVERLRLVLMLMFSIVIA 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +G+ LIT+LLI+P  TARR + +PE+M  LA + G + +  GL  S   DTP+GP
Sbjct: 189 VAMKIVGVLLITALLIIPAATARRLAGNPEHMVGLAILFGFIAVSGGLTMSWHLDTPAGP 248

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++T   +F+L +   +
Sbjct: 249 SVVVTGFAVFLLVYGSAR 266


>gi|27363636|ref|NP_759164.1| Zinc ABC transporter inner membrane permease ZnuB [Vibrio
           vulnificus CMCP6]
 gi|27359752|gb|AAO08691.1| Zinc ABC transporter, inner membrane permease protein ZnuB [Vibrio
           vulnificus CMCP6]
          Length = 265

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 180/253 (71%), Gaps = 2/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI L  GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 7   EFLLPSLLAGLGIALIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYLALIV 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + ++SD +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 67  CCLALAVILVTLQKQQLVASDTLLGILAHSALSIGLVAVSFLDNVRVDLMSYLFGDLLAV 126

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D+L I+ G+  +    L+  W+PLL+TTVN ELA  EG   + I+LI +++  ++I+
Sbjct: 127 SPQDLLFIYAGVAAVG-ATLYLFWRPLLSTTVNEELAAVEGTNIDLIRLILMLMVGIVIA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSLLI+P   ARRF+ SPE MA  A++IG+L ++ GL  S  FDTP+GP
Sbjct: 186 VGMKFVGALIMTSLLIIPAAAARRFAQSPEQMAGFASLIGVLAVLGGLTLSWHFDTPAGP 245

Query: 243 SIIITSLFLFILS 255
           S++I++  +F+L+
Sbjct: 246 SVVISATAIFMLA 258


>gi|37679220|ref|NP_933829.1| zinc ABC transporter, permease protein [Vibrio vulnificus YJ016]
 gi|37197963|dbj|BAC93800.1| zinc ABC transporter, permease protein [Vibrio vulnificus YJ016]
          Length = 275

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 180/253 (71%), Gaps = 2/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI L  GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 17  EFLLPSLLAGLGIALIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYLALIV 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + ++SD +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 77  CCLALAVILVTLQKQQLVASDTLLGILAHSALSIGLVAVSFLDNVRVDLMSYLFGDLLAV 136

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D+L I+ G+  +    L+  W+PLL+TTVN ELA  EG   + I+LI +++  ++I+
Sbjct: 137 SPQDLLFIYAGVAAVG-ATLYLFWRPLLSTTVNEELAAVEGTNIDLIRLILMLMVGIVIA 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSLLI+P   ARRF+ SPE MA  A++IG+L ++ GL  S  FDTP+GP
Sbjct: 196 VGMKFVGALIMTSLLIIPAAAARRFAQSPEQMAGFASLIGVLAVLGGLTLSWHFDTPAGP 255

Query: 243 SIIITSLFLFILS 255
           S++I++  +F+L+
Sbjct: 256 SVVISATAIFMLA 268


>gi|312882122|ref|ZP_07741872.1| ABC-type Mn2+/Zn2+ transport system, permease component [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370258|gb|EFP97760.1| ABC-type Mn2+/Zn2+ transport system, permease component [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 261

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/264 (44%), Positives = 184/264 (69%), Gaps = 16/264 (6%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ----LPLTI 59
           EF + +LF+G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL  +      L LTI
Sbjct: 3   EFLLPSLFAGLGIACIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDINLYLALTI 62

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           C   +A    ++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD
Sbjct: 63  CCLALA----VILVTLQKQRLVATDTLLGILAHSALSLGLVSVSFLDDVRIDLMSYLFGD 118

Query: 120 ILAVNTTDILLIW----GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           +LAV   D++ I+     IGF  +M++F  W+ LL+TTVN ELA  EG   + ++LI ++
Sbjct: 119 LLAVTPGDLIYIYLGAAVIGF--VMLIF--WRSLLSTTVNEELAAVEGHNTDLMRLILML 174

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           +  L+I++ +KF+G  ++TSLLI+P  TARRF+ +PE MA+LA+ +G L +I+GL  S  
Sbjct: 175 MVGLVIAIGMKFVGALIMTSLLIIPAATARRFANTPEQMALLASALGSLSVILGLALSWH 234

Query: 236 FDTPSGPSIIITSLFLFILSFFYK 259
           FDTP+GPS+++++  LF+LS   K
Sbjct: 235 FDTPAGPSVVLSAAALFLLSQAKK 258


>gi|149191116|ref|ZP_01869375.1| zinc ABC transporter, permease protein [Vibrio shilonii AK1]
 gi|148835044|gb|EDL52022.1| zinc ABC transporter, permease protein [Vibrio shilonii AK1]
          Length = 261

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 182/257 (70%), Gaps = 10/257 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ----LPLTI 59
           EF + ++ +GIGI L  GPLG F++W+R+AYFGDT+AH++L+G+AL  +      L LT+
Sbjct: 3   EFLLPSIVAGIGIALIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDINLYLALTV 62

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           C   +A    ++L+ +QK   +++D +LG++ HS +SL LV +SF+  +  DL S+LFGD
Sbjct: 63  CCMALA----IILVTLQKQRLVATDTLLGILAHSALSLGLVAVSFLDNIRVDLMSYLFGD 118

Query: 120 ILAVNTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           +LAV+ TD++ I+ G+  +  + LF  W+PLL+TTVN +LA  EG+  + ++LI +++  
Sbjct: 119 LLAVSPTDLMYIYAGVAVIGAL-LFVFWRPLLSTTVNEDLAAVEGVNVDLMRLIIMLMVG 177

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+I++ +KF+G  ++TSLLI+P  TAR+F+ +PE MA+ A+ IGI+ +  GL  S  +DT
Sbjct: 178 LVIAIGMKFVGALIMTSLLIIPAATARKFTVTPEQMAVTASFIGIISVFCGLSLSWFYDT 237

Query: 239 PSGPSIIITSLFLFILS 255
           P+GPS++I++   F+L+
Sbjct: 238 PAGPSVVISAASFFLLA 254


>gi|254506871|ref|ZP_05119010.1| zinc ABC transporter, permease protein [Vibrio parahaemolyticus 16]
 gi|219550156|gb|EED27142.1| zinc ABC transporter, permease protein [Vibrio parahaemolyticus 16]
          Length = 261

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 105/252 (41%), Positives = 179/252 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+++AYFGDT+AH++L+G+A   +  + L + + +
Sbjct: 3   EFLLPSLLAGLGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGIAFGFLLNVNLYLALVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+L+V
Sbjct: 63  CCLALALILVTLQKQQLVATDTLLGILAHSALSLGLVAVSFLDDVRIDLMSYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD++ I+G   +   IL   W+ LLATTV+ +LA  +G   + ++L+ +++  L+I++
Sbjct: 123 TPTDLMYIYGGVIVVTAILAIFWRSLLATTVSEDLAAVDGQNVDLMRLVLMLMVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P   ARRFS++PE MA+LA++IG L ++ GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAAAARRFSSTPEQMALLASLIGALAVVFGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           ++I++  +F+LS
Sbjct: 243 VVISATAMFMLS 254


>gi|298484766|ref|ZP_07002866.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160620|gb|EFI01641.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 262

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 184/257 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    ++++ +++ +++I+V
Sbjct: 123 SPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMVLMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|152994335|ref|YP_001339170.1| ABC-3 protein [Marinomonas sp. MWYL1]
 gi|150835259|gb|ABR69235.1| ABC-3 protein [Marinomonas sp. MWYL1]
          Length = 263

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 108/237 (45%), Positives = 170/237 (71%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
            GPLG F++W+R+AYFGDT+AHSALLGVAL  +  + L + I ++    +LVL+ +QK  
Sbjct: 19  AGPLGAFVVWRRMAYFGDTLAHSALLGVALGFLLDINLNLAIIVLCVGLALVLVTLQKKH 78

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
            +++D +LG++ HS +SL LV +SF+  +  DL ++LFGD+LA++ TD+  I+G G   I
Sbjct: 79  IIATDTLLGILAHSALSLGLVAVSFLDNIRIDLMAYLFGDLLAISQTDVYWIYGGGLAVI 138

Query: 140 MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLIL 199
            +L   WKPLLA TVN ELAK EG   E I+L+ +++ +L+I+V++K +G+ LITSL+I+
Sbjct: 139 TLLVAFWKPLLAVTVNEELAKVEGYPVEAIRLLLMLLVALVIAVAMKIVGVLLITSLMII 198

Query: 200 PTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSF 256
           P  TAR+ S++P  MA  A++IG L +  GL+ S  +DTP+GPS+++ +  LF++++
Sbjct: 199 PAATARKLSSTPVQMASFASLIGCLAVCSGLWASYRWDTPTGPSVVVCAALLFLIAY 255


>gi|86147657|ref|ZP_01065966.1| zinc ABC transporter, permease protein [Vibrio sp. MED222]
 gi|218710207|ref|YP_002417828.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           splendidus LGP32]
 gi|85834568|gb|EAQ52717.1| zinc ABC transporter, permease protein [Vibrio sp. MED222]
 gi|218323226|emb|CAV19403.1| znuB, High-affinity zinc uptake system membrane protein [Vibrio
           splendidus LGP32]
          Length = 261

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 182/252 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +F + L   + +
Sbjct: 3   EFLLPSILAGLGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLFNINLYFALLI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLMLAVLLVTLQKQKLVATDTLLGILAHSALSLGLVAVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    +  ++L   W+PLL+TTVN +LA  +G+  + ++LI +++  ++I+V
Sbjct: 123 SPTDLVFIYAGAAVIGVVLAIFWRPLLSTTVNEDLAAVDGINIDLMRLILMLLVGIVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+F+ +PE MA LA++IG + +  GL  S  +DTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKFANTPEQMAFLASVIGSIAVFGGLSLSWFYDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           ++I++  +F+LS
Sbjct: 243 VVISAAAMFMLS 254


>gi|289208872|ref|YP_003460938.1| ABC transporter [Thioalkalivibrio sp. K90mix]
 gi|288944503|gb|ADC72202.1| ABC-3 protein [Thioalkalivibrio sp. K90mix]
          Length = 273

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 184/252 (73%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F  RA+ +G+ +    GPLG F++W+R+AYFGDTI+HSALLGVAL  +    L + + 
Sbjct: 7   DDFLFRAVLAGLMVAAVAGPLGAFVVWRRMAYFGDTISHSALLGVALGFLLGTNLNLMVT 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++    +++L+ +Q+ + L+SD +LG++ HS +SL +V ++F++ +  DL ++LFGDILA
Sbjct: 67  IVCVAIAVLLVILQRRQELASDTLLGILAHSALSLGIVAVTFIEGLRVDLMAYLFGDILA 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V T D+L I   G + +++L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +L+I+
Sbjct: 127 VGTNDLLAIAIGGGIALLLLVLLWRPLLALTVHEELARVEGVPVLAVRLGLMLLIALVIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ LIT+L+I+P  +ARRF+++PE MA LA +IG+L +++G++GS  +DTP+GP
Sbjct: 187 AAMQVVGVLLITALMIIPAASARRFASTPEQMAFLAGVIGMLAVLVGVWGSFQYDTPTGP 246

Query: 243 SIIITSLFLFIL 254
           +I++ ++  FIL
Sbjct: 247 TIVVAAMLGFIL 258


>gi|330890990|gb|EGH23651.1| zinc ABC transporter permease [Pseudomonas syringae pv. mori str.
           301020]
          Length = 262

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L + +L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAGLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|71737862|ref|YP_272570.1| zinc ABC transporter permease [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257481820|ref|ZP_05635861.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289625099|ref|ZP_06458053.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646464|ref|ZP_06477807.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|71558415|gb|AAZ37626.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|330866589|gb|EGH01298.1| zinc ABC transporter permease [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330986804|gb|EGH84907.1| zinc ABC transporter permease [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 262

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 183/257 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|327478655|gb|AEA81965.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri DSM
           4166]
          Length = 261

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 112/240 (46%), Positives = 175/240 (72%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+AL GVAL L+  + LT+ + +   L +L+L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALFGVALGLMLDVNLTLAVTVGCVLLALLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++ HST+SL LV LSFMK V  DL  +LFGD+LAV  +D+  I G   L ++
Sbjct: 80  LASDTLLGILAHSTLSLGLVSLSFMKDVRVDLMGYLFGDLLAVGPSDLAWIIGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 MLIPLWRPLLAITVHEELAKVEGLPVAGIRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + +PE MA+ A+I+GI+ + +GL  S   DTP+GPSI++++  LF+LSF + K
Sbjct: 200 AAAAQRHARTPEQMALGASILGIVAVCLGLTLSWYEDTPAGPSIVVSAAALFLLSFAWPK 259


>gi|237797963|ref|ZP_04586424.1| zinc ABC transporter permease [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331020814|gb|EGI00871.1| zinc ABC transporter permease [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 262

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/257 (41%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +  
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTF 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++VL+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVVLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPDDLAWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|302186836|ref|ZP_07263509.1| hypothetical protein Psyrps6_10825 [Pseudomonas syringae pv.
           syringae 642]
          Length = 262

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 181/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L + +L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAALLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|262276210|ref|ZP_06054019.1| zinc ABC transporter permease protein ZnuB [Grimontia hollisae CIP
           101886]
 gi|262220018|gb|EEY71334.1| zinc ABC transporter permease protein ZnuB [Grimontia hollisae CIP
           101886]
          Length = 261

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 179/257 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF    L +GI I  + GPLG F++W+++AYFGDT+AH +LLG+ L  + Q+ L + + +
Sbjct: 3   EFIAIPLVAGILIAATVGPLGSFVVWRKMAYFGDTLAHGSLLGLTLGFMLQVNLNMALIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +Q+   +S+D +LG+I H+++SL LV +SF+  +  DL ++LFGD+L+V
Sbjct: 63  TCVVMAILLVSLQRKSNVSTDTLLGIIAHTSLSLGLVTISFVDDLRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I     L +  ++++W PLLA TV+ E+A+ +G   +++KLI +++  ++I+V
Sbjct: 123 SGPDVGWIAVGCALVLAAIYRLWNPLLAITVDEEMARVDGYNVDRLKLILMLLVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSL+I+P  TARRFS SPE MA+ A+ IG+L ++ G+  S   DTP+GPS
Sbjct: 183 AMKFVGALIITSLMIIPAATARRFSRSPEQMAMFASGIGVLAVLGGIALSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LF LS FY++
Sbjct: 243 VVVAAAVLFFLSQFYRQ 259


>gi|331009455|gb|EGH89511.1| zinc ABC transporter permease [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 262

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GP G F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPPGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|66043548|ref|YP_233389.1| hypothetical protein Psyr_0278 [Pseudomonas syringae pv. syringae
           B728a]
 gi|289674491|ref|ZP_06495381.1| hypothetical protein PsyrpsF_14602 [Pseudomonas syringae pv.
           syringae FF5]
 gi|63254255|gb|AAY35351.1| ABC-3 [Pseudomonas syringae pv. syringae B728a]
 gi|330938821|gb|EGH42344.1| hypothetical protein PSYPI_07940 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330977278|gb|EGH77233.1| hypothetical protein PSYAP_11200 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 262

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|320322190|gb|EFW78286.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331841|gb|EFW87779.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 262

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I     L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLTWILDGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|114770194|ref|ZP_01447732.1| ABC-type Mn2+/Zn2+ transport system, permease components [alpha
           proteobacterium HTCC2255]
 gi|114549031|gb|EAU51914.1| ABC-type Mn2+/Zn2+ transport system, permease components [alpha
           proteobacterium HTCC2255]
          Length = 266

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/265 (42%), Positives = 180/265 (67%), Gaps = 7/265 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA+ +GIG+ L+  PLGCF++W+R+AYFG+ IAH+A+LGVA+SL+ Q+ +   
Sbjct: 1   MLDDFMTRAVLAGIGVALAAAPLGCFVVWRRMAYFGEAIAHAAILGVAISLMLQISVFAG 60

Query: 61  IFMIATLTS-LVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
             M+A L + +V L   KN A+  D +LGV+ HS+++  LV +SF+  +  DL ++LFGD
Sbjct: 61  ALMVALLMAWIVTLLSGKNYAM--DTLLGVLAHSSLAFGLVFVSFLSGIRIDLMAYLFGD 118

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV+  D+ +IW    L +++++  W  LL +T+N E+A A G+ P++ K+I  +  ++
Sbjct: 119 ILAVSQYDLAVIWLGVILVLLLMYWRWSALLISTLNEEMAYASGLNPKRDKIILTLSLAI 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            ++V+IK +G+ LI ++LI+P  +AR F+ +PE+MAI+A IIG L    GL  + IFDTP
Sbjct: 179 TVAVAIKVVGVLLIIAMLIIPAASARIFARTPESMAIIAAIIGCLSAFGGLEAAYIFDTP 238

Query: 240 SGPSIIITSLFLF----ILSFFYKK 260
           +GP+I+  +   F    ILSF YK 
Sbjct: 239 AGPTIVCIAAISFVTFNILSFIYKS 263


>gi|163802532|ref|ZP_02196424.1| arginyl-tRNA synthetase [Vibrio sp. AND4]
 gi|159173615|gb|EDP58434.1| arginyl-tRNA synthetase [Vibrio sp. AND4]
          Length = 261

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/253 (41%), Positives = 183/253 (72%), Gaps = 2/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAALLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I+  G + +   L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+
Sbjct: 123 SPQDLMFIY-TGVIAVSACLYLFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSVAVLMGLSLSWHFDTPAGP 241

Query: 243 SIIITSLFLFILS 255
           S++I++ FLF+LS
Sbjct: 242 SVVISATFLFMLS 254


>gi|330972142|gb|EGH72208.1| hypothetical protein PSYAR_16765 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 262

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPPAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++++  LF+LSF   +
Sbjct: 243 IVVSAAALFLLSFVLPR 259


>gi|146280438|ref|YP_001170591.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri A1501]
 gi|145568643|gb|ABP77749.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri A1501]
          Length = 261

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 174/240 (72%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+AL GVAL L+  + LT+ + +   L +L+L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALFGVALGLMLDVNLTLAVTVGCVLLALLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++ HST+SL LV LSFM  V  DL  +LFGD+LAV  +D+  I G   L ++
Sbjct: 80  LASDTLLGILAHSTLSLGLVSLSFMDDVRIDLMGYLFGDLLAVGPSDLAWIIGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 MLIPLWRPLLAITVHEELAKVEGLPVAGIRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + +PE MA+ A+++GI+ + +GL  S   DTP+GPSI++++  LF+LSF + K
Sbjct: 200 AAAAQRHARTPEQMALGASVLGIVAVCLGLTLSWYEDTPAGPSIVVSAAALFLLSFAWPK 259


>gi|330952060|gb|EGH52320.1| hypothetical protein PSYCIT7_11939 [Pseudomonas syringae Cit 7]
          Length = 262

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 181/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V
Sbjct: 123 SPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  LF+LSF   +
Sbjct: 243 IVVCAAALFLLSFVLPR 259


>gi|156973656|ref|YP_001444563.1| hypothetical protein VIBHAR_01359 [Vibrio harveyi ATCC BAA-1116]
 gi|156525250|gb|ABU70336.1| hypothetical protein VIBHAR_01359 [Vibrio harveyi ATCC BAA-1116]
          Length = 261

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/253 (41%), Positives = 184/253 (72%), Gaps = 2/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLDINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I+  G + +   L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+
Sbjct: 123 SPQDLMFIYA-GVIAVSGCLYLFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSIAVLMGLSLSWHFDTPAGP 241

Query: 243 SIIITSLFLFILS 255
           S++I++ FLF+LS
Sbjct: 242 SVVISATFLFMLS 254


>gi|126725535|ref|ZP_01741377.1| ABC-3 [Rhodobacterales bacterium HTCC2150]
 gi|126704739|gb|EBA03830.1| ABC-3 [Rhodobacterales bacterium HTCC2150]
          Length = 265

 Score =  218 bits (554), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 168/256 (65%), Gaps = 7/256 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++F +RA+F+G+G+  +  PLGCF++W+R+AYFGD  AH+A+LGVALS  F     I 
Sbjct: 1   MFDDFLVRAVFAGLGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSFAFG----IS 56

Query: 61  IFMIATLTSL---VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
           IF     TSL   VL+     + L++D +LGV+ H+ +++ LV  S +     DL ++LF
Sbjct: 57  IFAGVLGTSLSVAVLISFMGGQKLANDTLLGVMAHAGLAIGLVAASILGGAQVDLEAYLF 116

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           GDILAV   D+ LIW  G L + ++   W+PLL TT++ ELA A G++P++  LI  M  
Sbjct: 117 GDILAVGQRDLALIWAGGALVVGLILWRWQPLLNTTLSPELAIASGIKPKREALILTMAL 176

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           ++ ++V+IK +G  LI +LLI+P  +AR  + SPE+MA++A +IG    I GL+ S  +D
Sbjct: 177 AITVAVAIKVVGALLIGALLIIPAASARILAKSPESMAVMAALIGAASAIAGLWLSYQWD 236

Query: 238 TPSGPSIIITSLFLFI 253
           TP+GPSI+  +   FI
Sbjct: 237 TPAGPSIVSAAAGFFI 252


>gi|323499716|ref|ZP_08104682.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           sinaloensis DSM 21326]
 gi|323315218|gb|EGA68263.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           sinaloensis DSM 21326]
          Length = 261

 Score =  218 bits (554), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI L  GPLG F++W+++AYFGDT+AH++L+G+A   +  + L + + +
Sbjct: 3   EFLLPSILAGLGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGIAFGFLLDVNLYLALVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLILAVILVTLQKQQQVATDTLLGILAHSALSLGLVAVSFLDDVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    +  +IL   W+PLLATTV+ +LA  +G   + ++L+ +++  L+I++
Sbjct: 123 SPTDLMYIYSGAVIVAIILAFAWRPLLATTVSEDLAAVDGHNVDLMRLLLMLLIGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  +AR FS +PE MA +A++IG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAASARSFSKTPEQMAAIASVIGAIAVLLGLSMSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++  +F+LS   K 
Sbjct: 243 VVISATAMFMLSQLVKS 259


>gi|254453734|ref|ZP_05067171.1| zinc ABC transporter, permease protein [Octadecabacter antarcticus
           238]
 gi|198268140|gb|EDY92410.1| zinc ABC transporter, permease protein [Octadecabacter antarcticus
           238]
          Length = 264

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 165/253 (65%), Gaps = 1/253 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL F + + + 
Sbjct: 1   MLDDFMVRAALAGIGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLAFSMSIFVG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +A L +LV+  +      + D +LGV+ HS ++  LV +S +  V  DL ++LFGDI
Sbjct: 61  TMTVALLMALVV-SVLSGRGYAMDTLLGVLAHSALAFGLVAVSLISGVRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L + ++   W  LL +T+N +LA A G+ P++ +L+  +  ++ 
Sbjct: 120 LAVSRGDLAVIWGGAALVVALIGWRWSALLTSTLNEDLAYASGINPKREQLVLTIALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PE MA+ A +IG+L  IIGL  + + DTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARPLSRTPEGMAVAAGLIGMLSAIIGLRAAFVLDTPA 239

Query: 241 GPSIIITSLFLFI 253
           GPSI+  +   F+
Sbjct: 240 GPSIVCVAAITFL 252


>gi|294676686|ref|YP_003577301.1| zinc ABC transporter permease ZnuB [Rhodobacter capsulatus SB 1003]
 gi|294475506|gb|ADE84894.1| zinc ABC transporter, permease protein ZnuB [Rhodobacter capsulatus
           SB 1003]
          Length = 261

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 111/261 (42%), Positives = 168/261 (64%), Gaps = 3/261 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA   G+G+ L+TGPLG F+IW+R+AYFGD  AH+A+LGVAL+  F + +   
Sbjct: 1   MLDDFLIRAALGGVGLTLATGPLGSFVIWRRMAYFGDATAHAAILGVALAYGFGVSVYAG 60

Query: 61  IFMIATLTSLVLLQIQ-KNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
              +A   +L +  +  +  A+  D +LGV+ HS ++  LV  SF   +  DL++FLFGD
Sbjct: 61  TLAVALAMALTVASLSGRGHAM--DTVLGVLAHSALAFGLVAASFFSGLRVDLSAFLFGD 118

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV+ TD+ +IWG   L   +L   W+ LL  TVN ELA+A G+ P + +L+ ++  +L
Sbjct: 119 ILAVSRTDLAVIWGGSALVAAVLAWRWQGLLTATVNEELAQASGLDPRRERLVLVLALAL 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            ++V+IK +G  LI +LLI+P   AR+ +  PE MA+ AT IG L ++ GL  SL FDTP
Sbjct: 179 TVAVAIKIVGALLIAALLIVPAAAARQLARGPETMALAATGIGALAVLGGLQASLAFDTP 238

Query: 240 SGPSIIITSLFLFILSFFYKK 260
           +GPSI+  +  +F L+   ++
Sbjct: 239 AGPSIVAVAAGIFALTLLLRR 259


>gi|120556682|ref|YP_961033.1| ABC-3 protein [Marinobacter aquaeolei VT8]
 gi|120326531|gb|ABM20846.1| ABC-3 protein [Marinobacter aquaeolei VT8]
          Length = 270

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/254 (42%), Positives = 178/254 (70%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + + 
Sbjct: 9   GDFFWRALLGGLGVALVAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNLGVV 68

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L L+ + +   L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+LA
Sbjct: 69  ITCVLIALALVLLSRTRTLATDTLLGILAHSALAIGLVTLSFMPDVRVDLTGLLFGDLLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D++ I+G     + +L  +W+ LL +T++ ELA+ EG+  E+++L  +++ SL+I+
Sbjct: 129 MTRQDLVWIYGGAAFVLSLLALLWRGLLMSTIHEELARVEGIPVERLRLALMLMFSLVIA 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +G+ LIT+LLI+P  TARR + +PE+M  LA + G++ +  GL  S   DTP+GP
Sbjct: 189 VAMKIVGVLLITALLIIPAATARRLAHNPEHMTALAVVFGVMAVSGGLTLSWYLDTPAGP 248

Query: 243 SIIITSLFLFILSF 256
           S+++T+  +F++ +
Sbjct: 249 SVVVTAFLVFLMVY 262


>gi|84683868|ref|ZP_01011771.1| ABC zinc transporter, inner membrane subunit ZnuB [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668611|gb|EAQ15078.1| ABC zinc transporter, inner membrane subunit ZnuB [Rhodobacterales
           bacterium HTCC2654]
          Length = 287

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/256 (42%), Positives = 174/256 (67%), Gaps = 3/256 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++F +RA F+G+G+  +TGPLG F++W+R+AYFGD  AH+A+LGVAL+LIF +P+T+ 
Sbjct: 28  MFDDFLVRAGFAGVGLAFATGPLGSFVVWRRMAYFGDATAHAAILGVALALIFSVPVTLG 87

Query: 61  IFMIATLTSLVLLQIQ-KNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
              +A   +LV+  +  +  A+  DA LGV++HS ++L LV +SF+  V  DL++FLFGD
Sbjct: 88  TLAVALAMALVVSGLATRGHAM--DATLGVLSHSALALGLVAISFVPGVRVDLSAFLFGD 145

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV   D+L+IWG   + + +L   W PLL  T++ +LA A G+ P + +L+  +  ++
Sbjct: 146 ILAVGRQDLLVIWGGAAVVVALLVWRWAPLLTATMSEDLAVASGIDPRRERLVLTLALAI 205

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +++V++K IG  LI ++LI+P   AR FS +PE MA+ A  IG    + GL  S + DTP
Sbjct: 206 VVAVALKVIGTLLIAAMLIIPAAAARGFSRTPEAMAVSAVGIGAASALAGLGASYLVDTP 265

Query: 240 SGPSIIITSLFLFILS 255
           +GPSI+  +  +F ++
Sbjct: 266 AGPSIVTAAAVIFAIT 281


>gi|152986214|ref|YP_001351613.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PA7]
 gi|150961372|gb|ABR83397.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PA7]
          Length = 262

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 173/240 (72%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAVTVGCVLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+LAV+ TD+L I     L + 
Sbjct: 80  LAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLLAVSATDLLWIIAGSALVLA 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MAI A+++G++ +  GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMAIGASLLGLVAVCAGLALSWFKDTPAGPSIVVSAAGLFLLSFVLPR 259


>gi|145636324|ref|ZP_01791993.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittHH]
 gi|145638682|ref|ZP_01794291.1| RNA-binding protein Hfq [Haemophilus influenzae PittII]
 gi|145270489|gb|EDK10423.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittHH]
 gi|145272277|gb|EDK12185.1| RNA-binding protein Hfq [Haemophilus influenzae PittII]
 gi|309750175|gb|ADO80159.1| Zinc transporter permease subunit ZnuB [Haemophilus influenzae
           R2866]
          Length = 261

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 176/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLFILS F K+
Sbjct: 243 VVICSAFLFILSLFKKE 259


>gi|220935911|ref|YP_002514810.1| ABC-3 protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997221|gb|ACL73823.1| ABC-3 protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 266

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/242 (46%), Positives = 177/242 (73%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RAL  GI + L  GPLG F++W+R+AYFGDT+AHSALLGVAL  +  + L + + 
Sbjct: 2   DDFILRALMGGIAVALVAGPLGSFVVWRRMAYFGDTLAHSALLGVALGFLLGISLNLTVI 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            + T  +++L+ +Q+   L+SD +LG++ HST+SL LV ++F++ V  DL  +LFGDILA
Sbjct: 62  ALCTALAVLLVLLQRQRRLASDTLLGILAHSTLSLGLVSVAFLEGVRIDLMGYLFGDILA 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+L I+G G L +++L  +W+PLLA TV+ +LA+ EG+    + L F+++ +L+I+
Sbjct: 122 VSQGDLLWIFGGGALALILLMILWRPLLAMTVHEDLARVEGVPVMWVSLGFMLLIALVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +GI LITSL+I+P  TARR + +PE MA+ A ++G L ++ G+ GSL +DTP+GP
Sbjct: 182 VAMKVVGILLITSLMIIPAATARRLAATPEQMALYAGVLGSLAVVGGVMGSLTWDTPTGP 241

Query: 243 SI 244
           SI
Sbjct: 242 SI 243


>gi|255262440|ref|ZP_05341782.1| high-affinity zinc uptake system membrane protein ZnuB
           [Thalassiobium sp. R2A62]
 gi|255104775|gb|EET47449.1| high-affinity zinc uptake system membrane protein ZnuB
           [Thalassiobium sp. R2A62]
          Length = 264

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 101/255 (39%), Positives = 166/255 (65%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL F + + + 
Sbjct: 1   MLDDFMVRATLAGIGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLAFSMSIFVG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L +L +         + D +LGV+ HS ++  LV +SF+  +  DL ++LFGDI
Sbjct: 61  TVVVALLMALTV-NFLSRRGYAMDTLLGVLAHSALAFGLVAVSFLSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L  +++   W  LL  T+N +LA A G+ P++ +L   +  ++ 
Sbjct: 120 LAVSRGDLAVIWGGALLVAILICWRWSALLTATLNEDLAYASGINPKREQLALTIALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P+  AR  S +PE MA++A +IG L   +GL  + +FDTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPSAAARPLSQTPEGMALIAGLIGALSASVGLRAAYVFDTPA 239

Query: 241 GPSIIITSLFLFILS 255
           GPSI+  +   F++S
Sbjct: 240 GPSIVCVAAITFLVS 254


>gi|145632654|ref|ZP_01788388.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 3655]
 gi|329122282|ref|ZP_08250870.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
 gi|144986849|gb|EDJ93401.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 3655]
 gi|327473843|gb|EGF19260.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
          Length = 261

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 176/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|126664514|ref|ZP_01735498.1| zinc ABC transporter, permease protein [Marinobacter sp. ELB17]
 gi|126630840|gb|EBA01454.1| zinc ABC transporter, permease protein [Marinobacter sp. ELB17]
          Length = 268

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 177/252 (70%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS + Q+P+ + + 
Sbjct: 7   DDFFWRALIGGLGVALVAGPLGCFVVWRRLAYFGDTLAHSALLGIALSFVIQVPINVGVI 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +L L+   +++ L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+LA
Sbjct: 67  ITCLGLALALVLFSRSKTLATDTLLGILAHSALAIGLVTLSFMPSVRMDLTGLLFGDLLA 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ +D+  I+G     + +L  +W+ LL +T++ ELA+ EG+  E+++L  I++ +++I+
Sbjct: 127 MSRSDLWWIYGGAATILCLLALLWRGLLMSTIHEELARVEGVPVERLRLALILMFAIVIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +G+ LIT+LLI+P  TARR + +PE M  +A + G + +  GL  S   DTP+GP
Sbjct: 187 VAMKIVGVLLITALLIIPAATARRLARTPEQMVAMAMLFGFIAVTGGLALSWELDTPAGP 246

Query: 243 SIIITSLFLFIL 254
           S+++T+   F+L
Sbjct: 247 SVVVTAFSCFLL 258


>gi|330965528|gb|EGH65788.1| zinc ABC transporter permease [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 262

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 173/239 (72%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +   L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTLGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G   L +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSALVLVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 IVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPSI++++  LF+LSF   K
Sbjct: 201 AAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPK 259


>gi|229844431|ref|ZP_04464571.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae 6P18H1]
 gi|229812680|gb|EEP48369.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae 6P18H1]
          Length = 261

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 177/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S ++DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIGGLILSALYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLFILS F K+
Sbjct: 243 VVICSAFLFILSLFKKE 259


>gi|145630420|ref|ZP_01786201.1| RNA-binding protein Hfq [Haemophilus influenzae R3021]
 gi|148825312|ref|YP_001290065.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae PittEE]
 gi|144984155|gb|EDJ91592.1| RNA-binding protein Hfq [Haemophilus influenzae R3021]
 gi|148715472|gb|ABQ97682.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae PittEE]
          Length = 261

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 176/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGIVLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|254439873|ref|ZP_05053367.1| ABC 3 transport family [Octadecabacter antarcticus 307]
 gi|198255319|gb|EDY79633.1| ABC 3 transport family [Octadecabacter antarcticus 307]
          Length = 264

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 165/252 (65%), Gaps = 1/252 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+ L+  PLGCF++W+R+AYFGD  AH+A+LGVALSL   + +   
Sbjct: 1   MLDDFMMRATLAGIGVALAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLALSISVFAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +IA L +L +  +      + D +LGV+ HS ++  LV +SF+  +  DL ++LFGDI
Sbjct: 61  AMVIALLMALTV-NLLTGRGYAMDTLLGVLAHSALAFGLVAVSFLSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L + ++   W  LL  T+N +LA A G+ P++ +L+  +  ++ 
Sbjct: 120 LAVSRLDLTVIWGGAALVVALIGWRWSALLTATLNEDLAYASGIDPKREQLVLTLALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PENMA++A  IG +  ++GL  + IFDTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARPLSRTPENMALVAAGIGSVSALVGLRAAYIFDTPA 239

Query: 241 GPSIIITSLFLF 252
           GPSI+  +  +F
Sbjct: 240 GPSIVCVAAIIF 251


>gi|15600694|ref|NP_254188.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAO1]
 gi|107104603|ref|ZP_01368521.1| hypothetical protein PaerPA_01005682 [Pseudomonas aeruginosa PACS2]
 gi|116053651|ref|YP_793978.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218894604|ref|YP_002443474.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           LESB58]
 gi|254237819|ref|ZP_04931142.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           C3719]
 gi|254243052|ref|ZP_04936374.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa 2192]
 gi|296392366|ref|ZP_06881841.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAb1]
 gi|313111558|ref|ZP_07797357.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           39016]
 gi|9951836|gb|AAG08886.1|AE004962_10 permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAO1]
 gi|115588872|gb|ABJ14887.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169750|gb|EAZ55261.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           C3719]
 gi|126196430|gb|EAZ60493.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa 2192]
 gi|218774833|emb|CAW30651.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           LESB58]
 gi|310883859|gb|EFQ42453.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           39016]
          Length = 262

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 173/240 (72%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAVTVGCVLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+LAV+ +D+L I     L + 
Sbjct: 80  LAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLLAVSASDLLWIIAGSALVLA 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAGPSIVVSAAGLFLLSFVLPR 259


>gi|49082970|gb|AAT50885.1| PA5501 [synthetic construct]
          Length = 263

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 173/240 (72%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAVTVGCVLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+LAV+ +D+L I     L + 
Sbjct: 80  LAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLLAVSASDLLWIIAGSALVLA 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAGPSIVVSAAGLFLLSFVLPR 259


>gi|319898072|ref|YP_004136269.1| high-affinity zinc uptake system membrane protein znub [Haemophilus
           influenzae F3031]
 gi|317433578|emb|CBY81962.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae F3031]
          Length = 261

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLATLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|309972434|gb|ADO95635.1| Zinc transporter permease subunit ZnuB [Haemophilus influenzae
           R2846]
          Length = 261

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A +I +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVISMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLFILS F K+
Sbjct: 243 VVICSAFLFILSLFKKE 259


>gi|254504625|ref|ZP_05116776.1| ABC 3 transport family [Labrenzia alexandrii DFL-11]
 gi|222440696|gb|EEE47375.1| ABC 3 transport family [Labrenzia alexandrii DFL-11]
          Length = 274

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 195/257 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ L  GPLGCF++W+R++YFGDT++H+ALLGVAL+L+  + +T+ 
Sbjct: 1   MLDDFFTRALIAGIGVALVAGPLGCFVVWRRMSYFGDTLSHAALLGVALALLLDVNITLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  ++ + +L+LL ++  + L SDA+LG+++HS +++ LV L+FM WV  DL   LFGDI
Sbjct: 61  VGAVSIVLALLLLALRHGDTLPSDALLGLLSHSALAIGLVCLAFMTWVRVDLLGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V  TDI +I+G G + +  L  IW+ L A TV+ +LA AEG++P++ +L+F+++T+++
Sbjct: 121 LSVTRTDIAMIYGGGAIVLGGLLLIWRQLFAATVSSDLAGAEGLRPDRAELVFMLLTAIV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+K IG  LIT+LLILP   ARR++ SPE MA++A   G++ ++ GL GSL +DTPS
Sbjct: 181 IAISLKIIGALLITALLILPAAAARRWAGSPEQMAVIAAFAGVVAVVAGLNGSLYYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ ++ +F+LS F
Sbjct: 241 GPSIVVAAMLIFVLSLF 257


>gi|331017880|gb|EGH97936.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 262

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 173/239 (72%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +     L +++L+ +Q+ + L
Sbjct: 21  PLGAFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTCGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM+ V  DL ++LFGD+LA++ TD+  I G   L +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMQEVRIDLMAYLFGDLLAISPTDLAWILGGSALVLVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 IVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 201 AAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPR 259


>gi|301169109|emb|CBW28706.1| zinc transporter subunit: membrane component of ABC superfamily
           [Haemophilus influenzae 10810]
          Length = 261

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++WQ++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWQKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|317048518|ref|YP_004116166.1| ABC-3 protein [Pantoea sp. At-9b]
 gi|316950135|gb|ADU69610.1| ABC-3 protein [Pantoea sp. At-9b]
          Length = 261

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     + +
Sbjct: 3   ELLLPGWLGGVFLALAAGPLGAFVVWRRMSYFGDTLAHASLLGVAFGLLFNVNPYYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMSGVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + + ++   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L I V
Sbjct: 123 TPQDLWMMGGGVTIVLAVMAWQWRSLLSMTISPELAQVDGVNIQRTRLMLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA  A IIGIL +  GL  S ++DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRSPEQMAGFAVIIGILAVTGGLSFSALYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K 
Sbjct: 243 VVLCAAVLFIISMAKKP 259


>gi|68249009|ref|YP_248121.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 86-028NP]
 gi|260582329|ref|ZP_05850122.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae NT127]
 gi|68057208|gb|AAX87461.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 86-028NP]
 gi|260094697|gb|EEW78592.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae NT127]
          Length = 261

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 176/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGIVLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A I+ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIIMSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|148827608|ref|YP_001292361.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittGG]
 gi|229846494|ref|ZP_04466602.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 7P49H1]
 gi|319775665|ref|YP_004138153.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae F3047]
 gi|148718850|gb|ABQ99977.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittGG]
 gi|229810587|gb|EEP46305.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 7P49H1]
 gi|317450256|emb|CBY86472.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae F3047]
          Length = 261

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|330874112|gb|EGH08261.1| zinc ABC transporter permease [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 262

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 172/239 (71%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +     L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTFGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G   L +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSALVLVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 IVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPSI++++  LF+LSF   K
Sbjct: 201 AAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPK 259


>gi|291333950|gb|ADD93628.1| ABC 3 protein [uncultured marine bacterium MedDCM-OCT-S04-C448]
          Length = 232

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 163/224 (72%)

Query: 32  IAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVIT 91
           +AYFGDT+AHS+LLGVA+ ++    + + +F      +LVL    + + LS D +LG ++
Sbjct: 1   MAYFGDTVAHSSLLGVAMGVLLGFNVMLGVFAAGFAVALVLSGFLREKRLSGDTVLGTLS 60

Query: 92  HSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLA 151
           H+++SL ++++S M W+  DL  +LFGDILAV+ TD+  ++G G L +++L  +W+PLLA
Sbjct: 61  HASLSLGVIVISLMTWLRVDLMGYLFGDILAVSLTDLYWVYGGGMLVLVLLVLLWRPLLA 120

Query: 152 TTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSP 211
            TV+ ELA+AEG++  + +L+ ++I + +I++++K +G+ L+TSLLI+P   ARR S +P
Sbjct: 121 VTVDEELARAEGIEAARYELMLMLIIAAVIALAMKIVGVLLVTSLLIIPAAAARRLSRTP 180

Query: 212 ENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           E MA++A I+G+L +++GL+ S  FDTPSGPSI++ SL LF+L 
Sbjct: 181 EQMALMAAIVGVLSVLLGLFASFQFDTPSGPSIVLASLMLFLLG 224


>gi|16272356|ref|NP_438569.1| hypothetical protein HI0407 [Haemophilus influenzae Rd KW20]
 gi|260580530|ref|ZP_05848358.1| high-affinity zinc uptake system membrane protein znuB [Haemophilus
           influenzae RdAW]
 gi|1175840|sp|P44691|ZNUB_HAEIN RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|1573380|gb|AAC22066.1| conserved hypothetical integral membrane protein [Haemophilus
           influenzae Rd KW20]
 gi|260092872|gb|EEW76807.1| high-affinity zinc uptake system membrane protein znuB [Haemophilus
           influenzae RdAW]
          Length = 261

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 176/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGIVLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A I+ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIIMSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F ++
Sbjct: 243 VVICSAFLFVLSLFKRE 259


>gi|90415429|ref|ZP_01223363.1| high-affinity zinc uptake system membrane protein [marine gamma
           proteobacterium HTCC2207]
 gi|90332752|gb|EAS47922.1| high-affinity zinc uptake system membrane protein [marine gamma
           proteobacterium HTCC2207]
          Length = 261

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 172/245 (70%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           + L  GPLGCF++W+R+AYFGDT+AHSALLGV++ ++  + ++I +  I  L +L L+ +
Sbjct: 15  VALVAGPLGCFVVWRRMAYFGDTLAHSALLGVSIGVLLGINISITVTAIPMLIALGLVYL 74

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           ++   LS D +LG+++HS ++  LV++S +  V  DL S LFGD+LAV   D+ +++ + 
Sbjct: 75  EQRGILSLDTLLGILSHSALATGLVLISLLPDVRIDLMSLLFGDLLAVTKNDLWVVYAVA 134

Query: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITS 195
              I +L  +WKPL+  TV+ ELA  EG++   ++   ++IT+L+I++++K +G+ LIT+
Sbjct: 135 GTVIALLLWLWKPLINITVHEELASVEGVKTSVVRTALMLITALVIAIAMKIVGVLLITA 194

Query: 196 LLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           LLI+P  TARR S++PE MA++A++I +L +++GL  S   DT +GPS+++ +  LF LS
Sbjct: 195 LLIIPAATARRVSSTPEQMAVMASLIAMLTVMMGLAMSYYSDTQAGPSVVVCAALLFTLS 254

Query: 256 FFYKK 260
             +++
Sbjct: 255 LVFRQ 259


>gi|28872377|ref|NP_794996.1| zinc ABC transporter permease [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971445|ref|ZP_03399558.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato T1]
 gi|301382162|ref|ZP_07230580.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060099|ref|ZP_07251640.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302132371|ref|ZP_07258361.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28855632|gb|AAO58691.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213923806|gb|EEB57388.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato T1]
          Length = 262

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 172/239 (71%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +     L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTCGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G   L +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSALVLVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 IVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G++ + +GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 201 AAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPR 259


>gi|317491789|ref|ZP_07950224.1| ABC 3 transporter [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920223|gb|EFV41547.1| ABC 3 transporter [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 261

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 176/258 (68%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G  + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIAGALLALTAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFFAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L ++ L+ +++   L  D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLAIGLVWLERRPTLGVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              DI++I  IG   ++ IL+  W+PLL+ T++ ELA  +G+  E++++I +++T+L I 
Sbjct: 123 TYNDIVMI-AIGVAIVLGILWWQWRPLLSVTISPELAHVDGVNLERVRMILMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRFS +PE MA +A IIGIL +  GL  S  +DTP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFSRTPEQMASIAVIIGILAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +FILS   K+
Sbjct: 242 SVVLCATAMFILSLSKKQ 259


>gi|119386842|ref|YP_917897.1| ABC-3 protein [Paracoccus denitrificans PD1222]
 gi|119377437|gb|ABL72201.1| ABC-3 protein [Paracoccus denitrificans PD1222]
          Length = 260

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 169/260 (65%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+VL+TG LG F++W+R+AYFGD+ AH+A+LGVALS +F LP+ + 
Sbjct: 1   MLDDFLTRAALAGLGLVLATGALGSFVVWRRMAYFGDSTAHAAILGVALSFVFSLPIYLG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +A   +L++ Q+      S D +LGV+ HS ++L LV +SF+  +   L +FLFGDI
Sbjct: 61  TLAVAVAMALIVAQLTAR-GQSMDTVLGVLAHSALALGLVGVSFVPSLRVGLEAFLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+  IW      + +L   W+ L+  +VN ELA A G+ P + +LI  +  +++
Sbjct: 120 LAVTRADLAWIWAGATAVLGLLIWRWQRLVTASVNEELAMAAGIDPARERLILSLALAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++++I+ +G  LI+++LI+P   AR FS +PE MA  AT+IG + ++ GL+ SL  DTP+
Sbjct: 180 VAIAIRIVGALLISAMLIVPAAAARGFSATPEQMAGSATLIGAISVLGGLWASLWLDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSI+  S  ++ ++    +
Sbjct: 240 GPSIVAISAAIYAVTLVVCR 259


>gi|145628771|ref|ZP_01784571.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 22.1-21]
 gi|144979241|gb|EDJ88927.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 22.1-21]
          Length = 261

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|261252359|ref|ZP_05944932.1| zinc ABC transporter permease protein ZnuB [Vibrio orientalis CIP
           102891]
 gi|260935750|gb|EEX91739.1| zinc ABC transporter permease protein ZnuB [Vibrio orientalis CIP
           102891]
          Length = 261

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/260 (41%), Positives = 180/260 (69%), Gaps = 8/260 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ----LPLTI 59
           EF + ++ +G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL L+      L LT+
Sbjct: 3   EFLLPSILAGLGIAAIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGLLLDINLYLALTV 62

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           C   +A L    L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD
Sbjct: 63  CCLALAIL----LVTLQKQQVVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGD 118

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           +LAV   D++ I+    +   +L   W+ LL+TTVN +LA  EG   + ++L+ +++  L
Sbjct: 119 LLAVTPEDLVYIYLGVVVVAAVLGFFWRSLLSTTVNEDLAAVEGHNVDLMRLVLMLMVGL 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +I++ +KF+G  ++TSLLI+P  TARRF+ +PE MA+ A++IG + +++GL  S  +DTP
Sbjct: 179 VIAIGMKFVGALIMTSLLIIPAATARRFAKAPEQMALFASLIGAIAVLLGLSMSWHYDTP 238

Query: 240 SGPSIIITSLFLFILSFFYK 259
           +GPS++I++  +F+LS  Y+
Sbjct: 239 AGPSVVISATAMFMLSQLYR 258


>gi|145634596|ref|ZP_01790305.1| RNA-binding protein Hfq [Haemophilus influenzae PittAA]
 gi|145268141|gb|EDK08136.1| RNA-binding protein Hfq [Haemophilus influenzae PittAA]
          Length = 261

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 175/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A I+ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIIMSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+LS F K+
Sbjct: 243 VVICSAFLFVLSLFKKE 259


>gi|260767659|ref|ZP_05876594.1| zinc ABC transporter permease protein ZnuB [Vibrio furnissii CIP
           102972]
 gi|260617168|gb|EEX42352.1| zinc ABC transporter permease protein ZnuB [Vibrio furnissii CIP
           102972]
 gi|315179509|gb|ADT86423.1| ABC-type Mn2+/Zn2+ transport system, permease component [Vibrio
           furnissii NCTC 11218]
          Length = 260

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 187/258 (72%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI L  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L   + +
Sbjct: 3   EFLLPSVLAGIGIALIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYFALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +Q+ + +++D +LG++ HS++SL L+ +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLGLAVILVTMQRQQLVATDTLLGILAHSSLSLGLIAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMI-LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D++ IW  G + + I ++  W+PLL+T+VN ELA+ EG+  + ++LI +++  L+I+
Sbjct: 123 SPSDLVFIWS-GVIAVGIAVYLFWRPLLSTSVNEELAQVEGINTDLMRLILMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSL+I+P  TARR + +PE MA+ A+ IG++ ++ GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMTSLMIIPAATARRLARTPEQMALFASSIGMVCVLSGLSLSWQFDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++++  LF+LS F K+
Sbjct: 242 SVVVSATALFMLSHFVKR 259


>gi|170717770|ref|YP_001784836.1| ABC transporter [Haemophilus somnus 2336]
 gi|168825899|gb|ACA31270.1| ABC-3 protein [Haemophilus somnus 2336]
          Length = 261

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 178/260 (68%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT+AHSALLGV L +   +   + I +
Sbjct: 3   EILFPAWLTGILLSLITAPLGSFVVWRKMAYFGDTLAHSALLGVTLGIFLHINPYVAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +++++ ++ N   S D +LG+I HS +SL +V ++ ++ V  DL ++LFGD+LA+
Sbjct: 63  LTVLLAILMVWLESNTQYSIDTLLGIIAHSCLSLGVVTVALLQNVRVDLMAYLFGDLLAL 122

Query: 124 NTTDILLIWGIGF---LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
              D+  I  IG    L I+I F  W+PLL+ TV+ ELA+ EG+  ++++ + +++T+L 
Sbjct: 123 GFDDLYFI-AIGVSIVLGILIFF--WQPLLSITVSPELAQVEGINIKRMQFLLMILTALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+KF+G  +ITSLLI+P  TA+RF+ SPE M I+A  + ++ I +GL  S  +DTPS
Sbjct: 180 IALSMKFVGALIITSLLIIPAATAKRFARSPEMMVIIAIFVSMISITLGLTLSAFYDTPS 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS++I+S FLFILS F K+
Sbjct: 240 GPSVVISSTFLFILSLFKKE 259


>gi|83643430|ref|YP_431865.1| Mn2+/Zn2+ ABC transporter permease [Hahella chejuensis KCTC 2396]
 gi|83631473|gb|ABC27440.1| ABC-type Mn2+/Zn2+ transport system, permease components [Hahella
           chejuensis KCTC 2396]
          Length = 263

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 173/257 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  I AL  GIG+   TGPLGCF++W+R++YFGDT++HSAL+GVAL L+ ++ +++ I  
Sbjct: 3   DILIPALLGGIGLAFITGPLGCFVVWRRMSYFGDTLSHSALMGVALGLMLEVNVSLAITA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L  L L  +Q+ + +++D +LG++ HS++SL LV LSFM+    DL S+LFGD+LA+
Sbjct: 63  GCVLMGLTLALMQRQKHIATDTLLGILAHSSLSLGLVALSFMRDQQVDLMSYLFGDLLAL 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D++ I+      I++L  +W+ LL  T+N +LA  EG    + +L+ +++ SL+I++
Sbjct: 123 NYQDVIWIFAGAVAAIVMLKLLWRSLLMMTLNEDLAAVEGYNILRTQLLLMLMMSLVIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ L+TSLLI+P   AR FS +PE MA LA   G+  ++ GL  S  +DTP+GPS
Sbjct: 183 AMKVVGVLLVTSLLIIPAAAARPFSDTPEKMAALAIASGVFAVVAGLSLSWWWDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LF+ S    +
Sbjct: 243 VVVAAFVLFLSSMGAHR 259


>gi|89052806|ref|YP_508257.1| hypothetical protein Jann_0315 [Jannaschia sp. CCS1]
 gi|88862355|gb|ABD53232.1| ABC-3 [Jannaschia sp. CCS1]
          Length = 265

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 170/252 (67%), Gaps = 1/252 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++F  RA  +G+G+ ++  PLGCF++W+R+AYFGD  AH+A+LGVALSL  Q+ + + 
Sbjct: 1   MFDDFMTRATLAGVGVAIAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLALQMSIFVG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A + +L +  +      + D +LGV+ HS ++  LV +SF+  +  DL ++LFGDI
Sbjct: 61  AVVVALVMALTVTALT-GRGYAMDTLLGVMAHSALAFGLVAVSFLSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+L+IWG   L + ++   W PLL +T+N ELA A  + P++ +LI  +  ++ 
Sbjct: 120 LAVSRLDLLVIWGGAALVVALIAWRWSPLLTSTLNEELAYASSIDPKREQLILTLALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR F+ +PE MA++A +IG L  ++GL  + +FDTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARSFARTPEAMAVIAALIGGLSAVVGLRAAYVFDTPA 239

Query: 241 GPSIIITSLFLF 252
           GPSI+  +  +F
Sbjct: 240 GPSIVCVAAIVF 251


>gi|77456290|ref|YP_345795.1| hypothetical protein Pfl01_0062 [Pseudomonas fluorescens Pf0-1]
 gi|77380293|gb|ABA71806.1| high-affinity zinc ABC transport system, membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 262

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 171/239 (71%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ + +   L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTVAVTVGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G     +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 LVTLWRPLLAITVHEELARVEGLSVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G+L +  GL  S   DTP+GPSI++T+  LF+LSF   +
Sbjct: 201 AAAQRHARSPEQMALGASVLGMLAVCGGLALSWFKDTPAGPSIVVTAAALFLLSFVLPR 259


>gi|88797732|ref|ZP_01113320.1| high-affinity zinc uptake system membrane protein ZnuB [Reinekea
           sp. MED297]
 gi|88779409|gb|EAR10596.1| high-affinity zinc uptake system membrane protein ZnuB [Reinekea
           sp. MED297]
          Length = 284

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 171/254 (67%), Gaps = 1/254 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +G+G+ L+  PLGCF+IW+R+AY GD  AH+++LGVALSLIF LPLT+ 
Sbjct: 1   MLDDFLIRAALAGLGVNLTAAPLGCFVIWRRMAYLGDATAHASILGVALSLIFSLPLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++      +L     N   + D +LGV++HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  V-LLTASLMALLSLALSNRGWAMDTLLGVLSHSALAIGLVAVSFVSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+L IW   FL + +L   W  LL  T+N +LA A G+ P++ +LI  +  +++
Sbjct: 120 LAVSQTDLLTIWVGAFLVVGMLAYRWSNLLLVTLNPDLAIASGIDPKREQLILTLSLAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PE MA+L+ +IG     +GL  S  FDTP+
Sbjct: 180 VAVAIKIVGVLLIVAMLIIPAAGARPLSRTPETMAMLSAVIGGSASGLGLIASYQFDTPT 239

Query: 241 GPSIIITSLFLFIL 254
           GP+I+ T+  LF+L
Sbjct: 240 GPTIVCTATLLFLL 253


>gi|330957156|gb|EGH57416.1| hypothetical protein PMA4326_01115 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 262

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 169/239 (70%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +     L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTCGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++  D+  I G   L ++ 
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPADLAWIMGGSSLVLVT 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 IIALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MAI A+++G+  + IGL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 201 AAAQRHARSPEQMAIGASLLGVTAVCIGLSLSWFKDTPAGPSIVVSAAALFLLSFVLPR 259


>gi|113461181|ref|YP_719250.1| high-affinity zinc uptake system, membrane protein [Haemophilus
           somnus 129PT]
 gi|112823224|gb|ABI25313.1| high-affinity zinc uptake system, membrane protein [Haemophilus
           somnus 129PT]
          Length = 261

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 177/260 (68%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI +   T PLG F++W+++AYFGDT+AHSALLGV L +   +   + I +
Sbjct: 3   EILFPAWLTGILLSFITAPLGAFVVWRKMAYFGDTLAHSALLGVTLGIFLHINPYVAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +++++ ++ N   S D +LG+I HS +SL +V ++ ++ V  DL ++LFGD+LA+
Sbjct: 63  LTVLLAILMVWLESNTQYSIDTLLGIIAHSCLSLGVVTVALLQNVRVDLMAYLFGDLLAL 122

Query: 124 NTTDILLIWGIGF---LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
              D+  I  IG    L I+I F  W+PLL+ TV+ ELA+ EG+  ++++ + +++T+L 
Sbjct: 123 GFDDLYFI-AIGVSIVLGILIFF--WQPLLSITVSPELAQVEGINIKRMQFLLMILTALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+KF+G  +ITSLLI+P  TA+RF+ SPE M I+A  + ++ I +GL  S  +DTPS
Sbjct: 180 IALSMKFVGALIITSLLIIPAATAKRFARSPEMMVIIAIFVSMISITLGLTLSAFYDTPS 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS++I+S FLFILS F K+
Sbjct: 240 GPSVVISSTFLFILSLFKKE 259


>gi|77465566|ref|YP_355069.1| ABC zinc tranporter, inner membrane subunit ZnuB [Rhodobacter
           sphaeroides 2.4.1]
 gi|126464005|ref|YP_001045118.1| ABC-3 protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221369572|ref|YP_002520668.1| ABC-3 protein precursor [Rhodobacter sphaeroides KD131]
 gi|332561237|ref|ZP_08415555.1| ABC-3 protein precursor [Rhodobacter sphaeroides WS8N]
 gi|77389984|gb|ABA81168.1| ABC zinc tranporter, inner membrane subunit ZnuB [Rhodobacter
           sphaeroides 2.4.1]
 gi|126105816|gb|ABN78346.1| ABC-3 protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221162624|gb|ACM03595.1| ABC-3 protein precursor [Rhodobacter sphaeroides KD131]
 gi|332275035|gb|EGJ20351.1| ABC-3 protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 260

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 161/250 (64%), Gaps = 11/250 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---- 56
           M ++F IRA  +GIG+ L+ GPLG F++W+R+AYFGD  +H+A+LGVAL+L  +LP    
Sbjct: 1   MLDDFLIRAALAGIGVALAAGPLGAFVVWRRMAYFGDATSHAAILGVALALATELPVGLG 60

Query: 57  -LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            L + + M AT+ +L           + D +LGV+ HS ++  LV +SF+  V TDL+++
Sbjct: 61  TLAVALVMAATVATL------SGRGWAMDTMLGVLAHSALAFGLVAVSFLPSVRTDLSAW 114

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFGDILAV+  D+  IW    L + +L   W  LL  T+N +LA A G+ P + +LI  +
Sbjct: 115 LFGDILAVSVPDLAFIWAGAALVLALLLWRWSALLTATINEDLAAASGIDPARERLILTL 174

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
             ++ ++V++K +G  LI+++LI+P   AR  + +PE MA+LA +IG    + GL  SL 
Sbjct: 175 ALAVTVAVALKVVGALLISAMLIIPAAAARGLARNPEPMALLAALIGAGASLAGLGASLA 234

Query: 236 FDTPSGPSII 245
           FDTP+GPSI+
Sbjct: 235 FDTPAGPSIV 244


>gi|260432559|ref|ZP_05786530.1| high-affinity zinc uptake system membrane protein ZnuB
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416387|gb|EEX09646.1| high-affinity zinc uptake system membrane protein ZnuB
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 265

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 170/259 (65%), Gaps = 4/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL FQ+ +   
Sbjct: 1   MLDDFMMRATLAGIGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLAFQMSIFAG 60

Query: 61  IFMIATLTSL-VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
             ++A L +  V L  Q+  A+  D +LGV+ HS+++  LV +SF+  +  DL ++LFGD
Sbjct: 61  ALVVALLMAFAVTLLSQRGYAM--DTLLGVMAHSSLAFGLVAVSFLSGIRIDLMAYLFGD 118

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV+ +D+L+IWG   L + ++   W  LL  T+N ELA A G  P + +LI  +  ++
Sbjct: 119 ILAVSRSDLLVIWGGAALVVALVAWRWSQLLTGTLNEELAYASGFDPRREQLILTVSLAV 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            ++V+IK +G+ LI ++LI+P   AR  + SPE+MA+ A  IG +  ++GL  + I DTP
Sbjct: 179 TVAVAIKVVGVLLIAAMLIIPAAAARSLARSPESMAVSAAAIGTVATVVGLRAAYILDTP 238

Query: 240 SGPSIIITSLFLFI-LSFF 257
           +GPSI+  +  +F  LS F
Sbjct: 239 AGPSIVCVAAIIFAGLSLF 257


>gi|325274009|ref|ZP_08140167.1| hypothetical protein G1E_12797 [Pseudomonas sp. TJI-51]
 gi|324100862|gb|EGB98550.1| hypothetical protein G1E_12797 [Pseudomonas sp. TJI-51]
          Length = 260

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 178/257 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVA+     +   + + +
Sbjct: 3   DFLLYALLAGLSLAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVAMGFALDVSPALAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +TTD+  I G   L +++L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I+V
Sbjct: 123 STTDLAWILGGSALVLLLLGVLWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   A+R + SPE MA+ A+++GI  +  GL  S   DTP+GPS
Sbjct: 183 AMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGITAVCGGLAMSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  LF+LS    K
Sbjct: 243 IVVCAAVLFLLSLALPK 259


>gi|323491266|ref|ZP_08096451.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           brasiliensis LMG 20546]
 gi|323314392|gb|EGA67471.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           brasiliensis LMG 20546]
          Length = 274

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/256 (41%), Positives = 171/256 (66%), Gaps = 3/256 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+ L+  PLGCFI+W+R+AYFGD  AH+++LGVALSL F LP+   
Sbjct: 1   MLDDFIWRAALAGVGVTLAAAPLGCFIVWRRMAYFGDATAHASMLGVALSLSFSLPIFPG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  IA + ++ +         + D +LGVI HS +++ LV +SF+  V  DL ++LFGDI
Sbjct: 61  VLFIALIMAITV-STFSGRGYAMDTLLGVIAHSALAIGLVAVSFLSGVRLDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKI-WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           LAV+  D+L+IW +G L ++ L  + W  LL +T+N +LA A G  P++ +LI  +  +L
Sbjct: 120 LAVSKMDLLVIW-VGTLVVIGLISLRWSGLLLSTMNKDLALASGFSPKREQLILTIALAL 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +++V+IK +G+ LI ++LI+P  TAR FS +PE M + A +IG    + GL+ S + DTP
Sbjct: 179 VVAVAIKVVGVLLIVAMLIIPAATARPFSRTPEIMVVFAALIGSSASVAGLHVSYVIDTP 238

Query: 240 SGPSIIITSLFLFILS 255
           +GP+++  +  LF++S
Sbjct: 239 TGPTMVCVATALFVVS 254


>gi|269960713|ref|ZP_06175085.1| zinc ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269834790|gb|EEZ88877.1| zinc ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 261

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 187/258 (72%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI +  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +S+ LV +SF++ V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLENVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I+  G + +   L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+
Sbjct: 123 SPQDLMFIYA-GVIGVSACLYAFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSIAVLMGLSLSWHFDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S++I++ FLF+LS   K+
Sbjct: 242 SVVISATFLFMLSQLIKR 259


>gi|312958173|ref|ZP_07772696.1| zinc transport system permease protein [Pseudomonas fluorescens
           WH6]
 gi|311287604|gb|EFQ66162.1| zinc transport system permease protein [Pseudomonas fluorescens
           WH6]
          Length = 262

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 171/240 (71%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVA+  +  +  TI + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVAMGFLLDVSPTIAVTVGCLLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G     ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLV 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELAK EG+    +++  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLVVLWRPLLAITVHEELAKVEGLPVSGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MAI A+++G+L +  GL  S   DTP+GPSI++ +  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMAIGASLLGMLAVCGGLALSWFKDTPAGPSIVVAAAALFLLSFVLPR 259


>gi|163732890|ref|ZP_02140335.1| zinc ABC transporter, permease protein [Roseobacter litoralis Och
           149]
 gi|161394250|gb|EDQ18574.1| zinc ABC transporter, permease protein [Roseobacter litoralis Och
           149]
          Length = 264

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 170/260 (65%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+ ++  PLGCF++W+R+AYFGD  AH+A+LGVALSL F + + I 
Sbjct: 1   MLDDFMVRAALAGIGVAVAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLAFSMSIFIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L +L +  +      + D +LGV+ HS ++  LV +SF+  V  DL ++LFGDI
Sbjct: 61  TMVVALLMALTV-SVLSGRGYAMDTLLGVLAHSALAFGLVAVSFLSGVRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L ++++   W  LL +T+N +LA A G+ P++ +L+  +  ++ 
Sbjct: 120 LAVSRGDLAVIWGGAALVVLLIGWRWSALLTSTLNEDLAHASGIDPKQEQLVLTLALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PE MA+ A +IG L  I+GL  + +FDTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARPLSRTPEGMALAAGVIGTLSAIVGLRAAYVFDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSI+  +   F+ +   + 
Sbjct: 240 GPSIVCVAALSFLATSLIRN 259


>gi|229587651|ref|YP_002869770.1| high-affinity zinc ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229359517|emb|CAY46358.1| high-affinity zinc ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 262

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 171/240 (71%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVA+  +  +  TI + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVAMGFLLDVSPTIAVTVGCLLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G     ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLV 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    +++  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLVALWRPLLAITVHEELATVEGLPVPSLRMALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MAI A+++G+L +  GL  S   DTP+GPSI++T+  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMAIGASLLGMLAVCGGLALSWFKDTPAGPSIVVTAAALFLLSFVLPR 259


>gi|271500730|ref|YP_003333755.1| ABC-3 protein [Dickeya dadantii Ech586]
 gi|270344285|gb|ACZ77050.1| ABC-3 protein [Dickeya dadantii Ech586]
          Length = 261

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA+ L+  + L   +  
Sbjct: 3   ELLLPGWLAGVCLAVAAGPLGSFVVWRRMSYFGDTLAHASLLGVAIGLLLGVNLFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L ++ L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  ITLLLAVGLVWLERRPGLAIDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
            + D+ LI G G L ++ +L   W+ LL+ TV+ ELA  +G+   + KLI +++T+L I 
Sbjct: 123 TSEDLWLI-GPGVLLVLAVLGWQWQALLSMTVSPELAHVDGVAIARTKLILMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRFS +PE MA+ A   GIL +  GL  S   +TP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFSRTPEQMALCAMGAGILAVTGGLAFSAEANTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCASLLFILSLLKKQ 259


>gi|126734791|ref|ZP_01750537.1| ABC-3 [Roseobacter sp. CCS2]
 gi|126715346|gb|EBA12211.1| ABC-3 [Roseobacter sp. CCS2]
          Length = 265

 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 168/252 (66%), Gaps = 1/252 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA+ +G+G+ L+  PLGCF++W+R+AYFGD  AH+A+LG+AL+L F++ + I 
Sbjct: 1   MLDDFMTRAMLAGVGVALAAAPLGCFVVWRRMAYFGDATAHAAILGIALALAFEMSIFIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +A + +L +         + D +LGV+ HS ++  LV +SF+  +  DL ++LFGDI
Sbjct: 61  AMAVALIMALTV-TFLSGRGYAMDTLLGVLAHSALAFGLVAVSFLSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+++IWG   L + ++   W  LL +T+N ELA A G+ P++ +L+  +  ++ 
Sbjct: 120 LAVSRTDLVVIWGGAALVVALILWRWSALLTSTLNEELAYASGLNPKREQLVLTIALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  + +PE MA +A +IG +  I GL G+ IFDTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARGLARTPEAMAGIAAVIGAISAIAGLQGAYIFDTPA 239

Query: 241 GPSIIITSLFLF 252
           GPSI+  +  LF
Sbjct: 240 GPSIVCVAAILF 251


>gi|110681134|ref|YP_684141.1| zinc ABC transporter, permease protein [Roseobacter denitrificans
           OCh 114]
 gi|109457250|gb|ABG33455.1| zinc ABC transporter, permease protein [Roseobacter denitrificans
           OCh 114]
          Length = 264

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 168/260 (64%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+ ++  PLGCF++W+R+AYFGD  AH+A+LGVALSL F + + I 
Sbjct: 1   MLDDFMVRAALAGIGVAVAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLAFSMSIFIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L +L +  +      + D +LGV+ HS ++  LV +SF+  V  DL ++LFGDI
Sbjct: 61  TMVVALLMALTV-SVLSGRGYAMDTLLGVLAHSALAFGLVAVSFLSGVRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L ++++   W  LL +T+N +LA A G+ P++ +L+  +  ++ 
Sbjct: 120 LAVSRGDLAVIWGGAALVVLLIGWRWSALLTSTLNEDLAHASGLDPKREQLVLTLALAIT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PE MA+ A  IG L  I+GL  + + DTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAAAARPLSRTPEGMALAAGAIGTLSAIVGLRAAYVLDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSI+  +   F+ +   K 
Sbjct: 240 GPSIVCVAALTFLATSVIKS 259


>gi|197285011|ref|YP_002150883.1| high-affinity zinc transporter membrane component [Proteus
           mirabilis HI4320]
 gi|194682498|emb|CAR42458.1| high-affinity zinc uptake system membrane protein [Proteus
           mirabilis HI4320]
          Length = 261

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 173/252 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     +  
Sbjct: 3   ELLLPGWIAGMLLAMAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLFNIEPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +++L+ ++    LS D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLAILLVWLELKPQLSVDTLLGIMAHSALSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D++ I+    + ++++ + W+PLL+ T+N ++A  +G+  ++ +L  +MIT+L I +
Sbjct: 123 NYQDVISIFIGVVIVLLVIIRSWRPLLSMTINQDMAFVDGVNIQRERLKLMMITALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA++A  +G+  I  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRSPEQMAVIAVAVGMFAITGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           +++ +  LF+LS
Sbjct: 243 VVLAASSLFVLS 254


>gi|261340245|ref|ZP_05968103.1| zinc uptake ABC transporter, permease protein ZnuB [Enterobacter
           cancerogenus ATCC 35316]
 gi|288317330|gb|EFC56268.1| zinc uptake ABC transporter, permease protein ZnuB [Enterobacter
           cancerogenus ATCC 35316]
          Length = 261

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 175/257 (68%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGVMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LLA T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVVVLGILFWQWRNLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVIIGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+ S   K
Sbjct: 242 SVVLSAAVLFVFSMMKK 258


>gi|254229703|ref|ZP_04923112.1| ABC 3 transport family [Vibrio sp. Ex25]
 gi|262394879|ref|YP_003286733.1| zinc ABC transporter permease ZnuB [Vibrio sp. Ex25]
 gi|151937748|gb|EDN56597.1| ABC 3 transport family [Vibrio sp. Ex25]
 gi|262338473|gb|ACY52268.1| zinc ABC transporter permease protein ZnuB [Vibrio sp. Ex25]
          Length = 261

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 184/257 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI +  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNVNLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQKQQLVATDTLLGILAHSALSVGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+       + L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+V
Sbjct: 123 SPQDLMFIYAGAAAVSVCLYVFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKISSSPEQMALFASIIGSVAVLMGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++  LF+LS F ++
Sbjct: 243 VVISATSLFMLSQFIRQ 259


>gi|227355413|ref|ZP_03839809.1| high-affinity zinc uptake system membrane protein [Proteus
           mirabilis ATCC 29906]
 gi|227164400|gb|EEI49284.1| high-affinity zinc uptake system membrane protein [Proteus
           mirabilis ATCC 29906]
          Length = 261

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 173/252 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     +  
Sbjct: 3   ELLLPGWIAGMLLAMAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLFNIEPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +++L+ ++    LS D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLAILLVWLELKPQLSVDTLLGIMAHSALSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D++ I+    + ++++ + W+PLL+ T+N ++A  +G+  ++ +L  +MIT+L I +
Sbjct: 123 NYQDVISIFIGVVIVLLVIIRSWRPLLSMTINQDMAFVDGVNIKRERLKLMMITALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA++A  +G+  I  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRSPEQMAVIAVAVGMFAITGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           +++ +  LF+LS
Sbjct: 243 VVLAASSLFVLS 254


>gi|206575874|ref|YP_002237749.1| high-affinity zinc uptake ABC transporter, permease protein
           [Klebsiella pneumoniae 342]
 gi|288934607|ref|YP_003438666.1| ABC transporter [Klebsiella variicola At-22]
 gi|290508808|ref|ZP_06548179.1| high-affinity zinc transporter membrane component znuB [Klebsiella
           sp. 1_1_55]
 gi|206564932|gb|ACI06708.1| high-affinity zinc uptake ABC transporter, permease protein
           [Klebsiella pneumoniae 342]
 gi|288889316|gb|ADC57634.1| ABC-3 protein [Klebsiella variicola At-22]
 gi|289778202|gb|EFD86199.1| high-affinity zinc transporter membrane component znuB [Klebsiella
           sp. 1_1_55]
          Length = 261

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+PLLA T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPQDLIAI-AIGVVIVIGILLWQWRPLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+L +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAAVAVGVGMLAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K 
Sbjct: 242 SVVLCAAVLFILSMTKKA 259


>gi|332290484|ref|YP_004421336.1| high-affinity zinc transporter membrane component [Gallibacterium
           anatis UMN179]
 gi|330433380|gb|AEC18439.1| high-affinity zinc transporter membrane component [Gallibacterium
           anatis UMN179]
          Length = 261

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 181/258 (70%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLG+AL ++F L   I I +
Sbjct: 3   EIIFPAWITGIVLSLITAPLGAFVVWRKMAYFGDTLSHSALLGIALGIVFDLNPYIAILL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++ N   ++D +LG+I H+++SL +V +  +  V  DL ++LFGD+LA+
Sbjct: 63  LIILLALILVWLENNTHFAADTLLGIIAHTSLSLGVVTIGLIGGVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+L I GIG + ++ IL   W+ L++ TVN ELA+ EG+  +K +++ +++T++ I+
Sbjct: 123 TYQDLLWI-GIGVILVLSILCYFWQALISATVNPELAQIEGVDVKKGRIVLMLLTAITIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P  TARRFS +PE+MAI+A II ++ +  GL  S  +DT +GP
Sbjct: 182 LSMKFVGALIITSLLIIPAATARRFSRTPESMAIIAVIISMIAVTGGLLLSAFYDTAAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S++I S  LFILS F K+
Sbjct: 242 SVVICSALLFILSLFKKQ 259


>gi|261867809|ref|YP_003255731.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413141|gb|ACX82512.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 261

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/255 (43%), Positives = 174/255 (68%), Gaps = 6/255 (2%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I  +  L 
Sbjct: 8   AWLTGIILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILALTLLL 67

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           S+ L+ ++ N   S D +LG+I HS +S+ +V +  +K V  DL S+LFGD+LA+N  D 
Sbjct: 68  SIALVWLENNTQFSIDTLLGIIAHSCLSIGVVTVGLLKNVRVDLMSYLFGDLLAINYQD- 126

Query: 129 LLIWGIGFLNIMILFKI---WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
             +W IG   I++L  +   WKPL++ T++ ELA+ EG+  +K++ I +++T+L I++S+
Sbjct: 127 --LWYIGIGAIIVLAALCYFWKPLISATISPELAQVEGINVKKMRFILMILTALTIALSM 184

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           KF+G  +ITSLLI+P  TARRF+ +PE MAI+A  I ++ + +GL  S  +DT +GPS++
Sbjct: 185 KFVGALIITSLLIIPAATARRFARTPETMAIIAVFISMIAVSLGLTLSAYYDTAAGPSVV 244

Query: 246 ITSLFLFILSFFYKK 260
           I S FLF+ S   K+
Sbjct: 245 ICSTFLFLCSLLKKQ 259


>gi|260575818|ref|ZP_05843814.1| ABC-3 protein [Rhodobacter sp. SW2]
 gi|259021971|gb|EEW25271.1| ABC-3 protein [Rhodobacter sp. SW2]
          Length = 263

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 165/257 (64%), Gaps = 11/257 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---- 56
           M ++F IRA  +GIG+ L+ GPLG F++W+R+AYFGD  AH+A+LGVAL+L   LP    
Sbjct: 1   MLDDFLIRAALAGIGVALAAGPLGSFVVWRRMAYFGDATAHAAILGVALALATDLPIGLG 60

Query: 57  -LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            L + + M AT+++L           + D  LGV+ HS ++  LV +SF+  V  DL S+
Sbjct: 61  TLLVALAMAATVSTL------AARGWAMDTTLGVLAHSALAFGLVAVSFIPEVRVDLASY 114

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFGDILAV+  D+  IWG   L + +L   W  LL +T++ +LA A G+ P++ +LI  +
Sbjct: 115 LFGDILAVSRVDLGFIWGGAALVLALLVWRWSALLTSTLSEDLACASGLNPDRERLILTL 174

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
             +++++V++K IG  LI ++LI+P   AR  + SPE MA+LA +IG+   + GL  SL 
Sbjct: 175 ALAVVVAVALKVIGALLIAAMLIIPAAAARGLARSPEQMAVLAALIGMASALGGLRMSLS 234

Query: 236 FDTPSGPSIIITSLFLF 252
           +DTP+GPSI+  +  +F
Sbjct: 235 YDTPAGPSIVAVAACVF 251


>gi|152979483|ref|YP_001345112.1| ABC-3 protein [Actinobacillus succinogenes 130Z]
 gi|150841206|gb|ABR75177.1| ABC-3 protein [Actinobacillus succinogenes 130Z]
          Length = 261

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  + A  +GI +   T PLG F++W+++AYFGDT+AHSALLGVAL +   +   + I +
Sbjct: 3   EILLPAWLTGILLSFITAPLGAFVVWRKMAYFGDTLAHSALLGVALGIFLDINPYLAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++V++ ++ N   S D ILG+I HS +SL +V +  ++ V  DL  +LFGD+LAV
Sbjct: 63  LTVMLAVVMVWLESNTQYSVDTILGIIAHSCLSLGVVTVGLLQNVRVDLMGYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+  I  +G + ++ +L  +WKPL++TTV+ ELA+ EG+   +++ I +++T+L I+
Sbjct: 123 TFEDLGFI-SVGVITVLSVLIYLWKPLISTTVSPELAQVEGINIRRMRFILMILTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P  TARRF+ +PE MA  A II +L + +GL  S  ++T +GP
Sbjct: 182 LSMKFVGALIITSLLIIPAATARRFARTPEMMAGFAVIISMLTVSMGLILSAFYNTAAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S++I S  LF+LS   K+
Sbjct: 242 SVVICSAALFLLSLIKKE 259


>gi|296101802|ref|YP_003611948.1| high-affinity zinc transporter membrane component [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295056261|gb|ADF60999.1| high-affinity zinc transporter membrane component [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 261

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 173/257 (67%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+ LLA TV+ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVVVLGILLWQWRNLLAMTVSPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVIIGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++ +  LFI S   K
Sbjct: 242 SVVLCAAVLFIFSMMKK 258


>gi|293390117|ref|ZP_06634451.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950651|gb|EFE00770.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 267

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 173/250 (69%), Gaps = 6/250 (2%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I  +  L 
Sbjct: 8   AWLTGIILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILALTLLL 67

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           S+ L+ ++ N   S D +LG+I HS +S+ +V +  +K V  DL S+LFGD+LA+N  D 
Sbjct: 68  SIALVWLENNTQFSIDTLLGIIAHSCLSIGVVTVGLLKNVRVDLMSYLFGDLLAINYQD- 126

Query: 129 LLIWGIGFLNIMILFKI---WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
             +W IG   I++L  +   WKPL++TT++ ELA+ EG+  +K++ I +++T+L I++S+
Sbjct: 127 --LWYIGIGAIIVLAALCYFWKPLISTTISPELAQVEGINVKKMRFILMILTALTIALSM 184

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           KF+G  +ITSLLI+P  TARRF+ +PE MAI+A  I ++ + +GL  S  +DT +GPS++
Sbjct: 185 KFVGALIITSLLIIPAATARRFARTPETMAIIAVFISMIAVSLGLTLSAYYDTAAGPSVV 244

Query: 246 ITSLFLFILS 255
           I S FLF+ S
Sbjct: 245 ICSTFLFLCS 254


>gi|300951480|ref|ZP_07165315.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 116-1]
 gi|300956629|ref|ZP_07168908.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 175-1]
 gi|300316611|gb|EFJ66395.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 175-1]
 gi|300449230|gb|EFK12850.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 116-1]
 gi|323940473|gb|EGB36664.1| ABC 3 transporter [Escherichia coli E482]
          Length = 261

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVACGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S ++DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAVYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|16129812|ref|NP_416373.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. MG1655]
 gi|89108699|ref|AP_002479.1| zinc transporter subunit [Escherichia coli str. K-12 substr. W3110]
 gi|157161328|ref|YP_001458646.1| high-affinity zinc transporter membrane component [Escherichia coli
           HS]
 gi|170081515|ref|YP_001730835.1| zinc ABC transporter membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|188494717|ref|ZP_03001987.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 53638]
 gi|238901074|ref|YP_002926870.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli BW2952]
 gi|256022475|ref|ZP_05436340.1| high-affinity zinc transporter membrane component [Escherichia sp.
           4_1_40B]
 gi|301029308|ref|ZP_07192405.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 196-1]
 gi|301645625|ref|ZP_07245554.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 146-1]
 gi|307138522|ref|ZP_07497878.1| high-affinity zinc transporter membrane component [Escherichia coli
           H736]
 gi|331642473|ref|ZP_08343608.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H736]
 gi|2507486|sp|P39832|ZNUB_ECOLI RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|1736502|dbj|BAA15667.1| zinc transporter subunit [Escherichia coli str. K12 substr. W3110]
 gi|1788166|gb|AAC74929.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. MG1655]
 gi|157067008|gb|ABV06263.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli HS]
 gi|169889350|gb|ACB03057.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188489916|gb|EDU65019.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 53638]
 gi|238863796|gb|ACR65794.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli BW2952]
 gi|260449018|gb|ACX39440.1| ABC-3 protein [Escherichia coli DH1]
 gi|299877734|gb|EFI85945.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 196-1]
 gi|301076157|gb|EFK90963.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 146-1]
 gi|315136502|dbj|BAJ43661.1| high-affinity zinc transporter membrane component [Escherichia coli
           DH1]
 gi|331039271|gb|EGI11491.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H736]
          Length = 261

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S ++DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAVYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|261343860|ref|ZP_05971505.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rustigianii DSM 4541]
 gi|282568247|gb|EFB73782.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rustigianii DSM 4541]
          Length = 261

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 177/257 (68%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              DI+ I  IG + +  +LF  W+ LL+ TV+ ELA  +G+  ++ +L+ +M+T+L I 
Sbjct: 123 TYEDIITIL-IGVVVVCGLLFYRWRALLSMTVSAELAFVDGINLQRSRLLLMMVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA++A +IG++ +  GL  S  +DTP+GP
Sbjct: 182 IAMKFVGALIITSLLIIPAATARRFARTPEQMALIAVLIGMVSVTGGLTLSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++TS  LF+LS   K
Sbjct: 242 SVVLTSAILFVLSLCVK 258


>gi|146312074|ref|YP_001177148.1| high-affinity zinc transporter membrane component [Enterobacter sp.
           638]
 gi|145318950|gb|ABP61097.1| ABC-3 protein [Enterobacter sp. 638]
          Length = 261

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 172/257 (66%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAAGLVWLEKRPHLAVDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+ LLA TV+ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIFI-AIGVVIVLGILLWQWRNLLAMTVSEDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A +IG++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVVIGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++ +  +FI S   K
Sbjct: 242 SVVLCAALMFIFSMMKK 258


>gi|83645701|ref|YP_434136.1| Mn2+/Zn2+ ABC transporter permease [Hahella chejuensis KCTC 2396]
 gi|83633744|gb|ABC29711.1| ABC-type Mn2+/Zn2+ transport system, permease components [Hahella
           chejuensis KCTC 2396]
          Length = 258

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 162/249 (65%), Gaps = 1/249 (0%)

Query: 12  SGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLV 71
           + +G+ ++ GPLGCFI+W+R+AYFGD  AH+A+LGVALSL   LP+   + M++ L ++ 
Sbjct: 2   ASLGVAIAAGPLGCFIVWRRMAYFGDATAHAAVLGVALSLTLSLPVFPGVLMVSLLMAIT 61

Query: 72  LLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLI 131
           +  +   ++ + D +LGV+ H++++  LV +SF+  V  DL S+LFGDILAV  TD+ LI
Sbjct: 62  VSALS-GKSFAMDTLLGVMAHASLAFGLVAVSFLSGVRIDLMSYLFGDILAVGKTDLTLI 120

Query: 132 WGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
           W      I ++   W  LL +T+N +LA A G  P++ ++I  +  + +++V+IK +G+ 
Sbjct: 121 WAGAIAVITLVSLRWSGLLLSTLNPDLALASGFNPKREQMILTLALATVVAVAIKVVGVL 180

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           LI ++LI P  TAR FS +PE MA++A  IG L  I GL  + + DTP+GP+I+  +  L
Sbjct: 181 LIAAMLITPAATARHFSRTPEAMAVVAAFIGGLASIGGLRAAFVLDTPTGPTIVCVAALL 240

Query: 252 FILSFFYKK 260
           F+     ++
Sbjct: 241 FLAGDALRR 249


>gi|331683365|ref|ZP_08383966.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H299]
 gi|331079580|gb|EGI50777.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H299]
          Length = 261

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G+L +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMLAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|284006987|emb|CBA72264.1| high-affinity zinc uptake system membrane protein [Arsenophonus
           nasoniae]
          Length = 271

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLG+A  L+  + L   +  
Sbjct: 13  ELLLPGWLAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGIAFGLLLNVNLFYAVIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  + +++L  ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 73  ITLILAILLAWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMANVRMDLMAYLFGDLLSV 132

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
            T D+  I  G+  +  +I+++ W+ LL+ TVN +LA  +G++ +++K++ +++T+L I 
Sbjct: 133 TTEDVFSIAIGVTIVCSIIVWQ-WRNLLSITVNQDLAFVDGVKIQQLKVLLMLVTALTIG 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  T RRF+ +PE MA+ A IIG+  +  GL  S  +DTP+GP
Sbjct: 192 IAMKFVGALIITSLLIIPAATGRRFAKTPEQMAVAAIIIGMFSVTAGLALSAYYDTPAGP 251

Query: 243 SIIITSLFLFILSFFYK 259
           S++I +  LF+LS F K
Sbjct: 252 SVVICASVLFLLSLFVK 268


>gi|193066078|ref|ZP_03047135.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E22]
 gi|194429676|ref|ZP_03062194.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli B171]
 gi|218695425|ref|YP_002403092.1| high-affinity zinc transporter membrane component [Escherichia coli
           55989]
 gi|256017937|ref|ZP_05431802.1| high-affinity zinc transporter membrane component [Shigella sp. D9]
 gi|260844203|ref|YP_003221981.1| zinc transporter subunit ZnuB [Escherichia coli O103:H2 str. 12009]
 gi|260855799|ref|YP_003229690.1| zinc transporter subunit ZnuB [Escherichia coli O26:H11 str. 11368]
 gi|260868394|ref|YP_003234796.1| zinc transporter subunit ZnuB [Escherichia coli O111:H- str. 11128]
 gi|293446246|ref|ZP_06662668.1| znuB [Escherichia coli B088]
 gi|300816249|ref|ZP_07096471.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 107-1]
 gi|300824199|ref|ZP_07104317.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 119-7]
 gi|300924948|ref|ZP_07140875.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 182-1]
 gi|307314061|ref|ZP_07593673.1| ABC-3 protein [Escherichia coli W]
 gi|309794240|ref|ZP_07688664.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 145-7]
 gi|331668553|ref|ZP_08369401.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA271]
 gi|331677740|ref|ZP_08378415.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H591]
 gi|332278971|ref|ZP_08391384.1| zinc uptake ABC transporter [Shigella sp. D9]
 gi|192926315|gb|EDV80952.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E22]
 gi|194412318|gb|EDX28622.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli B171]
 gi|195182921|dbj|BAG66489.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           O111:H-]
 gi|218352157|emb|CAU97896.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli 55989]
 gi|257754448|dbj|BAI25950.1| zinc transporter subunit ZnuB [Escherichia coli O26:H11 str. 11368]
 gi|257759350|dbj|BAI30847.1| zinc transporter subunit ZnuB [Escherichia coli O103:H2 str. 12009]
 gi|257764750|dbj|BAI36245.1| zinc transporter subunit ZnuB [Escherichia coli O111:H- str. 11128]
 gi|291323076|gb|EFE62504.1| znuB [Escherichia coli B088]
 gi|300418884|gb|EFK02195.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 182-1]
 gi|300523270|gb|EFK44339.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 119-7]
 gi|300530939|gb|EFK52001.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 107-1]
 gi|306906199|gb|EFN36716.1| ABC-3 protein [Escherichia coli W]
 gi|308122145|gb|EFO59407.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 145-7]
 gi|315061164|gb|ADT75491.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli W]
 gi|320198053|gb|EFW72661.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli EC4100B]
 gi|323152652|gb|EFZ38928.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli EPECa14]
 gi|323158656|gb|EFZ44670.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli E128010]
 gi|323180656|gb|EFZ66201.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1180]
 gi|323378259|gb|ADX50527.1| ABC-3 protein [Escherichia coli KO11]
 gi|324118919|gb|EGC12808.1| ABC 3 transporter [Escherichia coli E1167]
 gi|331063747|gb|EGI35658.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA271]
 gi|331074200|gb|EGI45520.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H591]
 gi|332101323|gb|EGJ04669.1| zinc uptake ABC transporter [Shigella sp. D9]
          Length = 261

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|215487072|ref|YP_002329503.1| high-affinity zinc transporter membrane component [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312967061|ref|ZP_07781279.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 2362-75]
 gi|215265144|emb|CAS09532.1| zinc transporter subunit ZnuB: membrane component of ABC
           superfamily [Escherichia coli O127:H6 str. E2348/69]
 gi|312288525|gb|EFR16427.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 2362-75]
          Length = 261

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMMAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|295095545|emb|CBK84635.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 261

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 172/257 (66%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG   ++ IL   W+ LLA TV+ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVAVVLGILLWQWRNLLAMTVSPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVIIGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++ +  LFI S   K
Sbjct: 242 SVVLCAAVLFIFSMMKK 258


>gi|258626225|ref|ZP_05721073.1| zinc ABC transporter, permease protein [Vibrio mimicus VM603]
 gi|258581580|gb|EEW06481.1| zinc ABC transporter, permease protein [Vibrio mimicus VM603]
          Length = 265

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 107/257 (41%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 8   EFLLPSLLAGLGIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLV 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 68  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 127

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLLAT+VN ELA  EG   E ++LI +++  L+I+
Sbjct: 128 SPSDLTFIWLGVATVS-LIVYLLWQPLLATSVNEELAFVEGTNTELMRLILMLLIGLVIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TARR S +PE MA  A ++G+L ++ GL  S  FDTP+GP
Sbjct: 187 VGMKFVGALIMGSLLIIPAATARRLSRTPEAMAFWAILLGMLSVLGGLALSWHFDTPAGP 246

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 247 SVVVSATALFVLTQFKR 263


>gi|315634604|ref|ZP_07889888.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Aggregatibacter segnis ATCC 33393]
 gi|315476552|gb|EFU67300.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Aggregatibacter segnis ATCC 33393]
          Length = 261

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 170/248 (68%), Gaps = 2/248 (0%)

Query: 15  GIVLS--TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G+VLS  T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I ++  L S+ +
Sbjct: 12  GMVLSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILVLTILLSIAM 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + ++ N   S D +LG+I HS +S+ +V +  ++ V  DL S+LFGD+LA+   D++ I 
Sbjct: 72  VWLENNTQFSVDTLLGIIAHSCLSIGVVTVGLLQNVRVDLMSYLFGDLLAITYDDLIYIS 131

Query: 133 GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITL 192
               + +  L   WKPL++TT++ ELA+ EG+  ++++ I +++T+L I++S+KF+G  +
Sbjct: 132 LGAIVVLTALIYFWKPLISTTISPELAQVEGINVKRMRFILMILTALTIALSMKFVGALI 191

Query: 193 ITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
           ITSLLI+P   A+RF+ +PE+M  +A I+ +L + +GL  S  +DT +GPS++I + FLF
Sbjct: 192 ITSLLIIPAAAAKRFARTPESMVGIAVIVSMLAVSMGLTLSAYYDTAAGPSVVICATFLF 251

Query: 253 ILSFFYKK 260
           + S   K+
Sbjct: 252 LCSLLKKE 259


>gi|91211084|ref|YP_541070.1| high-affinity zinc transporter membrane component [Escherichia coli
           UTI89]
 gi|117624011|ref|YP_852924.1| high-affinity zinc transporter membrane component [Escherichia coli
           APEC O1]
 gi|157155379|ref|YP_001463162.1| high-affinity zinc transporter membrane component [Escherichia coli
           E24377A]
 gi|170019796|ref|YP_001724750.1| high-affinity zinc transporter membrane component [Escherichia coli
           ATCC 8739]
 gi|191172985|ref|ZP_03034519.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli F11]
 gi|194439081|ref|ZP_03071164.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 101-1]
 gi|209919226|ref|YP_002293310.1| high-affinity zinc transporter membrane component [Escherichia coli
           SE11]
 gi|218554447|ref|YP_002387360.1| high-affinity zinc transporter membrane component [Escherichia coli
           IAI1]
 gi|218558724|ref|YP_002391637.1| high-affinity zinc transporter membrane component [Escherichia coli
           S88]
 gi|218699569|ref|YP_002407198.1| high-affinity zinc transporter membrane component [Escherichia coli
           IAI39]
 gi|237705813|ref|ZP_04536294.1| zinc uptake ABC transporter [Escherichia sp. 3_2_53FAA]
 gi|253773184|ref|YP_003036015.1| high-affinity zinc transporter membrane component [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161919|ref|YP_003045027.1| high-affinity zinc transporter membrane component [Escherichia coli
           B str. REL606]
 gi|293410171|ref|ZP_06653747.1| znuB [Escherichia coli B354]
 gi|300904743|ref|ZP_07122573.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 84-1]
 gi|300928890|ref|ZP_07144395.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 187-1]
 gi|300982163|ref|ZP_07175898.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 200-1]
 gi|301304448|ref|ZP_07210560.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 124-1]
 gi|306814311|ref|ZP_07448477.1| high-affinity zinc transporter membrane component [Escherichia coli
           NC101]
 gi|312969899|ref|ZP_07784082.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1827-70]
 gi|91072658|gb|ABE07539.1| ZnuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           UTI89]
 gi|115513135|gb|ABJ01210.1| ZnuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           APEC O1]
 gi|157077409|gb|ABV17117.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E24377A]
 gi|169754724|gb|ACA77423.1| ABC-3 protein [Escherichia coli ATCC 8739]
 gi|190906696|gb|EDV66301.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli F11]
 gi|194422040|gb|EDX38044.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 101-1]
 gi|209912485|dbj|BAG77559.1| zinc ABC transporter permease component [Escherichia coli SE11]
 gi|218361215|emb|CAQ98799.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli IAI1]
 gi|218365493|emb|CAR03220.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli S88]
 gi|218369555|emb|CAR17324.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli IAI39]
 gi|222033608|emb|CAP76349.1| High-affinity zinc uptake system membrane protein znuB [Escherichia
           coli LF82]
 gi|226900570|gb|EEH86829.1| zinc uptake ABC transporter [Escherichia sp. 3_2_53FAA]
 gi|242377580|emb|CAQ32335.1| znuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253324228|gb|ACT28830.1| ABC-3 protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973820|gb|ACT39491.1| high-affinity zinc transporter membrane component [Escherichia coli
           B str. REL606]
 gi|253978014|gb|ACT43684.1| high-affinity zinc transporter membrane component [Escherichia coli
           BL21(DE3)]
 gi|291470639|gb|EFF13123.1| znuB [Escherichia coli B354]
 gi|294493785|gb|ADE92541.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli IHE3034]
 gi|300307319|gb|EFJ61839.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 200-1]
 gi|300403327|gb|EFJ86865.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 84-1]
 gi|300463118|gb|EFK26611.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 187-1]
 gi|300840299|gb|EFK68059.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 124-1]
 gi|305852470|gb|EFM52921.1| high-affinity zinc transporter membrane component [Escherichia coli
           NC101]
 gi|307626658|gb|ADN70962.1| high-affinity zinc transporter membrane component [Escherichia coli
           UM146]
 gi|309702083|emb|CBJ01397.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           ETEC H10407]
 gi|310338184|gb|EFQ03273.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1827-70]
 gi|312946459|gb|ADR27286.1| high-affinity zinc transporter membrane component [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315257310|gb|EFU37278.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 85-1]
 gi|315286572|gb|EFU46007.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 110-3]
 gi|320194425|gb|EFW69056.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli WV_060327]
 gi|323186365|gb|EFZ71715.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1357]
 gi|323937117|gb|EGB33397.1| ABC 3 transporter [Escherichia coli E1520]
 gi|323948255|gb|EGB44243.1| ABC 3 transporter [Escherichia coli H120]
 gi|323952361|gb|EGB48234.1| ABC 3 transporter [Escherichia coli H252]
 gi|323956490|gb|EGB52232.1| ABC 3 transporter [Escherichia coli H263]
 gi|323961914|gb|EGB57513.1| ABC 3 transporter [Escherichia coli H489]
 gi|323972633|gb|EGB67836.1| ABC 3 transporter [Escherichia coli TA007]
 gi|324007234|gb|EGB76453.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 57-2]
 gi|324012872|gb|EGB82091.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 60-1]
 gi|324018002|gb|EGB87221.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 117-3]
 gi|332343585|gb|AEE56919.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli UMNK88]
          Length = 261

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|194446294|ref|YP_002041158.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194404957|gb|ACF65179.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
          Length = 261

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|300717082|ref|YP_003741885.1| Zinc uptake ABC transporter permease [Erwinia billingiae Eb661]
 gi|299062918|emb|CAX60038.1| Zinc uptake ABC transporter, permease protein [Erwinia billingiae
           Eb661]
          Length = 261

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +   F+G  + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWFAGFLLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNISPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L SL+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  ITLLLSLLLVWLERRPHLAIDTLLGILAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+  I     + + +L   W+ LL+ T++ ELA+ +G+  ++ K++ +++T+L I V
Sbjct: 123 TPTDLYTIGAGVAIVLAVLAFYWRSLLSMTISPELAQVDGVNIQRTKMVLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE MA +A ++GIL +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPEQMAGIAILVGILAVTAGLTFSAWYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +F+LS   + 
Sbjct: 243 VVLGASLMFMLSMMKRP 259


>gi|146309512|ref|YP_001189977.1| ABC-3 protein [Pseudomonas mendocina ymp]
 gi|145577713|gb|ABP87245.1| ABC-3 protein [Pseudomonas mendocina ymp]
          Length = 262

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 164/225 (72%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL L+  +  T+ + +   L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGLMLDVNPTLAVTVGCVLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++ HST+SL LV+LSFM+ V  DL  +LFGD+LAV+ +D+  I G   L + +
Sbjct: 81  ASDTLLGILAHSTLSLGLVVLSFMQEVRIDLMGYLFGDLLAVSPSDLAWIIGGSALVLAL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L  +W+PLLA TV+ ELA+ EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 LTWLWRPLLAITVHEELARVEGLPVAAIRLALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
             A+R + +PE MA+ A+++G++ +  GL  S   DTP+GPSI++
Sbjct: 201 AAAQRHARTPEQMAVGASLLGLVAVCAGLAMSWYQDTPAGPSIVV 245


>gi|62180471|ref|YP_216888.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|62128104|gb|AAX65807.1| ABC superfamily (atp_bind) high affinity Zn transport protein
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
          Length = 261

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISSDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S ++DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSALYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|82543692|ref|YP_407639.1| high-affinity zinc transporter membrane component [Shigella boydii
           Sb227]
 gi|81245103|gb|ABB65811.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|320187793|gb|EFW62467.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella flexneri CDC 796-83]
 gi|332096678|gb|EGJ01669.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           boydii 3594-74]
          Length = 261

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLALDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|70733588|ref|YP_257228.1| zinc ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347887|gb|AAY95493.1| zinc ABC transporter, permease protein [Pseudomonas fluorescens
           Pf-5]
          Length = 262

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 169/239 (70%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT++H+ALLGVAL  +  +   + + +   L +++L+ +Q+ + L
Sbjct: 21  PLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPAVAVTVGCLLLAVLLVTLQQRQPL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++  D+  I G     +++
Sbjct: 81  ASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPGDLAWILGGSAAVLLL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P 
Sbjct: 141 LVALWRPLLAITVHEELARVEGLPVASLRLALMLLIAVVIAVAMKIVGVLLITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             A+R + SPE MA+ A+++G+L +  GL  S   DTP+GPSI++T+  LF+LSF   +
Sbjct: 201 AAAQRHARSPEQMALGASLLGMLAVCGGLALSWFKDTPAGPSIVVTAATLFLLSFVLPR 259


>gi|52424844|ref|YP_087981.1| ZnuB protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306896|gb|AAU37396.1| ZnuB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 261

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 15  GIVLS--TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           GI+LS  T PLG F++W+++AYFGDT++HSALLGVAL +   +   + I ++  + ++ +
Sbjct: 12  GILLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGICLDINPYLSILILTLILAVAM 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + ++ N   S D +LG+I HS +SL +V +  ++ V  DL  +LFGD+LAV+  D++ I 
Sbjct: 72  VWLESNTQFSVDTLLGIIAHSCLSLGVVTVGLLQNVRVDLMGYLFGDLLAVSYEDLIYI- 130

Query: 133 GIGFLNIMI-LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
           GIG L ++I L   WKPL++TTV+ ELA+ EG+   +++ I +++T+L I++S+KF+G  
Sbjct: 131 GIGVLIVLISLIYFWKPLISTTVSPELAQVEGINIRRMRFILMILTALTIALSMKFVGAL 190

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           +ITSLLI+P  TARRF+ +PE+MAI+A  + I+ + +GL  S  ++T +GPS++I S F+
Sbjct: 191 IITSLLIIPAATARRFARTPESMAIIAVGLSIVAVSLGLTLSAFYNTAAGPSVVICSSFI 250

Query: 252 FILSFFYKK 260
           F++S   K+
Sbjct: 251 FLISLLKKE 259


>gi|262166193|ref|ZP_06033930.1| zinc ABC transporter permease protein ZnuB [Vibrio mimicus VM223]
 gi|262025909|gb|EEY44577.1| zinc ABC transporter permease protein ZnuB [Vibrio mimicus VM223]
          Length = 272

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 15  EFLLPSLLAGLGIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 75  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 134

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLLAT+VN ELA  EG   + ++LI +++  L+I+
Sbjct: 135 SPSDLTFIWLGVATVS-LIVYLLWQPLLATSVNEELAFVEGTNTDLMRLILMLLIGLVIA 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TARR S +PE MA  A ++G+L ++ GL  S  FDTP+GP
Sbjct: 194 VGMKFVGALIMGSLLIIPAATARRLSRTPEAMAFWAILLGMLSVLGGLALSWHFDTPAGP 253

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 254 SVVVSAAALFVLTQFKR 270


>gi|262170927|ref|ZP_06038605.1| zinc ABC transporter permease protein ZnuB [Vibrio mimicus MB-451]
 gi|261892003|gb|EEY37989.1| zinc ABC transporter permease protein ZnuB [Vibrio mimicus MB-451]
          Length = 260

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 3   EFLLPSLLAGLGIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 63  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 122

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLLAT+VN ELA  EG   + ++LI +++  L+I+
Sbjct: 123 SPSDLTFIWLGVATVS-LIVYLLWQPLLATSVNEELAFVEGTNTDLMRLILMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TARR S +PE MA  A ++G+L ++ GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMGSLLIIPAATARRLSRTPEAMAFWAILLGMLSVLSGLALSWHFDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 242 SVVVSATALFVLTQFKR 258


>gi|183599003|ref|ZP_02960496.1| hypothetical protein PROSTU_02447 [Providencia stuartii ATCC 25827]
 gi|188021218|gb|EDU59258.1| hypothetical protein PROSTU_02447 [Providencia stuartii ATCC 25827]
          Length = 261

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 176/260 (67%), Gaps = 8/260 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIT 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L SL+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLSLILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKI----WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           N  DI+ I    F+ ++++  +    W+ LL+ TVN ELA  +G+  ++++L+ +++T+L
Sbjct: 123 NYEDIITI----FIGVIVVCGLLCWRWRALLSMTVNQELAFVDGVNIQRLRLLLMLVTAL 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I +++KF+G  +ITSLLI+P  TARRF+ +PE MA++A +IG+L +  GL  S  +DTP
Sbjct: 179 TIGIAMKFVGALIITSLLIIPAATARRFAKTPEQMALIAILIGMLSVTGGLTFSAFYDTP 238

Query: 240 SGPSIIITSLFLFILSFFYK 259
           +GPS+++T+  LF  S   K
Sbjct: 239 AGPSVVLTAAILFAFSLLVK 258


>gi|323174751|gb|EFZ60367.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli LT-68]
          Length = 261

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|187733450|ref|YP_001879636.1| high-affinity zinc transporter membrane component [Shigella boydii
           CDC 3083-94]
 gi|193069896|ref|ZP_03050845.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E110019]
 gi|187430442|gb|ACD09716.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella boydii
           CDC 3083-94]
 gi|192956796|gb|EDV87250.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E110019]
 gi|320173571|gb|EFW48766.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella dysenteriae CDC 74-1112]
 gi|320182603|gb|EFW57492.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella boydii ATCC 9905]
 gi|332090036|gb|EGI95136.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           boydii 5216-82]
          Length = 261

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|323186866|gb|EFZ72185.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli RN587/1]
          Length = 261

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL +V++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGMVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|15802272|ref|NP_288296.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 EDL933]
 gi|15831823|ref|NP_310596.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. Sakai]
 gi|168747887|ref|ZP_02772909.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4113]
 gi|168757893|ref|ZP_02782900.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4401]
 gi|168762347|ref|ZP_02787354.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4501]
 gi|168770842|ref|ZP_02795849.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4486]
 gi|168777760|ref|ZP_02802767.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4196]
 gi|168788280|ref|ZP_02813287.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC869]
 gi|195940295|ref|ZP_03085677.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810636|ref|ZP_03252512.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4206]
 gi|208816531|ref|ZP_03257651.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4045]
 gi|209400842|ref|YP_002270942.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4115]
 gi|217328955|ref|ZP_03445036.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. TW14588]
 gi|254793483|ref|YP_003078320.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227640|ref|ZP_05941921.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258194|ref|ZP_05950727.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|12515915|gb|AAG56849.1|AE005408_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13362037|dbj|BAB35992.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187767082|gb|EDU30926.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4196]
 gi|188017398|gb|EDU55520.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4113]
 gi|189355200|gb|EDU73619.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4401]
 gi|189360312|gb|EDU78731.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4486]
 gi|189367340|gb|EDU85756.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4501]
 gi|189371965|gb|EDU90381.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC869]
 gi|208725152|gb|EDZ74859.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4206]
 gi|208730874|gb|EDZ79563.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4045]
 gi|209162242|gb|ACI39675.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4115]
 gi|209767488|gb|ACI82056.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767490|gb|ACI82057.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767492|gb|ACI82058.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767496|gb|ACI82060.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|217318302|gb|EEC26729.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. TW14588]
 gi|254592883|gb|ACT72244.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|320188560|gb|EFW63222.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. EC1212]
 gi|320641713|gb|EFX11101.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. G5101]
 gi|320647073|gb|EFX15906.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H- str. 493-89]
 gi|320652356|gb|EFX20654.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H- str. H 2687]
 gi|320668428|gb|EFX35255.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326342239|gb|EGD66020.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. 1044]
 gi|326343789|gb|EGD67551.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. 1125]
          Length = 261

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTDGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|258621150|ref|ZP_05716184.1| zinc ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|258586538|gb|EEW11253.1| zinc ABC transporter, permease protein [Vibrio mimicus VM573]
          Length = 265

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 8   EFLLPSLLAGLGIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLV 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 68  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 127

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLLAT+VN ELA  EG   + ++LI +++  L+I+
Sbjct: 128 SPSDLTFIWLGVATVS-LIVYLLWQPLLATSVNEELAFVEGTNTDLMRLILMLLIGLVIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TARR S +PE MA  A ++G+L ++ GL  S  FDTP+GP
Sbjct: 187 VGMKFVGALIMGSLLIIPAATARRLSRTPEAMAFWAILLGMLSVLGGLALSWHFDTPAGP 246

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 247 SVVVSAAALFVLTQFKR 263


>gi|224583602|ref|YP_002637400.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|224468129|gb|ACN45959.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322714946|gb|EFZ06517.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 261

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S ++DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSALYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|301327648|ref|ZP_07220856.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 78-1]
 gi|300845796|gb|EFK73556.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 78-1]
          Length = 261

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ + K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLGKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K+
Sbjct: 242 SVVLCAALLFILSMMKKQ 259


>gi|91228432|ref|ZP_01262357.1| zinc ABC transporter, permease protein [Vibrio alginolyticus 12G01]
 gi|269967957|ref|ZP_06181997.1| zinc ABC transporter, permease protein [Vibrio alginolyticus 40B]
 gi|91188016|gb|EAS74323.1| zinc ABC transporter, permease protein [Vibrio alginolyticus 12G01]
 gi|269827480|gb|EEZ81774.1| zinc ABC transporter, permease protein [Vibrio alginolyticus 40B]
          Length = 261

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI +  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNVNLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +S+ LV +SF++ V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLENVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+         L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+V
Sbjct: 123 SPQDLMFIYAGVVAVSACLYVFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSVAVLMGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++  LF+LS   K 
Sbjct: 243 VVISATSLFMLSQLIKS 259


>gi|110641977|ref|YP_669707.1| high-affinity zinc transporter membrane component [Escherichia coli
           536]
 gi|110343569|gb|ABG69806.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli 536]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ +     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISVAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|327394171|dbj|BAK11593.1| high-affinity zinc uptake system membrane protein ZnuB [Pantoea
           ananatis AJ13355]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 170/260 (65%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKI---WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
             +D+   W +    I +L  +   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L 
Sbjct: 123 TPSDL---WAMAAGVIFVLAVMAWQWRALLSMTISPELAQVDGVNIQRTRLMLMLVTALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I V++KF+G  +ITSLLI+P  TARRF+ SPE MA +A +IG++ +  GL  S  +DTP+
Sbjct: 180 IGVAMKFVGALIITSLLIIPAATARRFARSPEMMAAVAVLIGVIAVTGGLTFSAFYDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS+++ +  LF+ S   K 
Sbjct: 240 GPSVVLCAAILFLFSMVRKP 259


>gi|238895436|ref|YP_002920171.1| high-affinity zinc transporter membrane component [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238547753|dbj|BAH64104.1| high-affinity zinc uptake system membrane protein [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+ LLA T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPQDLIAI-AIGVVIVIGILLWQWRNLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+L +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAAVAVGVGMLAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K 
Sbjct: 242 SVVLCAAVLFILSMTKKA 259


>gi|198245595|ref|YP_002215193.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|197940111|gb|ACH77444.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|301018305|ref|ZP_07182814.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 69-1]
 gi|331663355|ref|ZP_08364265.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA143]
 gi|300399741|gb|EFJ83279.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 69-1]
 gi|331059154|gb|EGI31131.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA143]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|204931076|ref|ZP_03221902.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|204320120|gb|EDZ05325.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|322616893|gb|EFY13801.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618131|gb|EFY15023.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322625802|gb|EFY22621.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322626254|gb|EFY23064.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322632668|gb|EFY29413.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322639012|gb|EFY35705.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322640452|gb|EFY37105.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644217|gb|EFY40762.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649540|gb|EFY45972.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322655447|gb|EFY51755.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660226|gb|EFY56464.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322662907|gb|EFY59114.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322668092|gb|EFY64251.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322674148|gb|EFY70242.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322675498|gb|EFY71572.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322683088|gb|EFY79104.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686782|gb|EFY82760.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323195327|gb|EFZ80507.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323199219|gb|EFZ84314.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204056|gb|EFZ89071.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207476|gb|EFZ92424.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323210661|gb|EFZ95539.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323217459|gb|EGA02178.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219948|gb|EGA04421.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224440|gb|EGA08728.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323231482|gb|EGA15595.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323235923|gb|EGA20002.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323240493|gb|EGA24536.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323245385|gb|EGA29385.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246749|gb|EGA30721.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323253605|gb|EGA37433.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255373|gb|EGA39143.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323260266|gb|EGA43887.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323266857|gb|EGA50343.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269063|gb|EGA52519.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|104779383|ref|YP_605881.1| Zinc ABC transporter permease [Pseudomonas entomophila L48]
 gi|95108370|emb|CAK13064.1| Zinc ABC transporter, permease protein [Pseudomonas entomophila
           L48]
          Length = 260

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 168/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL     +   + + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFALDVSPALAVTVGCLLLAILLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++TTD+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLV 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAALWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 200 AAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 259


>gi|330001189|ref|ZP_08303911.1| high-affinity zinc transporter membrane component [Klebsiella sp.
           MS 92-3]
 gi|328537759|gb|EGF63960.1| high-affinity zinc transporter membrane component [Klebsiella sp.
           MS 92-3]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 172/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+ LLA T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPQDLIAI-AIGVMIVIGILLWQWRNLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+L +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAAVAVGVGMLAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K 
Sbjct: 242 SVVLCAAVLFILSMTKKA 259


>gi|194433936|ref|ZP_03066208.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella
           dysenteriae 1012]
 gi|194417808|gb|EDX33905.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella
           dysenteriae 1012]
 gi|332095255|gb|EGJ00282.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 155-74]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIAI-AIGVVIVVAILFWQWRNLLSMTISPDLAFIDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|26248125|ref|NP_754165.1| high-affinity zinc transporter membrane component [Escherichia coli
           CFT073]
 gi|74311811|ref|YP_310230.1| high-affinity zinc transporter membrane component [Shigella sonnei
           Ss046]
 gi|170679836|ref|YP_001743385.1| high-affinity zinc transporter membrane component [Escherichia coli
           SMS-3-5]
 gi|218689797|ref|YP_002398009.1| high-affinity zinc transporter membrane component [Escherichia coli
           ED1a]
 gi|218705360|ref|YP_002412879.1| high-affinity zinc transporter membrane component [Escherichia coli
           UMN026]
 gi|227885713|ref|ZP_04003518.1| high-affinity zinc transporter membrane component [Escherichia coli
           83972]
 gi|291283041|ref|YP_003499859.1| Zinc uptake ABC transporter permease protein ZnuB [Escherichia coli
           O55:H7 str. CB9615]
 gi|293405354|ref|ZP_06649346.1| znuB [Escherichia coli FVEC1412]
 gi|293415174|ref|ZP_06657817.1| znuB [Escherichia coli B185]
 gi|298380996|ref|ZP_06990595.1| znuB [Escherichia coli FVEC1302]
 gi|300899109|ref|ZP_07117392.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 198-1]
 gi|300917564|ref|ZP_07134219.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 115-1]
 gi|300935834|ref|ZP_07150792.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 21-1]
 gi|300994112|ref|ZP_07180695.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 45-1]
 gi|301050787|ref|ZP_07197644.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 185-1]
 gi|331647456|ref|ZP_08348548.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M605]
 gi|331653268|ref|ZP_08354273.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M718]
 gi|331673389|ref|ZP_08374157.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA280]
 gi|26108528|gb|AAN80730.1|AE016761_305 High-affinity zinc uptake system membrane protein znuB [Escherichia
           coli CFT073]
 gi|73855288|gb|AAZ87995.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|170517554|gb|ACB15732.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli SMS-3-5]
 gi|209767494|gb|ACI82059.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|218427361|emb|CAR08256.2| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli ED1a]
 gi|218432457|emb|CAR13350.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli UMN026]
 gi|227837286|gb|EEJ47752.1| high-affinity zinc transporter membrane component [Escherichia coli
           83972]
 gi|281178927|dbj|BAI55257.1| zinc ABC transporter permease component [Escherichia coli SE15]
 gi|284921779|emb|CBG34852.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           042]
 gi|290762914|gb|ADD56875.1| Zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O55:H7 str. CB9615]
 gi|291427562|gb|EFF00589.1| znuB [Escherichia coli FVEC1412]
 gi|291432822|gb|EFF05801.1| znuB [Escherichia coli B185]
 gi|298278438|gb|EFI19952.1| znuB [Escherichia coli FVEC1302]
 gi|300297542|gb|EFJ53927.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 185-1]
 gi|300357266|gb|EFJ73136.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 198-1]
 gi|300406374|gb|EFJ89912.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 45-1]
 gi|300415218|gb|EFJ98528.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 115-1]
 gi|300458946|gb|EFK22439.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 21-1]
 gi|307553878|gb|ADN46653.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli ABU 83972]
 gi|315290338|gb|EFU49714.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 153-1]
 gi|320657957|gb|EFX25719.1| high-affinity zinc transporter membrane component [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320658530|gb|EFX26224.1| high-affinity zinc transporter membrane component [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|323165018|gb|EFZ50808.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           sonnei 53G]
 gi|323968627|gb|EGB64033.1| ABC 3 transporter [Escherichia coli M863]
 gi|323977957|gb|EGB73043.1| ABC 3 transporter [Escherichia coli TW10509]
 gi|327252983|gb|EGE64637.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli STEC_7v]
 gi|330911669|gb|EGH40179.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli AA86]
 gi|331043180|gb|EGI15318.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M605]
 gi|331049366|gb|EGI21438.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M718]
 gi|331069587|gb|EGI40974.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA280]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|283832742|ref|ZP_06352483.1| zinc uptake ABC transporter, permease protein ZnuB [Citrobacter
           youngae ATCC 29220]
 gi|291072425|gb|EFE10534.1| zinc uptake ABC transporter, permease protein ZnuB [Citrobacter
           youngae ATCC 29220]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPDDLIAI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|16765235|ref|NP_460850.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167552473|ref|ZP_02346226.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167994194|ref|ZP_02575286.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168234046|ref|ZP_02659104.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238523|ref|ZP_02663581.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168241521|ref|ZP_02666453.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168259834|ref|ZP_02681807.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168462576|ref|ZP_02696507.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168820716|ref|ZP_02832716.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194449891|ref|YP_002045946.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194470572|ref|ZP_03076556.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737285|ref|YP_002114928.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197249045|ref|YP_002146130.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197262375|ref|ZP_03162449.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|200389939|ref|ZP_03216550.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205352401|ref|YP_002226202.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856586|ref|YP_002243237.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|238912047|ref|ZP_04655884.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|16420429|gb|AAL20809.1| ABC superfamily high affinity Zn transport protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|194408195|gb|ACF68414.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194456936|gb|EDX45775.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712787|gb|ACF92008.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195634593|gb|EDX52945.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197212748|gb|ACH50145.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197240630|gb|EDY23250.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288647|gb|EDY28022.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|199602384|gb|EDZ00930.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205272182|emb|CAR37040.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205322932|gb|EDZ10771.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327896|gb|EDZ14660.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205331999|gb|EDZ18763.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339430|gb|EDZ26194.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205342733|gb|EDZ29497.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205351260|gb|EDZ37891.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708389|emb|CAR32693.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261247064|emb|CBG24883.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267993875|gb|ACY88760.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301158414|emb|CBW17921.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312912887|dbj|BAJ36861.1| high-affinity zinc ABC transporter permease protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320085490|emb|CBY95271.1| Chelated iron transport system membrane protein yfeD [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321224536|gb|EFX49599.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323130177|gb|ADX17607.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326622942|gb|EGE29287.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326627453|gb|EGE33796.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332988787|gb|AEF07770.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|99078584|ref|YP_611842.1| hypothetical protein TM1040_3613 [Ruegeria sp. TM1040]
 gi|99035722|gb|ABF62580.1| ABC-3 [Ruegeria sp. TM1040]
          Length = 270

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/255 (40%), Positives = 167/255 (65%), Gaps = 11/255 (4%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----L 57
           ++F IRA  +GIG+  +  PLGCF++W+R+AYFGD  AH+++LGVAL+L F +      L
Sbjct: 5   DDFIIRAALAGIGVAFAAAPLGCFVVWRRMAYFGDATAHASILGVALALTFDVSIFSGVL 64

Query: 58  TICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
              + M +T+++L           + D +LGV+ HS ++L LV +SF++ V  DL ++LF
Sbjct: 65  VTALLMASTISTL------SGRGYAMDTLLGVMAHSALALGLVAVSFLQGVRVDLMAYLF 118

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           GDILAV+  D+ +IW    + + +++  W  LL  T+N ELA+A G+ P + +L+  +  
Sbjct: 119 GDILAVSRGDLAVIWSGAAMVLGLMWWRWSSLLIATLNPELAQASGVNPRREQLVLTLAL 178

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +L+++V+IK +G+ LI ++L++P  TAR FS++PE MA+LA  IG   ++ G+Y S   D
Sbjct: 179 ALVVAVAIKVVGVLLIAAMLLIPAATARAFSSTPERMAVLAICIGCASVVGGIYVSFGAD 238

Query: 238 TPSGPSIIITSLFLF 252
           TP+GP+I+ T   LF
Sbjct: 239 TPTGPTIVSTGTALF 253


>gi|254451780|ref|ZP_05065217.1| zinc ABC transporter, permease protein [Octadecabacter antarcticus
           238]
 gi|198266186|gb|EDY90456.1| zinc ABC transporter, permease protein [Octadecabacter antarcticus
           238]
          Length = 266

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 166/253 (65%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RA+ + +G  L+ G LGCF++W+R+AYFGD  AH+A+LGVAL+L+F + + + + 
Sbjct: 6   DDFMVRAILAAVGTALACGALGCFVVWRRMAYFGDATAHAAILGVALALLFSVSVPLGVL 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++A    L L+ +     ++ D++LGV++H  ++L LV +S M     DL ++LFGDIL 
Sbjct: 66  IVALAMGL-LVGVLSGRTITPDSLLGVLSHGFLALGLVAVSLMPDARVDLDAYLFGDILV 124

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+ +IWG   +   +L   W+ LLA  V+ +LA A G+ P + +++  ++ + +++
Sbjct: 125 VSRIDLAVIWGGAAILCGVLVWRWQALLAEIVSNDLAYAAGLNPWRDRIMLTLLIAAVVA 184

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VSIK IG  LIT++LI+P  +AR  +  PE MA  AT+IG++  I GLY +  F TP+GP
Sbjct: 185 VSIKVIGALLITAMLIIPAASARMIARGPEAMAAWATLIGVVAAIGGLYAARSFGTPAGP 244

Query: 243 SIIITSLFLFILS 255
           SII  +  +F ++
Sbjct: 245 SIICFASAIFCVA 257


>gi|331657908|ref|ZP_08358870.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA206]
 gi|315299958|gb|EFU59196.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 16-3]
 gi|331056156|gb|EGI28165.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA206]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMTYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|82776445|ref|YP_402794.1| high-affinity zinc transporter membrane component [Shigella
           dysenteriae Sd197]
 gi|309789255|ref|ZP_07683848.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 1617]
 gi|81240593|gb|ABB61303.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308923009|gb|EFP68523.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 1617]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHTSLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|212711933|ref|ZP_03320061.1| hypothetical protein PROVALCAL_03008 [Providencia alcalifaciens DSM
           30120]
 gi|212685455|gb|EEB44983.1| hypothetical protein PROVALCAL_03008 [Providencia alcalifaciens DSM
           30120]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/257 (41%), Positives = 175/257 (68%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              DI+ I  IG + +  +LF  W+ LL+ TV+ ELA  +G+  ++ +L+ +M+T+L I 
Sbjct: 123 TYEDIITIL-IGVVVVCGLLFYRWRALLSMTVSSELAFVDGINLQRSRLLLMMVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA+ A  IG++ +  GL  S  +DTP+GP
Sbjct: 182 IAMKFVGALIITSLLIIPAATARRFAKTPEQMALTAIGIGMISVTGGLTLSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++TS  LFILS   K
Sbjct: 242 SVVLTSAILFILSLCVK 258


>gi|152970921|ref|YP_001336030.1| high-affinity zinc transporter membrane component [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|262041976|ref|ZP_06015158.1| zinc uptake ABC superfamily ATP binding cassette transporter
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|150955770|gb|ABR77800.1| High-affinity zinc uptake system membrane protein [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|259040674|gb|EEW41763.1| zinc uptake ABC superfamily ATP binding cassette transporter
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 169/257 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + I IL   W+ LLA T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPQDLIAIATGVVIVIGILLWQWRNLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAAVAVGVGMLAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K 
Sbjct: 243 VVLCAAVLFILSMTKKA 259


>gi|157145364|ref|YP_001452683.1| high-affinity zinc transporter membrane component [Citrobacter
           koseri ATCC BAA-895]
 gi|157082569|gb|ABV12247.1| hypothetical protein CKO_01104 [Citrobacter koseri ATCC BAA-895]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLIFI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGMGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|59711435|ref|YP_204211.1| zinc ABC transporter membrane protein [Vibrio fischeri ES114]
 gi|197335967|ref|YP_002155590.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
 gi|59479536|gb|AAW85323.1| zinc transporter subunit: membrane component of ABC superfamily
           [Vibrio fischeri ES114]
 gi|197317457|gb|ACH66904.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 171/238 (71%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+++AYFGDT+AH++LLG++L  +F + L + + +     +++L+ +QK   +
Sbjct: 21  PLGSFVVWRKMAYFGDTLAHASLLGLSLGFLFDINLNLALVICCVAIAVLLVTLQKQRLV 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           ++D +LG++ HS++SL LV +SF+  V  DL S+LFGD+LAV   D+L I+    + + +
Sbjct: 81  ATDTLLGILAHSSLSLGLVAVSFLDNVRVDLMSYLFGDLLAVTYDDLLYIYSGVIIILGL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           +F +WKPLL++T++ ELA+ EG+  E ++L+ +++  L+I++++KF+G  +ITSLLI+P 
Sbjct: 141 IFIVWKPLLSSTISEELAQVEGVNVELMRLVLMLMVGLVIAIAMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
            TARRFS SPE M + A+I G + ++ GL  S  +DTP+GPS++++   +F+LS   K
Sbjct: 201 ATARRFSRSPEQMVVFASIFGCIAVMAGLALSWHYDTPAGPSVVVSGAAIFMLSQLKK 258


>gi|157371015|ref|YP_001479004.1| high-affinity zinc transporter membrane protein [Serratia
           proteamaculans 568]
 gi|157322779|gb|ABV41876.1| ABC-3 protein [Serratia proteamaculans 568]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVLLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +LVL+ +++   LS D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLVLALVLVWLERRPQLSVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
             TDI +I GIG  + ++IL+  W+ LL+ TV+ ELA  +G+   + + + +++T+L I 
Sbjct: 123 TLTDIWMI-GIGVTVVLLILWWQWRNLLSMTVSPELAHVDGVNLVRARTVLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA  A ++GIL +  GL  S  +DTP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFARTPEQMAGYAVLVGILAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++++  LF+LS   K+
Sbjct: 242 SVVLSAAVLFVLSLSKKQ 259


>gi|30063270|ref|NP_837441.1| high-affinity zinc transporter membrane component [Shigella
           flexneri 2a str. 2457T]
 gi|110805803|ref|YP_689323.1| high-affinity zinc transporter membrane component [Shigella
           flexneri 5 str. 8401]
 gi|30041522|gb|AAP17250.1| hypothetical protein S1935 [Shigella flexneri 2a str. 2457T]
 gi|110615351|gb|ABF04018.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281601274|gb|ADA74258.1| High-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2002017]
 gi|313650645|gb|EFS15047.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2a str. 2457T]
 gi|332756759|gb|EGJ87106.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 4343-70]
 gi|332757636|gb|EGJ87969.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2747-71]
 gi|332758047|gb|EGJ88373.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-671]
 gi|332766835|gb|EGJ97036.1| fecCD transport family protein [Shigella flexneri 2930-71]
 gi|333003563|gb|EGK23103.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri VA-6]
 gi|333004712|gb|EGK24235.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-272]
 gi|333004751|gb|EGK24273.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-218]
 gi|333018432|gb|EGK37730.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-227]
 gi|333018546|gb|EGK37840.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-304]
          Length = 261

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQQVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|270262221|ref|ZP_06190493.1| hypothetical protein SOD_b04290 [Serratia odorifera 4Rx13]
 gi|270044097|gb|EFA17189.1| hypothetical protein SOD_b04290 [Serratia odorifera 4Rx13]
          Length = 261

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVLLAGAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +LVL+ +++   LS D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLALALVLVWLERRPQLSVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
             +DI +I GIG  + ++IL+  W+ LL+ T++ ELA  +G+   + + + +++T+L I 
Sbjct: 123 TFSDIWMI-GIGVSIVLLILWWQWRNLLSMTISPELAHVDGVNLVRARTVLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA  A ++G+L +  GL  S  +DTP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFARTPEQMAGYAVLVGMLAVTGGLAFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++++  LF+LS F K+
Sbjct: 242 SVVLSAAVLFVLSLFRKQ 259


>gi|163793525|ref|ZP_02187500.1| ABC-3 protein [alpha proteobacterium BAL199]
 gi|159181327|gb|EDP65842.1| ABC-3 protein [alpha proteobacterium BAL199]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 177/256 (69%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RAL +G+G+ L  GPLGCF++W+R+AY GDT+AH++LLG+AL LI  L L + 
Sbjct: 7   MLDDFLVRALVAGVGVALIAGPLGCFVVWRRMAYVGDTMAHASLLGIALGLILGLDLGVG 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  +    +L+L  +Q    + SD +LG++ H  +S+ LV ++FM+ V  DL ++LFGDI
Sbjct: 67  VLAVTVTVALLLAALQGQRLVGSDTLLGILAHGALSIGLVAVAFMETVRLDLMAYLFGDI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+L IWG   + +  L  +W+PLLA TV+ +LA AE      ++++F ++ +  
Sbjct: 127 LAVSARDLLWIWGGSAVVLAGLAAVWRPLLAATVDPDLALAERASAPWVQVVFALLIAGT 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +G+ LIT+LLI+P  TARR + SPE MA+ A  +G++ ++ GL  S+  DTPS
Sbjct: 187 IAIAMKIVGVLLITALLIIPAATARRSARSPEGMAVAAAGVGVVAVLGGLALSIGADTPS 246

Query: 241 GPSIIITSLFLFILSF 256
           GPSI++ +L LF++S 
Sbjct: 247 GPSIVVAALALFVVSL 262


>gi|260772365|ref|ZP_05881281.1| zinc ABC transporter permease protein ZnuB [Vibrio metschnikovii
           CIP 69.14]
 gi|260611504|gb|EEX36707.1| zinc ABC transporter permease protein ZnuB [Vibrio metschnikovii
           CIP 69.14]
          Length = 262

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 174/235 (74%), Gaps = 2/235 (0%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFGDT+AH++LLG+AL  +  + L   + + +   +++L+ +Q+ + +
Sbjct: 21  PLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYFALLVCSLSLAVILVTMQRQQLI 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW-GIGFLNIM 140
           ++D +LG++ HS++SL L+ +SF+  V  DL S+LFGD+LAV+  D+  IW G+  +++ 
Sbjct: 81  ATDTLLGILAHSSLSLGLIAVSFLDNVRIDLMSYLFGDLLAVSPADLWFIWSGVAAVSLA 140

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           + +  W+PLL+++VN ELA  EG+  E ++L+ +++  L+I+V +KF+G  ++TSL+I+P
Sbjct: 141 V-YLFWRPLLSSSVNEELASVEGVNIELMRLVLMLLIGLVIAVGMKFVGALIMTSLMIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
             TARR + +PE MA+LA++IGI+ ++IG+  S  FDTP+GPS+++++  +F+LS
Sbjct: 200 AATARRIAKTPEQMALLASLIGIISVLIGITLSWQFDTPAGPSVVVSATMMFMLS 254


>gi|16760843|ref|NP_456460.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29141465|ref|NP_804807.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213163231|ref|ZP_03348941.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213418775|ref|ZP_03351841.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426407|ref|ZP_03359157.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213649639|ref|ZP_03379692.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213855439|ref|ZP_03383679.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|289829034|ref|ZP_06546730.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25316147|pir||AI0742 high-affinity zinc uptake system membrane protein [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16503140|emb|CAD05644.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29137092|gb|AAO68656.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 261

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLASGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VTMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|283785597|ref|YP_003365462.1| high-affinity zinc uptake system membrane protein [Citrobacter
           rodentium ICC168]
 gi|282949051|emb|CBG88654.1| high-affinity zinc uptake system membrane protein [Citrobacter
           rodentium ICC168]
          Length = 262

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAAGLVWLEKRPHLAIDTLLGIMAHSVLSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  +G + ++ I+F  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPQDLIAI-ALGVMVVLAIIFWQWRNLLSMTISPDLAFVDGVKLQRVKLMLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  IG++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVGIGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMLKKQ 259


>gi|237731897|ref|ZP_04562378.1| high-affinity zinc transporter membrane component [Citrobacter sp.
           30_2]
 gi|226907436|gb|EEH93354.1| high-affinity zinc transporter membrane component [Citrobacter sp.
           30_2]
          Length = 261

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|291617752|ref|YP_003520494.1| ZnuB [Pantoea ananatis LMG 20103]
 gi|291152782|gb|ADD77366.1| ZnuB [Pantoea ananatis LMG 20103]
          Length = 261

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 98/260 (37%), Positives = 170/260 (65%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKI---WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
             +D   +W +    I +L  +   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L 
Sbjct: 123 TPSD---LWAMAAGVIFVLAVMAWQWRALLSMTISPELAQVDGVNIQRTRLMLMLVTALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I V++KF+G  +ITSLLI+P  TARRF+ SPE MA +A +IG++ +  GL  S  +DTP+
Sbjct: 180 IGVAMKFVGALIITSLLIIPAATARRFARSPEMMAAVAVLIGVIAVTGGLTFSAFYDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS+++ +  LF+ S   + 
Sbjct: 240 GPSVVLCAAILFLFSMVRQP 259


>gi|170724268|ref|YP_001751956.1| ABC-3 protein [Pseudomonas putida W619]
 gi|169762271|gb|ACA75587.1| ABC-3 protein [Pseudomonas putida W619]
          Length = 260

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 169/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVA+  +  +   + + +   L +L+L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVAMGFVLDVSPALAVTVGCLLLALLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++TTD+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAVLWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 200 AAAAQRHARSPEQMAVGASLLGVAAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 259


>gi|56413188|ref|YP_150263.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197362114|ref|YP_002141751.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|56127445|gb|AAV76951.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197093591|emb|CAR59054.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 261

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLFAALLFIFSMMKKQ 259


>gi|268589735|ref|ZP_06123956.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rettgeri DSM 1131]
 gi|291314887|gb|EFE55340.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rettgeri DSM 1131]
          Length = 261

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 177/258 (68%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWVAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  DI+ I+ IG + +  +LF  W+ LL+ TV+ ELA  +G+  ++++L+ +++T+L I 
Sbjct: 123 SYEDIITIF-IGVIVVCGLLFYRWRALLSITVSPELAFVDGINIQRLRLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA +A +IG++ +  GL  S  +DTP+GP
Sbjct: 182 IAMKFVGALIITSLLIIPAATARRFARTPEQMAAIAVLIGMIAVTGGLTLSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ S  LF+ S   K 
Sbjct: 242 SVVLVSAILFVFSLTIKA 259


>gi|24113209|ref|NP_707719.1| high-affinity zinc transporter membrane component [Shigella
           flexneri 2a str. 301]
 gi|24052205|gb|AAN43426.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
          Length = 253

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 172/249 (69%), Gaps = 2/249 (0%)

Query: 13  GIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L +  L
Sbjct: 4   GIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIAVTLLLAGGL 63

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV   D++ I 
Sbjct: 64  VWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAVTPEDLISI- 122

Query: 133 GIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
            IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V++KF+G  
Sbjct: 123 AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQQVKLLLMLVTALTIGVAMKFVGAL 182

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS+++ +  L
Sbjct: 183 IITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPSVVLCAALL 242

Query: 252 FILSFFYKK 260
           FI+S   K+
Sbjct: 243 FIISMMKKQ 251


>gi|238792586|ref|ZP_04636219.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           intermedia ATCC 29909]
 gi|238728221|gb|EEQ19742.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           intermedia ATCC 29909]
          Length = 257

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 169/248 (68%), Gaps = 2/248 (0%)

Query: 15  GIVLST--GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G++L+T  GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  + +++L
Sbjct: 8   GVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIAMTMVLAVIL 67

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI LI 
Sbjct: 68  VWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWLIA 127

Query: 133 GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITL 192
               + + +L   W+ LL+ TV+ ELA  +G+  E+++++ +++T+L I +S+KF+G  +
Sbjct: 128 AGVIVVLAVLGWQWRALLSMTVSPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGALI 187

Query: 193 ITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
           ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS+++ +  +F
Sbjct: 188 ITSLLIIPAAAARRFAQTPEQMAGIAIGIGIVAVTGGLTFSAFYDTPAGPSVVLCAAVMF 247

Query: 253 ILSFFYKK 260
           +LS   K 
Sbjct: 248 VLSLSQKA 255


>gi|218548580|ref|YP_002382371.1| high-affinity zinc transporter membrane component [Escherichia
           fergusonii ATCC 35469]
 gi|218356121|emb|CAQ88738.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia fergusonii ATCC 35469]
 gi|324113595|gb|EGC07570.1| ABC 3 transporter [Escherichia fergusonii B253]
 gi|325496998|gb|EGC94857.1| high-affinity zinc transporter membrane component [Escherichia
           fergusonii ECD227]
          Length = 261

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ IL   W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVIIVLGILCWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|209694429|ref|YP_002262357.1| high-affinity zinc uptake system membrane protein ZnuB [Aliivibrio
           salmonicida LFI1238]
 gi|208008380|emb|CAQ78535.1| high-affinity zinc uptake system membrane protein ZnuB [Aliivibrio
           salmonicida LFI1238]
          Length = 261

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 170/238 (71%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+++AYFGDT+AH++LLG++L  +F + L + + +     +L+L+ +QK   +
Sbjct: 21  PLGSFVVWRKMAYFGDTLAHASLLGLSLGFLFDINLNLALIVCCIAIALLLVTLQKQRLV 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           ++D +LG++ HS++SL LV +SF+  V  DL S+LFGD+LAV   D+L I+    + +  
Sbjct: 81  ATDTLLGILAHSSLSLGLVAVSFLDNVRVDLMSYLFGDLLAVTYNDLLYIYTGVIIVLGQ 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           ++ +W+PLL++T++ ELA+ EG+  E ++L+ +++  L+I++S+KF+G  +ITSLLI+P 
Sbjct: 141 IYIVWRPLLSSTISEELAQVEGVNVELMRLVLMLMVGLVIAISMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
            TARRFS SPE M + A+I G + +I GL  S  +DTP+GPS++++   +F+LS   K
Sbjct: 201 ATARRFSRSPEQMVLFASIFGCIAVIAGLALSWHYDTPAGPSVVVSGAAIFMLSQLKK 258


>gi|83311410|ref|YP_421674.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magneticum AMB-1]
 gi|82946251|dbj|BAE51115.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magneticum AMB-1]
          Length = 260

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 170/253 (67%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RAL +G  + L  GPLGCFI+W+R+AYFGD +AHSALLG+   L+  +   + + 
Sbjct: 2   DDFLLRALMAGAAVALVAGPLGCFIVWRRMAYFGDALAHSALLGIVAGLLLGVAPLVGVV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +  + +++L + + + +   D++LG++ H +++L LV+LS M  V  DL  +LFGDILA
Sbjct: 62  ALCVIAAVILSRAEADRSAGGDSLLGILAHGSLALGLVLLSLMDRVRVDLMGWLFGDILA 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  +D+  +WG G + + +L   W+ L+A  V+ +LA  EG +  + +++ +++ +L ++
Sbjct: 122 VTASDMAWLWGGGAVVLAVLGWQWRSLIAAAVDEDLAVVEGHKVARSRMLLMLLVALGVA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++K +G+ L+T++LI+P   ARR S +PE MA+LA + G++ + +GL GS ++D PSGP
Sbjct: 182 AAMKVVGVMLVTAMLIIPAAAARRLSRTPERMAVLAALAGLIAVALGLGGSWVWDIPSGP 241

Query: 243 SIIITSLFLFILS 255
           SI+  +  LF+LS
Sbjct: 242 SIVTVATALFLLS 254


>gi|161502991|ref|YP_001570103.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|160864338|gb|ABX20961.1| hypothetical protein SARI_01053 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 261

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + IL   W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIATGVVIVLAILSWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A + G+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVVTGMLAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMLKKQ 259


>gi|46202381|ref|ZP_00208499.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magnetotacticum MS-1]
          Length = 266

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 168/253 (66%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F IRAL +G  + L  GPLGCFI+W+R+AYFGD +AHSALLG+   L+  +   + + 
Sbjct: 8   DDFLIRALMAGAAVALVAGPLGCFIVWRRMAYFGDALAHSALLGIVAGLLLGVAPLVGVA 67

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +  + +L+L + + + A   D++LG++ H +++L LV+LS M  V  DL  +LFGDILA
Sbjct: 68  ALCVIAALILARAEVDRATGGDSLLGILAHGSLALGLVLLSLMDRVRVDLMGWLFGDILA 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  +D+  +WG     + +L   W+ L+A  V+ +LA  EG +  +++++ +++ +L ++
Sbjct: 128 VGASDLAWLWGGACFVLAMLVWQWRSLVAAAVDEDLAVVEGHKVARVRMLLMLLVALGVA 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++K +GI L+T++LI+P    RR S +PE MA LA + G++ + +GL GS I+DTPSGP
Sbjct: 188 GAMKVVGIMLVTAMLIIPAAAVRRLSRTPEQMAGLAALAGLIAVALGLAGSWIWDTPSGP 247

Query: 243 SIIITSLFLFILS 255
           SI+  +  LF+LS
Sbjct: 248 SIVTVATALFLLS 260


>gi|37526029|ref|NP_929373.1| high-affinity zinc transporter membrane component [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36785459|emb|CAE14406.1| High-affinity zinc uptake system membrane protein ZnuB
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 261

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 172/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     I  
Sbjct: 3   ELLFPGWLAGVLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNISPFYTIIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLILAMMLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              DI LI  IG   +  +LF  W  LL+ TV+ E+A  +G++ ++++++ +++T+L I 
Sbjct: 123 TYEDIWLI-AIGVTIVTTLLFWRWNALLSITVSQEMAFVDGIKIQRLRVLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+L +  GL  S I+DTP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAIAVGMLAVTGGLAFSAIYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +FI S   K 
Sbjct: 242 SVVLCAAVMFIASLISKA 259


>gi|170769386|ref|ZP_02903839.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           albertii TW07627]
 gi|170121710|gb|EDS90641.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           albertii TW07627]
          Length = 261

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 172/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  + ++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDDVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA  A I+G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGAAVIVGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S   K+
Sbjct: 242 SVVLCAALLFIISMMKKQ 259


>gi|28897625|ref|NP_797230.1| zinc ABC transporter permease [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838605|ref|ZP_01991272.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AQ3810]
 gi|260365990|ref|ZP_05778475.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus K5030]
 gi|260878220|ref|ZP_05890575.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AN-5034]
 gi|260895657|ref|ZP_05904153.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus Peru-466]
 gi|260901285|ref|ZP_05909680.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AQ4037]
 gi|28805837|dbj|BAC59114.1| zinc ABC transporter, permease protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149748023|gb|EDM58882.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AQ3810]
 gi|308088172|gb|EFO37867.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus Peru-466]
 gi|308090154|gb|EFO39849.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AN-5034]
 gi|308109836|gb|EFO47376.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus AQ4037]
 gi|308111271|gb|EFO48811.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           parahaemolyticus K5030]
 gi|328473391|gb|EGF44239.1| zinc ABC transporter permease [Vibrio parahaemolyticus 10329]
          Length = 261

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI +  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNVNLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +Q+ + +++D +LG++ HS++S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQRQQLVATDTLLGILAHSSLSIGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+         L+  W+PLL++TV+ ELA  EG+  + I+L+ +++  ++I+V
Sbjct: 123 SPEDLMFIYAGVIAVSACLYIFWRPLLSSTVSEELAAVEGVNTDLIRLVLMLMVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+ S++PE MA  A+IIG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKLSSTPEQMAFFASIIGAISVLMGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++  LF+LS   ++
Sbjct: 243 VVISATSLFMLSQLIQR 259


>gi|311279240|ref|YP_003941471.1| ABC-3 protein [Enterobacter cloacae SCF1]
 gi|308748435|gb|ADO48187.1| ABC-3 protein [Enterobacter cloacae SCF1]
          Length = 261

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLMLAGGLVWLERRPHLAVDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
             +D++ I  +G + ++ IL   W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPSDLISI-ALGVIVVVAILLWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A + G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAWIAVVTGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   K 
Sbjct: 242 SVVLCAAALFILSMTKKA 259


>gi|209966420|ref|YP_002299335.1| high-affinity zinc uptake system membrane protein ZnuB
           [Rhodospirillum centenum SW]
 gi|209959886|gb|ACJ00523.1| high-affinity zinc uptake system membrane protein ZnuB
           [Rhodospirillum centenum SW]
          Length = 264

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/256 (41%), Positives = 176/256 (68%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RAL  G+G+ L  GPLGC ++W+R+AYFGDT+AHSALLGVAL  +F + L + 
Sbjct: 1   MLDDFVLRALLGGVGLALVAGPLGCVVVWRRMAYFGDTLAHSALLGVALGFLFGIGLNVG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++    +++L  +Q+   L+SD +LG+++HS +S+ L+ L+ M+ +  DL ++LFGD+
Sbjct: 61  VALVCVGIAVLLTVLQEQRRLASDTLLGIVSHSALSVGLLALALMEALRVDLMAYLFGDV 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+L IW  G L + +L  IW+ LLA TV+ +LA+ EG+    ++L+F+++ +  
Sbjct: 121 LAVTRADLLWIWAGGALVLAVLAAIWRRLLALTVDEDLARVEGVPVRAVRLVFMLLIAAT 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+ ++K +GI L+TSLL++P   ARRF+ +PE MA++A  +G   + +G+  SL  D P+
Sbjct: 181 IAFAMKIVGILLVTSLLVIPAAAARRFARTPEIMAVVAAGMGAAAVGLGMAASLWADLPT 240

Query: 241 GPSIIITSLFLFILSF 256
           GP+I+  +  LF LS 
Sbjct: 241 GPAIVAAAAGLFALSH 256


>gi|167031153|ref|YP_001666384.1| ABC-3 protein [Pseudomonas putida GB-1]
 gi|166857641|gb|ABY96048.1| ABC-3 protein [Pseudomonas putida GB-1]
          Length = 260

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 168/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL     +   + + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFALDVSPALAVTVGCLLLAILLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++TTD+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAVLWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 200 AAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 259


>gi|261210012|ref|ZP_05924311.1| zinc ABC transporter permease protein ZnuB [Vibrio sp. RC341]
 gi|260840958|gb|EEX67495.1| zinc ABC transporter permease protein ZnuB [Vibrio sp. RC341]
          Length = 260

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 182/257 (70%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+++AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 3   EFLLPSLLAGLGIAIIAGPLGSFVVWRKMAYFGDTLAHASLLGLALGFLLDINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 63  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 122

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+
Sbjct: 123 SPSDLTFIWLGVATVS-LIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GP
Sbjct: 182 VGMKFVGALIMGSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 242 SVVVSAAALFVLTQFKR 258


>gi|260598334|ref|YP_003210905.1| high-affinity zinc transporter membrane component [Cronobacter
           turicensis z3032]
 gi|260217511|emb|CBA31687.1| High-affinity zinc uptake system membrane protein znuB [Cronobacter
           turicensis z3032]
          Length = 261

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 174/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     + +
Sbjct: 3   ELLLPGWMAGMLLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLFDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMGNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ + G+G   ++ +L   W+ LL+ T++ +LA  +G+  +++K++ +M+T+L I 
Sbjct: 123 TPADLISV-GLGVAVVLGVLCWQWRNLLSMTISPDLAFVDGVPLQRVKILLMMVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVVLGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFILS   + 
Sbjct: 242 SVVLCAALLFILSMTKRP 259


>gi|310767864|gb|ADP12814.1| high-affinity zinc transporter membrane component [Erwinia sp.
           Ejp617]
          Length = 261

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 164/239 (68%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  L SL+L+ +++   L
Sbjct: 21  PLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNISPFYAVIVVTLLLSLILVWLERRPHL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           + D +LG++ HS +SL +V++S M  V  DL ++LFGD+LAV   D+  I     L + +
Sbjct: 81  ALDTLLGIMAHSALSLGMVVVSLMSDVRVDLMAYLFGDLLAVTPGDLWTILAGVTLVLAL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L   W+ LL+ TV+ ELA+ +G+  ++ K+I ++IT+L I V++KF+G  +ITSLLI+P 
Sbjct: 141 LAWQWRALLSLTVSPELAQVDGINIQRTKMILMLITALTIGVAMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            TARRF+ SPE MAI+A I+G+L +  GL  S  +DTP+GPS+++ +  +F+LS   K 
Sbjct: 201 ATARRFARSPEQMAIMAVIVGVLAVTSGLSFSAFYDTPAGPSVVLGASLMFMLSMIKKP 259


>gi|148545391|ref|YP_001265493.1| ABC-3 protein [Pseudomonas putida F1]
 gi|148509449|gb|ABQ76309.1| ABC-3 protein [Pseudomonas putida F1]
          Length = 260

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 168/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL     +   + + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFALDVSPALAVTVGCLLLAILLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++TTD+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    +++  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAVLWRPLLAVTVHEELAMVEGLPVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 200 AAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 259


>gi|290475239|ref|YP_003468125.1| high-affinity Zn ABC transporter membrane protein [Xenorhabdus
           bovienii SS-2004]
 gi|289174558|emb|CBJ81352.1| high-affinity Zn transport protein (ABC superfamily, membrane)
           [Xenorhabdus bovienii SS-2004]
          Length = 261

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI + ++ GPLG F++W+R++YFGDT+AH++LLGVA   +  +     +  
Sbjct: 3   ELLLPGWLAGILLTIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGFLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++K   L+ D +LG++ HS +SL LV++SFM  +  D+ ++LFGD+L+V
Sbjct: 63  VTLILAMILVWLEKRPQLAVDTLLGIMAHSALSLGLVVVSFMTNIRVDMMAYLFGDLLSV 122

Query: 124 NTTDILLI-WGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+ LI  G+  +  ++ ++ W+ LL+ TV+ +LA  +G++ ++++++ +++T+L I 
Sbjct: 123 TYEDLWLIAAGVAIVAGLLTWQ-WRALLSMTVSQDLAFVDGIKIQRLRVLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRFS +PE+MA+ A  +G+L +  GL  S  ++TP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFSRTPEHMAVFAIAVGMLAVTGGLTLSAFYNTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ S  LF LS   K 
Sbjct: 242 SVVLCSAALFALSLTCKA 259


>gi|329298644|ref|ZP_08255980.1| high-affinity zinc transporter membrane component [Plautia stali
           symbiont]
          Length = 259

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 169/257 (65%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLGGVLLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M+ V  DL  +LFGD+LA+
Sbjct: 63  LTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMQGVRVDLMVYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ L+ G   + ++++   W+ LL+ T++ ELA+ +G+  ++  L  +++T+L I V
Sbjct: 123 TPDDLSLMAGGVAIVLVVMAWQWRSLLSMTISPELAQVDGVNIQRTCL--MLVTALTIGV 180

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA  A +IGI+ +  GL  S  +DTP+GPS
Sbjct: 181 AMKFVGALIITSLLIIPAATARRFSRSPEQMAGFAVLIGIIAVTGGLTFSASYDTPAGPS 240

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K 
Sbjct: 241 VVLCAAVLFIISMAKKP 257


>gi|262404433|ref|ZP_06080988.1| zinc ABC transporter permease protein ZnuB [Vibrio sp. RC586]
 gi|262349465|gb|EEY98603.1| zinc ABC transporter permease protein ZnuB [Vibrio sp. RC586]
          Length = 272

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 182/257 (70%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +
Sbjct: 15  EFLLPSLLAGLGIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLNINLYLALLV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA+
Sbjct: 75  CCLGMAAILVAMQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAI 134

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           + +D+  IW G+  ++ +I++ +W+PLLAT+VN ELA  EG   + ++LI +++  L+I+
Sbjct: 135 SPSDLTFIWLGVATVS-LIVYLLWQPLLATSVNEELAFVEGTNTDLMRLILMLLIGLVIA 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V +KF+G  ++ SLLI+P  TAR  S +PE MA  A +IG++ ++ GL  S  FDTP+GP
Sbjct: 194 VGMKFVGALIMGSLLIIPAATARCLSRTPEAMAFWAILIGMVSVLGGLALSWHFDTPAGP 253

Query: 243 SIIITSLFLFILSFFYK 259
           S+++++  LF+L+ F +
Sbjct: 254 SVVVSAAALFVLTQFKR 270


>gi|161613553|ref|YP_001587518.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161362917|gb|ABX66685.1| hypothetical protein SPAB_01273 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 261

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 172/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + G LG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGSLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   K+
Sbjct: 242 SVVLCAALLFIFSMMKKQ 259


>gi|259908221|ref|YP_002648577.1| high-affinity zinc transporter membrane component [Erwinia
           pyrifoliae Ep1/96]
 gi|224963843|emb|CAX55345.1| ABC superfamily high affinity Zn transport protein [Erwinia
           pyrifoliae Ep1/96]
 gi|283478151|emb|CAY74067.1| putative ABC zinc2+ transport system, inner membrane component
           [Erwinia pyrifoliae DSM 12163]
          Length = 261

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 164/239 (68%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  L SL+L+ +++   L
Sbjct: 21  PLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNISPFYAVIVVTLLLSLILVWLERRPHL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           + D +LG++ HS +SL +V++S M  V  DL ++LFGD+LAV   D+  I     L + +
Sbjct: 81  ALDTLLGIMAHSALSLGMVVVSLMSDVRVDLMAYLFGDLLAVTPGDLWTILAGVTLVLAL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L   W+ LL+ T++ ELA+ +G+  ++ K+I ++IT+L I V++KF+G  +ITSLLI+P 
Sbjct: 141 LAWQWRALLSLTISPELAQVDGINIQRTKMILMLITALTIGVAMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            TARRF+ SPE MAI+A I+G+L +  GL  S  +DTP+GPS+++ +  +F+LS   K 
Sbjct: 201 ATARRFARSPEQMAIMAVIVGVLAVTSGLSFSAFYDTPAGPSVVLGASLMFMLSMIKKP 259


>gi|300723104|ref|YP_003712402.1| high-affinity Zn ABC transporter membrane protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629619|emb|CBJ90222.1| high-affinity Zn transport protein (ABC superfamily, membrane)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 261

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 174/257 (67%), Gaps = 2/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI + ++ GPLG F++W++++YFGDT+AH++LLGVA   +  +     +  
Sbjct: 3   ELLFPGWLAGILLAIAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGFLLNVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++K   L+ D +LG++ HS +SL LV++SFM  V  D+ ++LFGD+L+V
Sbjct: 63  VTLILAVILVWLEKRPQLAVDTLLGILAHSALSLGLVVVSFMTSVRVDMMAYLFGDLLSV 122

Query: 124 NTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+ LI  G+  +  ++ ++ W+ LL+ TV+ +LA  +G++ ++++++ +++T+L I 
Sbjct: 123 TYEDLWLIATGVAIVTGLLTWQ-WRALLSMTVSQDLAFVDGIKIQRLRVLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  TARRFS +PE MAI+A I+G+  +  GL  S  ++TP+GP
Sbjct: 182 LAMKFVGALIITSLLIIPAATARRFSRTPEQMAIVAIIVGMFSVTGGLILSAFYNTPAGP 241

Query: 243 SIIITSLFLFILSFFYK 259
           S+++ S  LF LS   K
Sbjct: 242 SVVLCSAMLFALSLTNK 258


>gi|330806694|ref|YP_004351156.1| Zinc ABC transporter permease [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374802|gb|AEA66152.1| Zinc ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 262

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 170/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +   + + +   L ++VL+ +Q  + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPAVAVTVGCLLLAVVLVTLQHRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++ TD+  I G     ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISPTDLSWILGGSAAVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLVALWRPLLAVTVHEELARVEGLPVLGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+L +  GL  S   DTP+GPSI++++  LF+LSF   +
Sbjct: 200 AAAAQRHARSPEQMALGASLLGMLAVCGGLALSWFKDTPAGPSIVVSAAALFLLSFVLPR 259


>gi|160689770|gb|ABX45732.1| ZnuB [Yersinia ruckeri]
          Length = 261

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 178/259 (68%), Gaps = 4/259 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIF 62
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  + P    I 
Sbjct: 3   ELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           M+  L ++VL+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+
Sbjct: 63  MMLVL-AMVLVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLS 121

Query: 123 VNTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           V  +D+ LI  GI  + +++ ++ W+PLL+ T++ ELA  +G+  +++K++ +++T+L I
Sbjct: 122 VTLSDLWLIAAGIAAVLLVLCWQ-WRPLLSMTISPELAHVDGVNLQRVKMLLMLVTALTI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +S+KF+G  +ITSLLI+P   ARRFS +PE MA +A IIGIL +  GL  S  +DTP+G
Sbjct: 181 GLSMKFVGALIITSLLIIPAAAARRFSRTPEQMAGIAIIIGILAVSGGLAFSAFYDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PS+++ +  +F+LS   K 
Sbjct: 241 PSVVLCAAVMFVLSLSQKP 259


>gi|322832702|ref|YP_004212729.1| ABC transporter [Rahnella sp. Y9602]
 gi|321167903|gb|ADW73602.1| ABC-3 protein [Rahnella sp. Y9602]
          Length = 261

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 171/250 (68%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L ++
Sbjct: 10  LAGVLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYTVIAVTLLLAV 69

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI +
Sbjct: 70  LLVVLERKPHLAVDTLLGIMAHSALSLGLVVVSLMSGVRVDLMAYLFGDLLSVTYSDIWM 129

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + I +L   W+ LL+ T++ ELA  +G++ ++ +++ +++T+L I +++KF+G 
Sbjct: 130 IGAGVTVVIAVLCWQWRALLSMTISPELAHVDGVKLQRTRIVLMLVTALTIGLAMKFVGA 189

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P  TARRF+ +PE MA +A  +GI+ +  GL  S  +DTP+GPS+++ +  
Sbjct: 190 LIITSLLIIPAATARRFAKTPEQMACVAVAVGIIAVTGGLTFSAFYDTPAGPSVVLCAAV 249

Query: 251 LFILSFFYKK 260
           LF+LS   K+
Sbjct: 250 LFMLSLSKKQ 259


>gi|292488536|ref|YP_003531420.1| putative zinc2+ ABC transporter inner membrane protein [Erwinia
           amylovora CFBP1430]
 gi|292899712|ref|YP_003539081.1| high-affinity zinc uptake ABC transporter permease [Erwinia
           amylovora ATCC 49946]
 gi|291199560|emb|CBJ46677.1| high-affinity zinc uptake ABC transporter, permease protein
           [Erwinia amylovora ATCC 49946]
 gi|291553967|emb|CBA21012.1| putative ABC zinc2+ transport system, inner membrane component
           [Erwinia amylovora CFBP1430]
 gi|312172679|emb|CBX80935.1| putative ABC zinc2+ transport system, inner membrane component
           [Erwinia amylovora ATCC BAA-2158]
          Length = 261

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 165/238 (69%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  L SL+L+ +++   L
Sbjct: 21  PLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVSPFYAVIVVTLLLSLILVWLERRPHL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           + D +LG++ HS +SL +V++S M  V  DL ++LFGD+LAV   D+  I     L +++
Sbjct: 81  ALDTLLGIMAHSALSLGMVVVSLMSDVRVDLMAYLFGDLLAVTPGDLRTIVAGVTLVVVL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L   W+ LL+ T++ ELA+ +G+  ++ K+I +++T+L I V++KF+G  +ITSLLI+P 
Sbjct: 141 LAWQWRALLSLTISPELAQVDGINIQRTKMILMLLTALTIGVAMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
            TARRF+ SPE MA+LA I+G+L +  GL  S  +DTP+GPS+++ +  +F+LS   K
Sbjct: 201 ATARRFARSPEQMALLAVIVGVLAVTSGLSFSAWYDTPAGPSVVLGASLMFMLSMIKK 258


>gi|301155701|emb|CBW15169.1| zinc transporter subunit: membrane component of ABC superfamily
           [Haemophilus parainfluenzae T3T1]
          Length = 261

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 162/228 (71%), Gaps = 2/228 (0%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
           T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   + I ++  + +++++ ++ N 
Sbjct: 19  TAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYVAIVILTIILAVLMVWLESNT 78

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
             S D +LG+I HS +SL +V +  +K V  DL S+LFGD+LA+N  D+  I G G + +
Sbjct: 79  QFSVDTLLGIIAHSCLSLGVVTVGLLKNVRVDLMSYLFGDLLAINFNDLPYI-GAGVVIV 137

Query: 140 M-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
           +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++S+KF+G  +ITSLLI
Sbjct: 138 LGTLLYFWQALLSTTVSPELAQVEGINIKKMRFILMILTALTIALSMKFVGALIITSLLI 197

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
           +P  TARRF+ +PE M ++A +I +L ++ GL+ S  +DT +GPS++I
Sbjct: 198 IPAATARRFAKTPEQMVLIAILISMLSVVGGLFLSAFYDTAAGPSVVI 245


>gi|325579076|ref|ZP_08149032.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325159311|gb|EGC71445.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 261

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 161/228 (70%), Gaps = 2/228 (0%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
           T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   + I ++  + +++++ ++ N 
Sbjct: 19  TAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYVAIVILTIILAVLMVWLESNT 78

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
             S D +LG+I HS +SL +V +  +K V  DL S+LFGD+LA+N  D+  I G G + +
Sbjct: 79  QFSVDTLLGIIAHSCLSLGVVTVGLLKNVRVDLMSYLFGDLLAINFNDLPYI-GAGVVIV 137

Query: 140 M-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
           +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++S+KF+G  +ITSLLI
Sbjct: 138 LGTLLYFWQALLSTTVSPELAQVEGINIKKMRFILMILTALTIALSMKFVGALIITSLLI 197

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
           +P  TARRF+ +PE M  +A +I +L ++ GL+ S  +DT +GPS++I
Sbjct: 198 IPAATARRFAKTPEQMVFIAILISMLSVVGGLFLSAFYDTAAGPSVVI 245


>gi|251792104|ref|YP_003006824.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533491|gb|ACS96737.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter aphrophilus NJ8700]
          Length = 261

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 15  GIVLS--TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G++LS  T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I ++  L S+ +
Sbjct: 12  GMILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILILTLLLSVAM 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + ++ N   S D +LG+I HS +S+ +V +  ++ V  DL S+LFGD+L++N  D++ I 
Sbjct: 72  VWLENNTQFSVDTLLGIIAHSCLSIGVVTVGLLQNVRVDLMSYLFGDLLSINYEDLIYI- 130

Query: 133 GIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
           GIG + ++  LF  WKPL++TT++ ELA+ EG+  ++++ I +++T+L I++S+KF+G  
Sbjct: 131 GIGAVIVLATLFYFWKPLISTTISPELAQVEGINVKRMRFILMVLTALTIALSMKFVGAL 190

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           +ITSLLI+P   A+RF+ +PE+M I+A+II ++ + +GL  S  +DT +GPS++I S FL
Sbjct: 191 IITSLLIIPAAAAKRFARTPESMVIIASIISMIAVSMGLTLSAYYDTAAGPSVVICSTFL 250

Query: 252 FILSFFYKK 260
           F+ S   K+
Sbjct: 251 FLCSLLKKE 259


>gi|260913882|ref|ZP_05920356.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Pasteurella dagmatis ATCC 43325]
 gi|260631969|gb|EEX50146.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Pasteurella dagmatis ATCC 43325]
          Length = 261

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 165/238 (69%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +GI + L+T PLG F++W+++AYFGDT+AHSALLGVAL    ++   + I ++  + 
Sbjct: 8   AWLTGILLSLTTAPLGAFVVWRKMAYFGDTLAHSALLGVALGFFLEINPYLSILILTLIL 67

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +++++ ++     S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+   D+
Sbjct: 68  AVIMVWLEGKTQFSVDTLLGIIAHSCLSLGVVTVGLLENVRVDLMAYLFGDLLAITYDDL 127

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
           + I     + +  L   WKPL++TTVN ELA+ EG+   K++ I +++T+L I++S+KF+
Sbjct: 128 IFITSGVVIVLGTLIYYWKPLISTTVNAELAQVEGININKMRFILMILTALTIALSMKFV 187

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
           G  +ITSLLI+P+ TARRF+ +PE MAI+A +I ++ + +GL  S  +DT +GPS++I
Sbjct: 188 GALIITSLLIIPSATARRFAKTPEQMAIIAVLISMISVSLGLLLSAYYDTAAGPSVVI 245


>gi|261492455|ref|ZP_05989011.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496363|ref|ZP_05992757.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261307948|gb|EEY09257.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311914|gb|EEY13061.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 289

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 176/253 (69%), Gaps = 2/253 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  +L   + +  +  L 
Sbjct: 36  AWLAGVLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLELDPYLAVIGMTILL 95

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +L+L+ +++    S D +LG+I H+++SL ++ +S +  V  DL S+LFGD+LA+N +D+
Sbjct: 96  ALLLVWLEQKTNYSVDTVLGIIAHTSLSLGVITISLLDNVRVDLMSYLFGDLLAINFSDV 155

Query: 129 LLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKF 187
           + I GIG  L  +IL   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++S+KF
Sbjct: 156 VFI-GIGATLICLILMLFWKRLLSITISPELAQIEGLNVARLRLLLMILTALTIALSMKF 214

Query: 188 IGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIIT 247
           +G  +ITSLLI+P+ TARRF+ +PE M ++A +  I+ +  GL  S   DTP+GPS++I 
Sbjct: 215 VGALIITSLLIIPSATARRFAKTPEKMVLIAILFSIVAVTGGLLLSGWKDTPAGPSVVIC 274

Query: 248 SLFLFILSFFYKK 260
           +  +F+LS F K+
Sbjct: 275 AGLIFLLSLFKKE 287


>gi|308187170|ref|YP_003931301.1| ABC transport system membrane protein znuB [Pantoea vagans C9-1]
 gi|308057680|gb|ADO09852.1| ABC transport system membrane protein znuB [Pantoea vagans C9-1]
          Length = 261

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S MK V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMKNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + ++++   W+ LL+ T++ ELA+ +G+  ++ +LI +++T+L I V
Sbjct: 123 TPDDLWMMGGGVIIVLLVMAWQWRSLLSMTISPELAQVDGVNIQRTRLILMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF  SPE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFVRSPEGMAAVAVVIGVIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K 
Sbjct: 243 VVLCAAILFIFSMVRKP 259


>gi|121998506|ref|YP_001003293.1| ABC-3 protein [Halorhodospira halophila SL1]
 gi|121589911|gb|ABM62491.1| ABC-3 protein [Halorhodospira halophila SL1]
          Length = 267

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 167/231 (72%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R+AYFG+T+AHSALLGVAL  +F + L + I M+  + +++L+ +++ + L
Sbjct: 23  PLGSFVVWRRMAYFGETLAHSALLGVALGFLFGINLNLGILMVCVVVAVLLVVLRQYQRL 82

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +SD +LG++ HS++SL LV ++FM+ +  DL  +LFGDILAV  TD+  I+G G L +  
Sbjct: 83  ASDTVLGILAHSSLSLGLVAIAFMEGLRVDLMGYLFGDILAVTPTDLYWIYGGGVLVLGT 142

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L  IW+PLL+ T++ E+A+ EG++   ++L F+ + +  I+++++ +GI L+ S+LI+P 
Sbjct: 143 LIGIWRPLLSLTLHEEMARVEGVRVLPVQLAFMALVAATIALAMQIVGILLVISMLIIPA 202

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
             AR F+ +PE MA++A +IG L ++ GL GS  +D P+GP+I++T+  +F
Sbjct: 203 AAARAFARTPEQMAVIAALIGALAVVGGLAGSFRWDLPTGPAIVVTATAIF 253


>gi|254361650|ref|ZP_04977788.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mannheimia haemolytica PHL213]
 gi|153093168|gb|EDN74184.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mannheimia haemolytica PHL213]
          Length = 261

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 175/253 (69%), Gaps = 2/253 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  +L   + +  +  L 
Sbjct: 8   AWLAGVLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLELDPYLAVIGMTILL 67

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +L+L+ +++    S D +LG+I H+++SL ++ +S +  V  DL S+LFGD+LA+N +D+
Sbjct: 68  ALLLVWLEQKTNYSVDTVLGIIAHTSLSLGVITISLLDNVRVDLMSYLFGDLLAINFSDV 127

Query: 129 LLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKF 187
           + I GIG  L  +IL   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++S+KF
Sbjct: 128 VFI-GIGATLICLILMLFWKRLLSITISPELAQIEGLNVARLRLLLMILTALTIALSMKF 186

Query: 188 IGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIIT 247
           +G  +ITSLLI+P+ TARRF+ +PE M ++A    I+ +  GL  S   DTP+GPS++I 
Sbjct: 187 VGALIITSLLIIPSATARRFAKTPEKMVLIAIFFSIIAVSGGLLLSSWKDTPAGPSVVIC 246

Query: 248 SLFLFILSFFYKK 260
           +  +F+LS F K+
Sbjct: 247 AGLIFLLSLFKKE 259


>gi|304396233|ref|ZP_07378115.1| ABC-3 protein [Pantoea sp. aB]
 gi|304356602|gb|EFM20967.1| ABC-3 protein [Pantoea sp. aB]
          Length = 261

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S MK V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMKNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + ++++   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L I V
Sbjct: 123 TPDDLWMMGGGVVIVLLVMAWQWRSLLSMTISPELAQVDGVNIQRTRLVLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF  SPE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFVRSPEGMAGVAVVIGVIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K 
Sbjct: 243 VVLCAAILFIFSMVRKP 259


>gi|149187357|ref|ZP_01865655.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           shilonii AK1]
 gi|148838893|gb|EDL55832.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           shilonii AK1]
          Length = 269

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 170/255 (66%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +GIG+ L+  PLGCFI+W+R+AYFGD  AH+++LGVALSL F LP+   
Sbjct: 1   MLDDFLWRAALAGIGVTLAAAPLGCFIVWRRMAYFGDATAHASMLGVALSLAFSLPIFPG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  IA L ++ +         + D +LGV+ HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  VLFIALLMAITV-STFSGRGYAMDTLLGVMAHSALAIGLVAVSFLSGIRLDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+L+IW    L + ++   W  LL +T+N +LA A G  P++ +LI  +  +++
Sbjct: 120 LAVSKTDLLVIWLGTLLVVGLIGFRWSGLLLSTLNKDLALASGYSPKREQLILTIALAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P  TAR FS +PE M +LA +IG    I+GL  S + DTP+
Sbjct: 180 VAVAIKVVGVLLIVAMLIIPAATARPFSRTPEIMVVLAAVIGSSSSIVGLRTSYLMDTPT 239

Query: 241 GPSIIITSLFLFILS 255
           GP+I+  +  LF++S
Sbjct: 240 GPTIVCVAAGLFLVS 254


>gi|126666483|ref|ZP_01737462.1| ABC-3 [Marinobacter sp. ELB17]
 gi|126629284|gb|EAZ99902.1| ABC-3 [Marinobacter sp. ELB17]
          Length = 268

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 172/259 (66%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++F  RA  +G+G+ ++  PLGCFI+W+R+A+FGD  AH+A+LGVALSL   +P+   
Sbjct: 1   MFDDFMFRASLAGLGVAIAAAPLGCFIVWRRMAFFGDATAHAAILGVALSLTLSMPIFAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + +++ L +L +  + +    + D +LGV++HS+++  LV +SF+  +  DL ++LFGDI
Sbjct: 61  VLVVSLLMALAIATLSE-RGYAMDTLLGVLSHSSLAFGLVAVSFLSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V T D+ +IWG   L + ++   W  LL +TVN ELA A G+ P++  +I  +  +++
Sbjct: 120 LSVGTLDLGVIWGGAALVLTLVGWRWSALLTSTVNPELACASGISPKRENMILTLSLAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P  TAR FS +PE M I+A IIG    + GL  S + DTP+
Sbjct: 180 VAVAIKVVGVLLIAAMLIIPAATARPFSRTPETMVIIAAIIGCGASLAGLQVSYVMDTPT 239

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP+I+     LF +S  ++
Sbjct: 240 GPTIVCIVAVLFGVSSVFR 258


>gi|156933562|ref|YP_001437478.1| high-affinity zinc transporter membrane component [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156531816|gb|ABU76642.1| hypothetical protein ESA_01382 [Cronobacter sakazakii ATCC BAA-894]
          Length = 261

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 171/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWMAGMLLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMGNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+L + G+G   ++ ++   W+ LL+ T++ +LA  +G+  +++K++ +M+T+L I 
Sbjct: 123 TPADLLSV-GLGVAVVLGVMCWQWRNLLSMTISPDLAFVDGVPLQRVKILLMMVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GP
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVGLGMVAVTGGLTFSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI S   + 
Sbjct: 242 SVVLCAALLFIFSMAKRP 259


>gi|257464778|ref|ZP_05629149.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus minor 202]
 gi|257450438|gb|EEV24481.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus minor 202]
          Length = 259

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 172/249 (69%), Gaps = 4/249 (1%)

Query: 15  GIVLS--TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G++LS  T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I +  +  + +L L
Sbjct: 12  GLLLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIAMTIILALAL 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + ++     S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA++  D++ I 
Sbjct: 72  VWLEHKTNYSVDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAIDFNDVIFIA 131

Query: 133 -GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
            G+ F+  ++ F  W+ LL+ T++ ELA+ EG++  +++L+ +++T+L I++S+KF+G  
Sbjct: 132 VGVVFIAAILGFY-WEKLLSITISPELAQIEGLKVARLRLLLMILTALTIALSMKFVGAL 190

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           +ITSLLI+P+ TARRF+ +PE+M I A    ++ I  GL  S I DTP+GPS+++ +  L
Sbjct: 191 IITSLLIIPSATARRFAKTPESMVIYAICFSVMAITGGLLLSSIEDTPAGPSVVVCAGGL 250

Query: 252 FILSFFYKK 260
           F++S   K+
Sbjct: 251 FLISLLKKE 259


>gi|240948709|ref|ZP_04753081.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           minor NM305]
 gi|240296925|gb|EER47503.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           minor NM305]
          Length = 259

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 171/249 (68%), Gaps = 4/249 (1%)

Query: 15  GIVLS--TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G++LS  T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I +  +  + +L L
Sbjct: 12  GLLLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIAMTIILALAL 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + I+     S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA++  D++ I 
Sbjct: 72  VWIEHKTNYSVDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAIDFNDVIFIA 131

Query: 133 -GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGIT 191
            G+ F+  ++ F  W+ LL+ T++ ELA+ EG++  +++L+ +++T+L I++S+KF+G  
Sbjct: 132 VGVVFIAAILGFY-WEKLLSITISPELAQIEGLKVARLRLLLMILTALTIALSMKFVGAL 190

Query: 192 LITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFL 251
           +ITSLLI+P+ TARRF+ +PE M I A    I+ I  GL  S I DTP+GPS+++ +  L
Sbjct: 191 IITSLLIIPSATARRFAKTPEAMVIYAIGFSIIAITGGLLLSSIKDTPAGPSVVVCAGGL 250

Query: 252 FILSFFYKK 260
           F++S   K+
Sbjct: 251 FLMSLLKKE 259


>gi|192361992|ref|YP_001983937.1| permease of ABC zinc transporter ZnuB [Cellvibrio japonicus
           Ueda107]
 gi|190688157|gb|ACE85835.1| permease of ABC zinc transporter ZnuB [Cellvibrio japonicus
           Ueda107]
          Length = 271

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 167/239 (69%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F +W+R+AYFGDT+AHSALLG+ L L+ ++ L + + +   + +L+L+ +Q+   L
Sbjct: 31  PLGSFAVWRRMAYFGDTLAHSALLGITLGLLLEINLNLAVALGCLVLALILVGLQQQRYL 90

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           ++D +LG+++HST++L LV +S       DL ++LFGDILAV   + L +W +  + +  
Sbjct: 91  ATDTLLGILSHSTLALGLVCVSLFSESRVDLMAYLFGDILAVTPGETLGVWLVSLVVVAT 150

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L   W+PLL+ TV+ +LA+ EG+  + ++ + +++ +L+I++++K +G+ LIT+LLI+P 
Sbjct: 151 LVGFWRPLLSITVHEDLARIEGIPVDAVRTLLMLLMALVIAIAMKVVGVLLITALLIIPA 210

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             +RR S +PE MAI+A+++G L + +GL  S  +D+P+GPSI++++  LF L+   ++
Sbjct: 211 AASRRLSHTPEQMAIIASLLGALAVCLGLSASYWWDSPAGPSIVLSATLLFSLTLLKRQ 269


>gi|15602106|ref|NP_245178.1| hypothetical protein PM0241 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720468|gb|AAK02325.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 261

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 174/257 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ + L T PLG F++W+++AYFGDT+AHSALLGVAL +   +   + I +
Sbjct: 3   EILFPAWLTGMLLSLITAPLGAFVVWRKMAYFGDTLAHSALLGVALGIFLDINPYLSIVL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++++ ++     S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAILMVWLEGKTQFSVDTLLGIIAHSCLSLGVVTVGLLQNVRVDLMAYLFGDLLAM 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D+++I       ++ L   W PLL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYEDLVVIGIGVVFVLVTLLYFWHPLLSTTVSPELAQVEGVNVQKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE+M  +A +I +L I +GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPESMVFIAILISMLSISLGLLLSAYYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I +  LF+LS   K+
Sbjct: 243 VVICASLLFLLSLMKKE 259


>gi|188533633|ref|YP_001907430.1| high-affinity zinc transporter membrane component [Erwinia
           tasmaniensis Et1/99]
 gi|188028675|emb|CAO96537.1| ABC superfamily high affinity Zn transport protein [Erwinia
           tasmaniensis Et1/99]
          Length = 261

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 162/239 (67%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L SLVL+ +++   L
Sbjct: 21  PLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVSPFYAVIAVTLLLSLVLVWLERRPHL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           + D +LG++ HS +SL +V++S M  V  DL ++LFGD+LAV   D+  I     L + +
Sbjct: 81  ALDTLLGIMAHSALSLGMVVVSLMSDVRVDLMAYLFGDLLAVTPGDLWAILAGVTLVLGL 140

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L   W+ LL+ T++ ELA+ +G+  ++ K++ ++IT+L I V++KF+G  +ITSLLI+P 
Sbjct: 141 LAWQWRALLSLTISPELAQVDGINIQRTKMMLMLITALTIGVAMKFVGALIITSLLIIPA 200

Query: 202 VTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            TARRF+ SPE MA LA ++G+L +  GL  S  +DTP+GPS+++ +  +F+LS   K 
Sbjct: 201 ATARRFARSPEQMAALAVLVGVLAVTTGLSFSAFYDTPAGPSVVLGASLMFMLSMIKKP 259


>gi|153828925|ref|ZP_01981592.1| zinc ABC transporter, permease protein [Vibrio cholerae 623-39]
 gi|148875631|gb|EDL73766.1| zinc ABC transporter, permease protein [Vibrio cholerae 623-39]
          Length = 260

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 14  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 73

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 74  MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAIDPSDLTFIW-F 132

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 133 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 192

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 193 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 252

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 253 LTQFKR 258


>gi|197335109|ref|YP_002157163.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
 gi|197316599|gb|ACH66046.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
          Length = 273

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 170/260 (65%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+ L+T PLGCFI+W+R+AYFGD  AH+++LG+ALSL   LP+   
Sbjct: 1   MLDDFLWRATLAGVGVTLATAPLGCFIVWRRMAYFGDATAHASMLGIALSLALSLPILPS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  IA + ++ + +     + + D +LGV+ HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  VLFIALIMAITVSKFS-GRSYAMDTLLGVMAHSALAIGLVAVSFLSGIRLDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG     I ++   W  LL +T++ +LA A    P++ +LI  +  +++
Sbjct: 120 LAVSKMDLFIIWGGALFIIGLIRFRWSGLLLSTLDKDLALASNFSPKREQLILTIALAIV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR FS +PE M +LA +IG    I+GL  S +FDTP+
Sbjct: 180 VAVAIKVVGVLLIVAMLIIPAAAARPFSQTPEMMVVLAALIGSSSSILGLRASYLFDTPT 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP+I+  +  LFI S   +K
Sbjct: 240 GPTIVCIATGLFITSSLIRK 259


>gi|320157037|ref|YP_004189416.1| zinc ABC transporterinner membrane permease ZnuB [Vibrio vulnificus
           MO6-24/O]
 gi|319932349|gb|ADV87213.1| zinc ABC transporter, inner membrane permease protein ZnuB [Vibrio
           vulnificus MO6-24/O]
          Length = 231

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/225 (42%), Positives = 159/225 (70%), Gaps = 2/225 (0%)

Query: 32  IAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVIT 91
           +AYFGDT+AH++L+G+AL  +  + L + + +     +++L+ +QK + ++SD +LG++ 
Sbjct: 1   MAYFGDTLAHASLMGLALGFLLDVNLYLALIVCCLALAVILVTLQKQQLVASDTLLGILA 60

Query: 92  HSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW-GIGFLNIMILFKIWKPLL 150
           HS +S+ LV +SF+  V  DL S+LFGD+LAV+  D+L I+ G+  +    L+  W+PLL
Sbjct: 61  HSALSIGLVAVSFLDNVRVDLMSYLFGDLLAVSPQDLLFIYAGVAAVG-ATLYLFWRPLL 119

Query: 151 ATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTS 210
           +TTVN ELA  EG   + I+LI +++  ++I+V +KF+G  ++TSLLI+P   ARRF+ S
Sbjct: 120 STTVNEELAAVEGTNIDLIRLILMLMVGIVIAVGMKFVGALIMTSLLIIPAAAARRFAQS 179

Query: 211 PENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           PE MA  A++IG+L ++ GL  S  FDTP+GPS++I++  +F+L+
Sbjct: 180 PEQMAGFASLIGVLAVLGGLTLSWHFDTPAGPSVVISATAIFMLA 224


>gi|297579587|ref|ZP_06941515.1| zinc ABC transporter, permease [Vibrio cholerae RC385]
 gi|297537181|gb|EFH76014.1| zinc ABC transporter, permease [Vibrio cholerae RC385]
          Length = 260

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 14  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 73

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 74  MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLAFIW-F 132

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 133 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 192

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 193 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 252

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 253 LTQFKR 258


>gi|153213723|ref|ZP_01948975.1| zinc ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|153826068|ref|ZP_01978735.1| zinc ABC transporter, permease protein [Vibrio cholerae MZO-2]
 gi|254226086|ref|ZP_04919684.1| zinc ABC transporter, permease protein [Vibrio cholerae V51]
 gi|124115784|gb|EAY34604.1| zinc ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|125621398|gb|EAZ49734.1| zinc ABC transporter, permease protein [Vibrio cholerae V51]
 gi|149740185|gb|EDM54338.1| zinc ABC transporter, permease protein [Vibrio cholerae MZO-2]
          Length = 260

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 14  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 73

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 74  MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-F 132

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 133 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 192

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 193 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 252

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 253 LTQFKR 258


>gi|15642083|ref|NP_231715.1| zinc ABC transporter, permease protein [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121586917|ref|ZP_01676697.1| zinc ABC transporter, permease protein [Vibrio cholerae 2740-80]
 gi|121727396|ref|ZP_01680535.1| zinc ABC transporter, permease protein [Vibrio cholerae V52]
 gi|147675495|ref|YP_001217608.1| zinc ABC transporter, permease protein [Vibrio cholerae O395]
 gi|153801976|ref|ZP_01956562.1| zinc ABC transporter, permease protein [Vibrio cholerae MZO-3]
 gi|153818397|ref|ZP_01971064.1| zinc ABC transporter, permease protein [Vibrio cholerae NCTC 8457]
 gi|153821697|ref|ZP_01974364.1| zinc ABC transporter, permease protein [Vibrio cholerae B33]
 gi|227082209|ref|YP_002810760.1| zinc ABC transporter, permease protein [Vibrio cholerae M66-2]
 gi|254286800|ref|ZP_04961753.1| zinc ABC transporter, permease protein [Vibrio cholerae AM-19226]
 gi|254849169|ref|ZP_05238519.1| zinc ABC transporter [Vibrio cholerae MO10]
 gi|298497891|ref|ZP_07007698.1| zinc ABC transporter [Vibrio cholerae MAK 757]
 gi|9656631|gb|AAF95229.1| zinc ABC transporter, permease protein [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121548853|gb|EAX58896.1| zinc ABC transporter, permease protein [Vibrio cholerae 2740-80]
 gi|121630288|gb|EAX62686.1| zinc ABC transporter, permease protein [Vibrio cholerae V52]
 gi|124122490|gb|EAY41233.1| zinc ABC transporter, permease protein [Vibrio cholerae MZO-3]
 gi|126511087|gb|EAZ73681.1| zinc ABC transporter, permease protein [Vibrio cholerae NCTC 8457]
 gi|126520795|gb|EAZ78018.1| zinc ABC transporter, permease protein [Vibrio cholerae B33]
 gi|146317378|gb|ABQ21917.1| zinc ABC transporter, permease protein [Vibrio cholerae O395]
 gi|150423091|gb|EDN15039.1| zinc ABC transporter, permease protein [Vibrio cholerae AM-19226]
 gi|227010097|gb|ACP06309.1| zinc ABC transporter, permease protein [Vibrio cholerae M66-2]
 gi|227013980|gb|ACP10190.1| zinc ABC transporter, permease protein [Vibrio cholerae O395]
 gi|254844874|gb|EET23288.1| zinc ABC transporter [Vibrio cholerae MO10]
 gi|297542224|gb|EFH78274.1| zinc ABC transporter [Vibrio cholerae MAK 757]
 gi|327484615|gb|AEA79022.1| Zinc ABC transporter, inner membrane permease protein ZnuB [Vibrio
           cholerae LMA3894-4]
          Length = 260

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 14  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 73

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 74  MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-F 132

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 133 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 192

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 193 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 252

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 253 LTQFKR 258


>gi|229513738|ref|ZP_04403200.1| hypothetical protein VCB_001383 [Vibrio cholerae TMA 21]
 gi|229524089|ref|ZP_04413494.1| hypothetical protein VCA_001673 [Vibrio cholerae bv. albensis
           VL426]
 gi|229528901|ref|ZP_04418291.1| zinc ABC transporter permease protein [Vibrio cholerae 12129(1)]
 gi|229332675|gb|EEN98161.1| zinc ABC transporter permease protein [Vibrio cholerae 12129(1)]
 gi|229337670|gb|EEO02687.1| hypothetical protein VCA_001673 [Vibrio cholerae bv. albensis
           VL426]
 gi|229348919|gb|EEO13876.1| hypothetical protein VCB_001383 [Vibrio cholerae TMA 21]
          Length = 304

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 58  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 117

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 118 MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-F 176

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 177 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 236

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 237 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 296

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 297 LTQFKR 302


>gi|251789854|ref|YP_003004575.1| high-affinity zinc transporter membrane component [Dickeya zeae
           Ech1591]
 gi|247538475|gb|ACT07096.1| ABC-3 protein [Dickeya zeae Ech1591]
          Length = 261

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/257 (40%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + L+ GPLG F++W+R++YFGDT+AH++LLGVAL L+  + L   +  
Sbjct: 3   ELLLPGWLAGVCLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVALGLLLDINLFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L ++ L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  ITLLLAVGLVWLERRPGLAIDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D+ LI     L + +L   W+ LL+ TV+ ELA  +G+   + KL+ ++IT+L I +
Sbjct: 123 TSEDLRLIAPGVLLVLGVLGWQWRALLSMTVSPELAHVDGVAIARTKLLLMLITALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA+ A  +GIL +  GL  S   +TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAVCAMGVGILAVTGGLAFSAEVNTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LF+LS   ++
Sbjct: 243 VVLCASLLFMLSLLKRQ 259


>gi|229507828|ref|ZP_04397333.1| hypothetical protein VCF_003057 [Vibrio cholerae BX 330286]
 gi|229511935|ref|ZP_04401414.1| hypothetical protein VCE_003345 [Vibrio cholerae B33]
 gi|229519071|ref|ZP_04408514.1| hypothetical protein VCC_003099 [Vibrio cholerae RC9]
 gi|229607373|ref|YP_002878021.1| hypothetical protein VCD_002284 [Vibrio cholerae MJ-1236]
 gi|229343760|gb|EEO08735.1| hypothetical protein VCC_003099 [Vibrio cholerae RC9]
 gi|229351900|gb|EEO16841.1| hypothetical protein VCE_003345 [Vibrio cholerae B33]
 gi|229355333|gb|EEO20254.1| hypothetical protein VCF_003057 [Vibrio cholerae BX 330286]
 gi|229370028|gb|ACQ60451.1| hypothetical protein VCD_002284 [Vibrio cholerae MJ-1236]
          Length = 304

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 58  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVA 117

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 118 MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-F 176

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 177 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 236

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 237 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFV 296

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 297 LTQFKR 302


>gi|304413261|ref|ZP_07394734.1| membrane component of Zn2+ ABC transporter [Candidatus Regiella
           insecticola LSR1]
 gi|304284104|gb|EFL92497.1| membrane component of Zn2+ ABC transporter [Candidatus Regiella
           insecticola LSR1]
          Length = 261

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 169/248 (68%), Gaps = 2/248 (0%)

Query: 15  GIVLST--GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVL 72
           G++L+T  GPLG FI+W+R++YFGDT+AH++LLGVA  L+  +     +  I  + +L+L
Sbjct: 12  GMLLATLAGPLGSFIVWRRMSYFGDTLAHASLLGVACGLLLHIDPFYTVIAITLMLALIL 71

Query: 73  LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW 132
           + +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI LI 
Sbjct: 72  VLMERKPQLAVDTLLGILAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVRLSDIWLIA 131

Query: 133 GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITL 192
               L ++IL   W+P L  T++ ELA  +G+  ++ +++ ++IT++ I +S+KF+G  +
Sbjct: 132 SGAALVLLILCWQWRPFLLMTISPELAHVDGVNLQRSRMLLMLITAITIGLSMKFVGALI 191

Query: 193 ITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
           ITSLLI+P   ARRF+ +PE MA +A +IG+L +  GL  S  +DTP+GPS+++ +  +F
Sbjct: 192 ITSLLIIPAAAARRFARTPEQMAGIAVVIGMLAVSGGLILSACYDTPAGPSVVLCAAVMF 251

Query: 253 ILSFFYKK 260
           ILS   K 
Sbjct: 252 ILSLSRKA 259


>gi|219870455|ref|YP_002474830.1| high-affinity zinc uptake system membrane protein [Haemophilus
           parasuis SH0165]
 gi|219690659|gb|ACL31882.1| high-affinity zinc uptake system membrane protein [Haemophilus
           parasuis SH0165]
          Length = 261

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 173/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGVFLTFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++    S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTVILALCLVWLEQRSTHSVDTLLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKI-WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+L I GIG + I  L  + WK LLA TV+ ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 GFNDVLFI-GIGVIGIATLLALYWKKLLAITVSPELAQIEGLNVARLRLLLMLLTALSIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+ TARRF+ +PE M I A  + IL +  GL  S + DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSATARRFAKTPETMVIYAIGLSILSVSGGLLLSALKDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LF+LS   K+
Sbjct: 242 SVVVCAGTLFLLSLIKKE 259


>gi|242239572|ref|YP_002987753.1| high-affinity zinc transporter membrane component [Dickeya dadantii
           Ech703]
 gi|242131629|gb|ACS85931.1| ABC-3 protein [Dickeya dadantii Ech703]
          Length = 261

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 174/260 (66%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLG+AL L+  + L   +  
Sbjct: 3   ELLLPGWLAGMFLSIAAGPLGSFVVWRRMSYFGDTLAHASLLGIALGLLLDINLFYAVIT 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ +++   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+L+V
Sbjct: 63  VTLMLACGLVWLERRPWLAIDTLLGIMAHSALSLGLVVVSLMNTIRIDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIG---FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
            T D   +W IG    L +M+L   W+ LL+ T++ ELA  +G+  ++ KL+ ++IT+L 
Sbjct: 123 TTDD---LWMIGPGVLLVVMVLCWQWRSLLSMTISPELAHVDGVSIQRTKLLLMLITALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I +++KF+G  +ITSLLI+P  TARRF+ +PE MA+LA  +G+L +  GL  S   +TP+
Sbjct: 180 IGLAMKFVGALIITSLLIIPAATARRFARTPEQMALLAIAVGMLAVTGGLAFSADANTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS+++ +  LFILS   K+
Sbjct: 240 GPSVVLCASLLFILSLLKKQ 259


>gi|259415079|ref|ZP_05739001.1| high-affinity zinc uptake system membrane protein ZnuB
           [Silicibacter sp. TrichCH4B]
 gi|259348989|gb|EEW60743.1| high-affinity zinc uptake system membrane protein ZnuB
           [Silicibacter sp. TrichCH4B]
          Length = 269

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 165/250 (66%), Gaps = 11/250 (4%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----L 57
           ++F IRA  +GIG+  +  PLGCF++W+R+AYFGD  AH+++LGVAL+L F +      L
Sbjct: 5   DDFMIRAALAGIGVAFAAAPLGCFVVWRRMAYFGDATAHASILGVALALTFDVSIFSGVL 64

Query: 58  TICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
              + M +T+++L           + D +LGV+ HS ++  LV +SF++ V  DL ++LF
Sbjct: 65  VTALLMASTISTL------SGRGYAMDTLLGVLAHSALAFGLVAVSFLQGVRVDLMAYLF 118

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           GDILAV+  D+ ++W    L I +++  W  LL  T+N ELA+A G+ P++ +L+  +  
Sbjct: 119 GDILAVSRGDLAVVWSGALLVISLMWWRWSSLLTATLNPELAQASGINPQREQLVLTLAL 178

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +++++V+IK +G+ LI ++L++P  TAR FST+PE MA LA +IG   +I G+Y S   D
Sbjct: 179 AVVVAVAIKVVGVLLIAAMLLIPAATARIFSTTPERMAFLAVLIGCGSVIGGMYMSFSAD 238

Query: 238 TPSGPSIIIT 247
           TP+GP+I+ T
Sbjct: 239 TPTGPTIVST 248


>gi|50121411|ref|YP_050578.1| high-affinity zinc transporter membrane protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611937|emb|CAG75386.1| high-affinity zinc uptake system membrane protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 261

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 175/258 (67%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  + L   +  
Sbjct: 3   ELLFPGWLAGILLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINLFSAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLILALGLVWLERRPYLAVDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFK-IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
            T D+ +I G G + ++ + +  W+ LL+ T++ ELA  +G++ ++ KL+ ++ T+L I 
Sbjct: 123 TTEDLWVI-GAGVIIVVAVMRWQWRALLSMTISPELAHVDGVKIQRTKLLLMLTTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++KF+G  +ITSLLI+P  +ARRF+ +PE MAI+A +IG++ +  GL  S  ++TP+GP
Sbjct: 182 IAMKFVGALIITSLLIIPAASARRFARTPEQMAIIAVMIGMIAVTGGLAFSAGYNTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LFI+S    +
Sbjct: 242 SVVLCASLLFIVSLLKPQ 259


>gi|229522040|ref|ZP_04411457.1| hypothetical protein VIF_002585 [Vibrio cholerae TM 11079-80]
 gi|229340965|gb|EEO05970.1| hypothetical protein VIF_002585 [Vibrio cholerae TM 11079-80]
          Length = 304

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  GIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQ 74
           GI +  GPLG F++W+R+AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ 
Sbjct: 58  GIAIIAGPLGSFVVWRRMAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGIAAILVA 117

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           +QK + +++D +LG++ HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  
Sbjct: 118 MQKQKLIATDTLLGIMAHSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-F 176

Query: 135 GFLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + + +I++ +W+PLL+T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++
Sbjct: 177 GVVTVSLIVYLLWQPLLSTSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIM 236

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            SLLI+P  TARR S +PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+
Sbjct: 237 GSLLIIPAATARRLSRTPEAMAFWAIGLGVLSVIGGLVLSWHFDTPAGPSVVVSAAVLFV 296

Query: 254 LSFFYK 259
           L+ F +
Sbjct: 297 LTQFKR 302


>gi|332161521|ref|YP_004298098.1| high-affinity zinc transporter membrane component [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318605503|emb|CBY27001.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325665751|gb|ADZ42395.1| high-affinity zinc transporter membrane component [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 261

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  MTMLLALILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DI LI     + + IL   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +
Sbjct: 123 TLSDIWLIAAGVVVVLGILCWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPAAAARRFARTPEQMAGIAIGIGIVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +FILS   K 
Sbjct: 243 VVLCAALMFILSLSQKA 259


>gi|22126137|ref|NP_669560.1| high-affinity zinc transporter membrane component [Yersinia pestis
           KIM 10]
 gi|45441704|ref|NP_993243.1| high-affinity zinc transporter membrane component [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596368|ref|YP_070559.1| high-affinity zinc transporter membrane component [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807438|ref|YP_651354.1| high-affinity zinc transporter membrane component [Yersinia pestis
           Antiqua]
 gi|108811699|ref|YP_647466.1| high-affinity zinc transporter membrane component [Yersinia pestis
           Nepal516]
 gi|145598358|ref|YP_001162434.1| high-affinity zinc transporter membrane component [Yersinia pestis
           Pestoides F]
 gi|149366012|ref|ZP_01888047.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           CA88-4125]
 gi|153948578|ref|YP_001401002.1| high-affinity zinc transporter membrane component [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419468|ref|YP_001606841.1| high-affinity zinc transporter membrane component [Yersinia pestis
           Angola]
 gi|165928361|ref|ZP_02224193.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938849|ref|ZP_02227403.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009314|ref|ZP_02230212.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166210998|ref|ZP_02237033.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401463|ref|ZP_02306960.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420153|ref|ZP_02311906.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424592|ref|ZP_02316345.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170024376|ref|YP_001720881.1| high-affinity zinc transporter membrane protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186895409|ref|YP_001872521.1| high-affinity zinc transporter membrane protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|218929166|ref|YP_002347041.1| high-affinity zinc transporter membrane component [Yersinia pestis
           CO92]
 gi|229894773|ref|ZP_04509953.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           Pestoides A]
 gi|229897476|ref|ZP_04512632.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229898122|ref|ZP_04513271.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229901981|ref|ZP_04517102.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           Nepal516]
 gi|270490835|ref|ZP_06207909.1| high-affinity zinc transporter membrane component [Yersinia pestis
           KIM D27]
 gi|294503875|ref|YP_003567937.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           Z176003]
 gi|21959098|gb|AAM85811.1|AE013828_2 inner membrane permease of zinc ABC transporter [Yersinia pestis
           KIM 10]
 gi|45436566|gb|AAS62120.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51589650|emb|CAH21280.1| ABC high-affinity zinc uptake transporter, permease subunit znuB
           [Yersinia pseudotuberculosis IP 32953]
 gi|108775347|gb|ABG17866.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           Nepal516]
 gi|108779351|gb|ABG13409.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           Antiqua]
 gi|115347777|emb|CAL20694.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           CO92]
 gi|145210054|gb|ABP39461.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           Pestoides F]
 gi|149292425|gb|EDM42499.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           CA88-4125]
 gi|152960073|gb|ABS47534.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|162352283|gb|ABX86231.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis Angola]
 gi|165913212|gb|EDR31835.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919644|gb|EDR36977.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991869|gb|EDR44170.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166208178|gb|EDR52658.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961848|gb|EDR57869.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049159|gb|EDR60567.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056474|gb|EDR66243.1| high-affinity zinc uptake ABC transporter, permease protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169750910|gb|ACA68428.1| ABC-3 protein [Yersinia pseudotuberculosis YPIII]
 gi|186698435|gb|ACC89064.1| ABC-3 protein [Yersinia pseudotuberculosis PB1/+]
 gi|229680877|gb|EEO76972.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           Nepal516]
 gi|229688838|gb|EEO80905.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229693813|gb|EEO83862.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229702246|gb|EEO90265.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           Pestoides A]
 gi|262362006|gb|ACY58727.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           D106004]
 gi|262365857|gb|ACY62414.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           D182038]
 gi|270339339|gb|EFA50116.1| high-affinity zinc transporter membrane component [Yersinia pestis
           KIM D27]
 gi|294354334|gb|ADE64675.1| high-affinity zinc uptake system membrane protein [Yersinia pestis
           Z176003]
 gi|320015263|gb|ADV98834.1| High-affinity zinc uptake system membrane protein [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 261

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  MTMVLALILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DI LI     + + +LF  W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +
Sbjct: 123 TLSDIWLIAAGVVVVLAVLFWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P   ARRF+ +PE MA +A  IGIL +  GL  S  +DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPAAAARRFARTPEQMAGIAVGIGILAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +F+LS   K 
Sbjct: 243 VVLCAAAMFVLSLSQKA 259


>gi|293395811|ref|ZP_06640093.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Serratia odorifera DSM 4582]
 gi|291421748|gb|EFE94995.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Serratia odorifera DSM 4582]
          Length = 261

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 166/240 (69%), Gaps = 2/240 (0%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           PLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L +LVL+ +++   L
Sbjct: 21  PLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDINPFYAVIAVTLLLALVLVWLERRPQL 80

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGF-LNIM 140
           S D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V  +DI +I  IG  + ++
Sbjct: 81  SVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSVTISDIGMI-AIGVAIVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L+  W+ LL+ T++ E+A  +G+   + + + +++T+L I +++KF+G  +ITSLLI+P
Sbjct: 140 VLWWQWRDLLSMTISPEMAHVDGVNLARARTVLMLVTALTIGLAMKFVGALIITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             TARRF+ +PE MA  A IIG+L +  GL  S  +DTP+GPS+++++  LF+LS   K+
Sbjct: 200 AATARRFARTPEQMAGYAVIIGMLAVSGGLTFSAFYDTPAGPSVVLSAAILFVLSLAKKQ 259


>gi|307546602|ref|YP_003899081.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307218626|emb|CBV43896.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 271

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 163/262 (62%), Gaps = 7/262 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           +++F +RA  +GIG+ L+  PLGCF++W+R+AYFGD  AH+A+LGVALSL+    L+  I
Sbjct: 3   FDDFLVRAALAGIGVALAAAPLGCFVVWRRMAYFGDATAHAAVLGVALSLV----LSTSI 58

Query: 62  FMIATLTSLVLLQIQK---NEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFG 118
                 TSL++  I         + D +LGV+ HS ++L LV +SF+  V  DL ++LFG
Sbjct: 59  LAGVLATSLIMATIVSTLSGRGYAMDTLLGVMAHSALALGLVAVSFVSGVRIDLMAYLFG 118

Query: 119 DILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           DILAV   D+ +IW    L + ++   W  LL  T+N +LA A G+ P++ +LI  +  +
Sbjct: 119 DILAVGKADLAVIWAGAALVLGLMGWRWPNLLTATLNTDLAYASGIDPKREQLILTLSLA 178

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           ++++V++K +G+ LI +LLI+P  TAR FS +PE MA+LA   G      GL  +   DT
Sbjct: 179 VVVAVALKVVGVLLIAALLIIPAATARPFSRTPETMALLAAAFGASATTGGLQAAFWLDT 238

Query: 239 PSGPSIIITSLFLFILSFFYKK 260
           P+GP+I+  +  LF LS    +
Sbjct: 239 PTGPTIVSLAAMLFALSSLAGR 260


>gi|322514788|ref|ZP_08067811.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
 gi|322119250|gb|EFX91380.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
          Length = 261

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 173/253 (68%), Gaps = 2/253 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ + + T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + ++  + 
Sbjct: 8   AWLAGLLLAVITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQVDPYIAVIIMTLIL 67

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +L+L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA++ +D+
Sbjct: 68  ALLLVWLEHRTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAIDFSDV 127

Query: 129 LLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKF 187
           + I G+G L I  +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++S+KF
Sbjct: 128 IFI-GVGSLLIASVLAFFWKKLLSITISPELAQIEGLNVARLRLLLMVLTALTIALSMKF 186

Query: 188 IGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIIT 247
           +G  +ITSLLI+P+  ARRF+ +PE M   A +  IL +  GL  S   DTP+GPS++I 
Sbjct: 187 VGALIITSLLIIPSAIARRFARTPEAMVGYAIVFSILSVTGGLLFSGWKDTPAGPSVVIC 246

Query: 248 SLFLFILSFFYKK 260
           +  LF+LS   K+
Sbjct: 247 AGILFLLSLAKKE 259


>gi|89092308|ref|ZP_01165262.1| high-affinity zinc uptake system membrane protein ZnuB
           [Oceanospirillum sp. MED92]
 gi|89083396|gb|EAR62614.1| high-affinity zinc uptake system membrane protein ZnuB
           [Oceanospirillum sp. MED92]
          Length = 262

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 174/253 (68%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + ALF G+G+    GPLG F++W+R+AYFGDT+AHSALLG+ +  +  + L + +  
Sbjct: 3   DFLLYALFGGLGVAAVAGPLGSFVVWRRMAYFGDTLAHSALLGITIGFLLDINLNLAVVF 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+L+ +Q+   +++D +LG++ HS +SL LV +S ++ +  DL ++LFGD+LAV
Sbjct: 63  CCVALALLLVAMQRQRMVATDTLLGIMAHSALSLGLVAVSILE-IRVDLMAYLFGDLLAV 121

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+  I+G G L + +L  +W+PLLA T+N ELA  EG+     +L  +++ +++I++
Sbjct: 122 TATDLYWIYGGGVLVLFLLKLLWEPLLAITINEELAHVEGVNVAWTRLALMLLIAVVIAI 181

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSLLI+P   +RR + +PE MA+ A ++G L +  GL  S  +DTP+GPS
Sbjct: 182 AMKIVGLLLITSLLIIPAAASRRLAKTPEQMALGACLVGCLSVAGGLALSWHYDTPAGPS 241

Query: 244 IIITSLFLFILSF 256
           +++TSL +F+L +
Sbjct: 242 VVVTSLLIFMLLY 254


>gi|159044250|ref|YP_001533044.1| putative high-affinity zinc uptake system membrane protein
           [Dinoroseobacter shibae DFL 12]
 gi|157912010|gb|ABV93443.1| putative high-affinity zinc uptake system membrane protein
           [Dinoroseobacter shibae DFL 12]
          Length = 266

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 161/252 (63%), Gaps = 1/252 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL  Q+ +   
Sbjct: 2   MLDDFMTRATLAGVGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLALQMSIFAG 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L +L +  +      + D +LGV+ HS ++  LV +SF+  V  DL ++LFGDI
Sbjct: 62  AVLVALLMALTVTYL-AGRGYAMDTLLGVMAHSALAFGLVAVSFLSGVRIDLMAYLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V+  D+++IWG   L + ++   W  LL  T+N ELA A G+ P + +L+  +  ++ 
Sbjct: 121 LSVSRMDLVVIWGGAALVVGLILWRWAALLTATLNEELAYASGLDPRREQLVLTVALAIT 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  + +PE MA +A  IG L  + GL  + +FDTP+
Sbjct: 181 VAVAIKVVGVLLIAAMLIIPAAAARGLARTPEAMAAIAAGIGALSAVAGLRAAYVFDTPA 240

Query: 241 GPSIIITSLFLF 252
           GPSI+  +  LF
Sbjct: 241 GPSIVCVAALLF 252


>gi|307130890|ref|YP_003882906.1| high-affinity zinc transport system membrane protein [Dickeya
           dadantii 3937]
 gi|306528419|gb|ADM98349.1| high-affinity zinc transport system membrane protein [Dickeya
           dadantii 3937]
          Length = 261

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVAL L+  + L   +  
Sbjct: 3   ELLLPGWLAGVCLAVAAGPLGSFVVWRRMSYFGDTLAHASLLGVALGLLLDINLFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L ++ L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  ITLLLAVGLVWLERRPGLAIDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D+LLI     L + +L   W+ LL+ TV+ ELA  +G+   + KL+ ++IT+L I +
Sbjct: 123 TSEDLLLIGPGVVLVLGVLGWQWRALLSMTVSPELAHVDGIAIARTKLLLMLITALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA+ A  +GI+ +  GL  S   +TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAVYAMGVGIMAVTGGLAFSAGANTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LF+ S   K+
Sbjct: 243 VVLCASLLFMFSLLKKQ 259


>gi|238782513|ref|ZP_04626544.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           bercovieri ATCC 43970]
 gi|238716440|gb|EEQ08421.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           bercovieri ATCC 43970]
          Length = 257

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 170/250 (68%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  + +L
Sbjct: 6   LAGILLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIVMTMVLAL 65

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI L
Sbjct: 66  ILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWL 125

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + + +L   W+ LL+ TV+ ELA  +G+  E+++++ +++T+L I +S+KF+G 
Sbjct: 126 IAAGVMVVLGVLCWQWRALLSMTVSPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGA 185

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P   ARRF+ +PE MA +A  IG++ +  GL  S ++DTP+GPS+++ +  
Sbjct: 186 LIITSLLIIPAAAARRFARTPEQMAGIAVGIGVIAVTGGLTFSALYDTPAGPSVVLCAAV 245

Query: 251 LFILSFFYKK 260
           +F+LS   K 
Sbjct: 246 MFVLSLSQKA 255


>gi|227111602|ref|ZP_03825258.1| high-affinity zinc transporter membrane component [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 261

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  + L   +  
Sbjct: 3   ELLFPGWLAGILLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINLFAAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLILALGLVWLERRPYLAIDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+ +I     + + I+   W+ LL+ T++ ELA  +G++ ++ KL+ ++ T+L I +
Sbjct: 123 TTEDLWVIASGVIVVVAIMCWQWRALLSMTISPELAHVDGVKLQRTKLLLMLTTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  +ARRF+ +PE MA +A I+G++ +  GL  S  ++TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAASARRFARTPEQMASIAIIVGMIAVTGGLAFSAGYNTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   ++
Sbjct: 243 VVLCASLLFIVSLIKRQ 259


>gi|253688212|ref|YP_003017402.1| ABC-3 protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754790|gb|ACT12866.1| ABC-3 protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 261

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  + L   +  
Sbjct: 3   ELLFPGWLAGILLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINLFAAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLILALGLVWLERRPYLAVDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+ +I     + + I+   W+ LL+ T++ ELA  +G++ ++ KL+ ++ T+L I +
Sbjct: 123 TTEDLWVIGSGVIVVVAIMRWQWRALLSMTISPELAHVDGVKLQRTKLLLMLTTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  +ARRF+ +PE MA +A I+G++ +  GL  S  ++TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAASARRFARTPEQMASIAVIVGMIAVTGGLAFSAGYNTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   ++
Sbjct: 243 VVLCASLLFIVSLLKRQ 259


>gi|94501585|ref|ZP_01308102.1| high-affinity zinc uptake system membrane protein ZnuB
           [Oceanobacter sp. RED65]
 gi|94426268|gb|EAT11259.1| high-affinity zinc uptake system membrane protein ZnuB
           [Oceanobacter sp. RED65]
          Length = 264

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 171/251 (68%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + AL +G  + L +GPLG FI+W+R+AYFGDT+AHSALLGV L  +  + L I I + 
Sbjct: 3   WLLDALLAGWLLSLMSGPLGSFIVWRRMAYFGDTLAHSALLGVTLGFLMDVQLNIAIILC 62

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A   +++L  +Q+ + + SD +LG++ H+T++  LV LS +  V  DL S+LFGD+LAV+
Sbjct: 63  AIFIAVLLANLQRQQLIPSDTLLGLMAHTTLAAGLVTLSMVDNVRIDLNSYLFGDLLAVS 122

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+  +     L +  + K+W+ LLA +V+ ELA+ EG    +++L+F+++ +++I+ +
Sbjct: 123 RQDLYSLAIGSALVLAAIIKMWRGLLAASVSEELAEVEGYNVARLRLMFMVLLAIVIAGA 182

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+ LIT+LLI+P   AR FS  P+ MA +ATI+ ++ + +GL  S  +DTP+GPS+
Sbjct: 183 MKLVGVLLITALLIIPAAAARPFSRHPQQMAFIATILSMISVALGLGLSYQWDTPAGPSV 242

Query: 245 IITSLFLFILS 255
           ++ S  +F++S
Sbjct: 243 VLASAIIFLIS 253


>gi|83943104|ref|ZP_00955564.1| ABC zinc transporter, inner membrane subunit ZnuB [Sulfitobacter
           sp. EE-36]
 gi|83846112|gb|EAP83989.1| ABC zinc transporter, inner membrane subunit ZnuB [Sulfitobacter
           sp. EE-36]
          Length = 275

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 171/255 (67%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +GIG+  +  PLGCF++W+R+AYFGD  +H+ALLGVAL+L F+LP+   
Sbjct: 13  MLDDFLIRAGLAGIGVAFAAAPLGCFVVWRRMAYFGDATSHAALLGVALALAFELPIFAG 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + +IA   +L++  +    +L +D +LGV+ H  +++ LV +S +     DL+++LFG+I
Sbjct: 73  VLLIALSMALIVTALN-GRSLGTDTLLGVLAHGALAIGLVAVSLLPNQRVDLSAYLFGEI 131

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  TD+ +IW    L+I +L   W+ LL++T+N +LA A G+ P + +LI  +  ++ 
Sbjct: 132 LAVTKTDLAIIWSGAVLSIALLVWRWQALLSSTLNPDLATASGVNPRREQLILTLALAVT 191

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  LI ++LI+P   AR F+ +PE MA+ A IIG++  + GL  S   DTP+
Sbjct: 192 VAVAIKVVGALLIAAMLIIPAAAARPFARTPEVMAMAACIIGMIAALGGLAASFTLDTPT 251

Query: 241 GPSIIITSLFLFILS 255
           GPSI+  +  LFILS
Sbjct: 252 GPSIVSVAAVLFILS 266


>gi|167856240|ref|ZP_02478974.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           parasuis 29755]
 gi|167852627|gb|EDS23907.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           parasuis 29755]
          Length = 261

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 172/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGVFLTFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ ++++   S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTVILALCLVWLEQHSTHSVDTLLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKI-WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D+L I   G + I  L  + WK LLA TV+ ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 GFNDVLFI-SFGVIGIATLLALYWKKLLAITVSPELAQIEGLNVARLRLLLMLLTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+ TARRF+ +PE M I A  + IL +  GL  S + DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSATARRFAKTPETMVIYAIGLSILSVSGGLLLSALKDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  LF+LS   K+
Sbjct: 242 SVVVCAGTLFLLSLIKKE 259


>gi|288962150|ref|YP_003452445.1| zinc transport system permease protein [Azospirillum sp. B510]
 gi|288914416|dbj|BAI75901.1| zinc transport system permease protein [Azospirillum sp. B510]
          Length = 261

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 179/253 (70%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           +EF  RAL +G GI L  GPLG F++W+R+AYFGDT++HSALLGV L  +  +   + + 
Sbjct: 2   DEFVTRALLAGGGIALLAGPLGSFVVWRRMAYFGDTLSHSALLGVTLGFLLGVNPMVGVM 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++    +L L+ +Q+   L++D +LG+++H ++SL LV L+F++ +  DL ++LFGDIL+
Sbjct: 62  VVCVALALALVALQRRRNLAADTLLGILSHGSLSLGLVALAFLETLRVDLMAYLFGDILS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I+G G + +  L  +W+ LLA TV+ +LA+ EGM  + ++L F+++ +L+I+
Sbjct: 122 VTDGDLMAIYGGGAVALTGLALLWRRLLAVTVDEDLARVEGMPVDALRLAFMLLIALVIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +GI LITSLLI+P   ARRF+ +PE MA LA+++GIL +I G+  SL +D P GP
Sbjct: 182 IAMKIVGILLITSLLIIPAAAARRFARTPEGMAALASVLGILAVIAGILASLTWDLPGGP 241

Query: 243 SIIITSLFLFILS 255
           S+++ +  LF+L 
Sbjct: 242 SVVVAAAALFLLG 254


>gi|238796298|ref|ZP_04639807.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           mollaretii ATCC 43969]
 gi|238719743|gb|EEQ11550.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           mollaretii ATCC 43969]
          Length = 248

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 165/242 (68%)

Query: 19  STGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKN 78
           + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L +L+L+ +++ 
Sbjct: 5   AAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIAMTMLLALILVWLERR 64

Query: 79  EALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLN 138
             L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI LI     + 
Sbjct: 65  PQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWLIAAGVIVV 124

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
           + +L   W+ LL+ TV+ ELA  +G+  E+++++ +++T+L I +S+KF+G  +ITSLLI
Sbjct: 125 LGVLCWQWRALLSMTVSPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGALIITSLLI 184

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFY 258
           +P   ARRF+ +PE MA +A  IG++ +  GL  S ++DTP+GPS+++ +  +F+LS   
Sbjct: 185 IPAAAARRFARTPEQMAGIAVGIGMIAVTGGLTFSALYDTPAGPSVVLCAAVMFVLSLSQ 244

Query: 259 KK 260
           K 
Sbjct: 245 KA 246


>gi|126730743|ref|ZP_01746553.1| ABC-3 [Sagittula stellata E-37]
 gi|126708909|gb|EBA07965.1| ABC-3 [Sagittula stellata E-37]
          Length = 270

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 164/256 (64%), Gaps = 7/256 (2%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RA+ +GIG+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL F    ++ IF
Sbjct: 9   DDFVMRAILAGIGLAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLTF----SVSIF 64

Query: 63  MIATLTSLVL---LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           M     +LV+   +        + D +LGV+ HS ++  LV  SF+  +  DL ++LFGD
Sbjct: 65  MGVMGVALVMAFTVSTLSGRGFAMDTMLGVLAHSALAFGLVAASFLSGIRVDLMAYLFGD 124

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL+V   D+ +IWG G L + +L   W  LL  T+N +LA AEG+ P + +++  +  ++
Sbjct: 125 ILSVMPRDLAVIWGGGALVVALLIWRWSALLTATLNPDLAYAEGVDPRREQMMLNVALAI 184

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +++V+IK +G  LIT++LI+P   AR  +++PE MA+LA  +    ++ G+  + IFDTP
Sbjct: 185 VVAVAIKVVGALLITAMLIIPAAAARPLTSTPEVMALLAGGMACASVVGGIRAAWIFDTP 244

Query: 240 SGPSIIITSLFLFILS 255
           +GP+I+     LF LS
Sbjct: 245 TGPTIVCVVAGLFALS 260


>gi|59712975|ref|YP_205751.1| high-affinity zinc uptake system membrane protein ZnuB2 [Vibrio
           fischeri ES114]
 gi|59481076|gb|AAW86863.1| high-affinity zinc uptake system membrane protein ZnuB2 [Vibrio
           fischeri ES114]
          Length = 273

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 168/260 (64%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+ L+  PLGCFI+W+R+AYFGD  AH+++LG+ALSL   LP+   
Sbjct: 1   MLDDFLWRATLAGVGVTLAAAPLGCFIVWRRMAYFGDATAHASMLGIALSLALSLPILPS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  IA + ++ + +     + + D +LGV+ HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  VLFIALIMAITVSKFS-GRSYAMDTLLGVMAHSALAIGLVAVSFLSGIRLDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG     I ++   W  LL + ++ +LA A    P++ +LI  +  +++
Sbjct: 120 LAVSKMDLFIIWGGALFIIGLIRFRWSGLLLSILDKDLALASNFSPKREQLILTIALAIV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR FS +PE M +LA +IG    I+GL  S +FDTP+
Sbjct: 180 VAVAIKVVGVLLIVAMLIIPAAAARPFSQTPEMMVVLAALIGSSSSILGLRASYLFDTPT 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP+I+  +  LFI S   +K
Sbjct: 240 GPTIVCIATGLFITSSLIRK 259


>gi|83954262|ref|ZP_00962982.1| ABC zinc transporter, inner membrane subunit ZnuB [Sulfitobacter
           sp. NAS-14.1]
 gi|83841299|gb|EAP80469.1| ABC zinc transporter, inner membrane subunit ZnuB [Sulfitobacter
           sp. NAS-14.1]
          Length = 275

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 171/255 (67%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +GIG+  +  PLGCF++W+R+AYFGD  +H+ALLGVAL+L F+LP+   
Sbjct: 13  MLDDFLIRAGLAGIGVAFAAAPLGCFVVWRRMAYFGDATSHAALLGVALALAFELPIFAG 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++A   +L++  +    +L +D +LGV+ H  +++ LV +S +     DL+++LFG+I
Sbjct: 73  VLLVALSMALIVTALN-GRSLGTDTLLGVLAHGALAIGLVAVSLLPNQRVDLSAYLFGEI 131

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  TD+ +IW    L+I +L   W+ LL++T+N +LA A G+ P + +LI  +  ++ 
Sbjct: 132 LAVTKTDLAIIWSGAVLSIALLVWRWQALLSSTLNPDLATASGVNPRREQLILTLALAVT 191

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  LI ++LI+P   AR F+ +PE MA+ A IIG++  + GL  S   DTP+
Sbjct: 192 VAVAIKVVGALLIAAMLIIPAAAARPFARTPEVMAMTACIIGMIAALGGLAASFTLDTPT 251

Query: 241 GPSIIITSLFLFILS 255
           GPSI+  +  LF+LS
Sbjct: 252 GPSIVSVAAVLFVLS 266


>gi|269468532|gb|EEZ80186.1| ABC-type Mn2+/Zn2+ transporter, permease component [uncultured
           SUP05 cluster bacterium]
          Length = 263

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 169/253 (66%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  RAL + IGI +  G LGCF+IW+R++YF ++I+HSALLGV+L L   L +   + 
Sbjct: 2   EDFIFRALLAAIGISIIAGSLGCFVIWKRMSYFSESISHSALLGVSLGLASGLGIHFGLV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++  + +L+++ +Q+ + LS+DAILG+ +H  +SL +V+L  +   NTD   FLFGDIL+
Sbjct: 62  LVGAVFALLIVVLQERKFLSNDAILGIFSHIALSLGIVVLGLVGGANTDYFGFLFGDILS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  TDI+ ++ +  +   +L   W+ LL  T+N ELAKAEG+Q    +L+F+++ +L +S
Sbjct: 122 ITNTDIVWVYSVLIVIASLLGFFWQRLLLLTLNEELAKAEGIQHMTYQLLFMLMIALAVS 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS++ +G+ LITSLLI+P   AR  + +P  M   + ++ I+ ++ GL GS+ +D  +GP
Sbjct: 182 VSVQIVGVLLITSLLIIPPAIARVLANTPGQMVFQSIVVSIMAVVAGLSGSMYYDLATGP 241

Query: 243 SIIITSLFLFILS 255
           +I+I    LF+LS
Sbjct: 242 AIVIALGILFVLS 254


>gi|146279185|ref|YP_001169343.1| hypothetical protein Rsph17025_3154 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557426|gb|ABP72038.1| hypothetical protein Rsph17025_3154 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 260

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 160/245 (65%), Gaps = 1/245 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +GIG+  + GPLG F++W+R+AYFGD  +H+A+LGVAL+L  +LP+ + 
Sbjct: 1   MLDDFLIRAALAGIGVAAAAGPLGAFVVWRRMAYFGDATSHAAILGVALALATELPVGLG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L     + +      + D +LGV+ HS ++  L+ +SF+  V TDL+++LFGDI
Sbjct: 61  TLIVA-LVMAATVAMLSGRGWAMDTMLGVLAHSALAFGLLAVSFLPSVRTDLSAWLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+  IW    L + +L   W  LL +T+N +LA A G+ P + +LI  +  ++ 
Sbjct: 120 LAVSLPDLAFIWMGAALVLALLIWRWTALLTSTINEDLAAASGIDPGRERLILTLALAVT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V++K +G  LI+++LI+P   AR  + +PE MA+LA +IG    I GL  SL FDTP+
Sbjct: 180 VAVALKVVGALLISAMLIIPAAAARGLARNPEPMALLAALIGAGASIAGLGASLTFDTPA 239

Query: 241 GPSII 245
           GPSI+
Sbjct: 240 GPSIV 244


>gi|261821385|ref|YP_003259491.1| high-affinity zinc transporter membrane component [Pectobacterium
           wasabiae WPP163]
 gi|261605398|gb|ACX87884.1| ABC-3 protein [Pectobacterium wasabiae WPP163]
          Length = 261

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  + L   +  
Sbjct: 3   ELLFPGWLAGILLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINLFSAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLILALGLVWLERRPYLAVDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+ +I     + + ++   W+ LL+ T++ ELA  +G++ ++ KL+ ++ T+L I +
Sbjct: 123 TTEDLWVISAGVIVVVAVMRWQWRALLSMTISPELAHVDGVKLQRTKLLLMLTTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  +ARRF+ +PE MA +A I+G++ +  GL  S  ++TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAASARRFARTPEQMASIAIIVGMIAVTGGLAFSAGYNTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S    +
Sbjct: 243 VVLCASLLFIVSLLKPQ 259


>gi|226942255|ref|YP_002797328.1| zinc ABC transporter permease [Azotobacter vinelandii DJ]
 gi|226717182|gb|ACO76353.1| zinc ABC transporter, permease protein [Azotobacter vinelandii DJ]
          Length = 262

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 166/240 (69%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVA+ L+  +  T+ +     L +++L+ +Q+ +A
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVAVGLLLDVSPTLAVIAGCLLLAVLLVALQQRQA 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL S+LFGD+LAV   D+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMDDVRIDLMSYLFGDLLAVGPGDLAWILGGSALVML 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA+ EG+    I+L  +++ +L+I+V++K +G+ LITSLLI+P
Sbjct: 140 LLVPLWRPLLAITVHEELARVEGLPVAGIRLALMLLIALVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + +PE MA  A+ +G++ +  GL  S   DTP+GPSI++ +  LF+      +
Sbjct: 200 AAAAQRHARTPEQMAAGASFLGVVAVCAGLSLSWFQDTPAGPSIVVCAAVLFLAGLLLPR 259


>gi|254477969|ref|ZP_05091354.1| ABC-3 [Ruegeria sp. R11]
 gi|214028554|gb|EEB69390.1| ABC-3 [Ruegeria sp. R11]
          Length = 264

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 174/264 (65%), Gaps = 11/264 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---- 56
           +++ F IRA  +G+G+ L+  PLGCF++W+R+AYFGD  AH+++LGVAL+L F       
Sbjct: 2   IFDAFLIRAALAGVGVALAAAPLGCFVVWRRMAYFGDATAHASILGVALALSFDTSVFAG 61

Query: 57  -LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            L + + M +T++SL           + D +LGV+ HS+++  LV +SF+  V  DL ++
Sbjct: 62  VLVMALAMGSTVSSL------SGRGYAVDTLLGVLAHSSLAFGLVAVSFLSGVRLDLMAY 115

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFGDILAV+ TD+L+IWG   + I +L+  W  LL +T+N +LA A G+ P + +LI  +
Sbjct: 116 LFGDILAVSQTDLLIIWGGAAMVIALLWWRWSALLTSTLNADLAHAAGIDPRREQLILTL 175

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
             S++++V+IK +G+ LI +LLI+P  TAR F+ +PE M ++A +IG +  I GL  +  
Sbjct: 176 ALSVVVAVAIKVVGVLLIAALLIIPAATARPFAKTPERMTLIAAVIGAVSAIGGLQLAFS 235

Query: 236 FDTPSGPSIIITSLFLFILSFFYK 259
           FDTP+GP+I+  +  LF LS  ++
Sbjct: 236 FDTPTGPTIVCLAAVLFALSNLHQ 259


>gi|331005482|ref|ZP_08328861.1| Zinc ABC transporter, inner membrane permease protein ZnuB [gamma
           proteobacterium IMCC1989]
 gi|330420758|gb|EGG95045.1| Zinc ABC transporter, inner membrane permease protein ZnuB [gamma
           proteobacterium IMCC1989]
          Length = 263

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 166/244 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +GIGI L   PLG FI+WQR+AYFGDT+AH++LLGVA  L+  + + + I +
Sbjct: 3   DFLLLALVAGIGIALIAAPLGAFIVWQRLAYFGDTLAHASLLGVAFGLLLTVNIQLAIML 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            +   +++L+  Q  + L +D +LG+++HST++L LV++S       DL+++L GD+L+ 
Sbjct: 63  CSLFIAVLLVFWQHQKQLPNDTLLGILSHSTLALGLVLVSVFDSGRIDLSAYLLGDLLST 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+ +  +  + +++ W  LL+  VN  LA  EG+  +K++ +FI + +L I++
Sbjct: 123 DVNDVITIYILLIIVALTIWRYWHALLSMIVNEPLAIVEGIPVKKMRFLFICLLALTIAM 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +IK +G+ LIT+LLI+P   AR  S+SPE M + A + G L ++ GLY SL++DTP+GPS
Sbjct: 183 AIKMVGVLLITALLIIPAAAARYLSSSPEKMVLWAGVFGCLSVMGGLYSSLLWDTPAGPS 242

Query: 244 IIIT 247
           I++ 
Sbjct: 243 IVVC 246


>gi|238897859|ref|YP_002923538.1| high-affinity Zn transport protein (ABC superfamily, membrane)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465616|gb|ACQ67390.1| high-affinity Zn transport protein (ABC superfamily, membrane)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 262

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 172/258 (66%), Gaps = 4/258 (1%)

Query: 7   IRALFSG--IGIVLST--GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           I  LF G   GI+L+T  GPLG FIIW+R++YFGDT+AH++LLGVA  L+  + L   + 
Sbjct: 2   IELLFPGWLAGILLATAAGPLGSFIIWRRMSYFGDTLAHASLLGVAFGLLLNVNLFYAVI 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            I  L + +L+ ++    L  D +LG++ HS +SL LVI+S M  V  DL ++LFGD+L+
Sbjct: 62  FITLLLACLLVWLEGQYQLPVDTLLGILAHSALSLGLVIVSLMSNVRIDLMAYLFGDLLS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   DILLI     L +++L   W+ LL+ T++ ELA  EG+  +K +++ + + SL I+
Sbjct: 122 VTIADILLIASGVMLVLLLLLWKWRQLLSITISAELAYVEGINLKKNQMLLMFLVSLTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G+ +I+SLLI+P+ TARRF+ +PE MA    I+G+L +  GL  S  +DTP+GP
Sbjct: 182 LSMKFVGVLIISSLLIIPSATARRFAHTPEQMAGTGIIVGVLAVTGGLALSAFYDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +F+LS   K 
Sbjct: 242 SVVLCATVMFLLSLLKKS 259


>gi|78484920|ref|YP_390845.1| hypothetical protein Tcr_0575 [Thiomicrospira crunogena XCL-2]
 gi|78363206|gb|ABB41171.1| ATP-binding cassete (ABC) superfamily transporter, permease
           component [Thiomicrospira crunogena XCL-2]
          Length = 268

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 169/252 (67%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A   GI I L   PLG F++WQ+ +YFG  +AHSALLGV+  L+ +L LT+ + +I+   
Sbjct: 15  AFLGGILIALIAAPLGVFMVWQKQSYFGAALAHSALLGVSFGLLIELNLTLAVVLISLGV 74

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +L +  +++   LSSD +LG++ HST+++ L+ILS    V  D+ S+LFGDIL++++ D+
Sbjct: 75  ALGIHFLKEKTRLSSDTLLGILAHSTLAIGLIILSLQSHVQIDIFSYLFGDILSIDSMDL 134

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
             I  +G L  +  +  W  LL TT+N ELA+ EG+  +K++L ++++ +L+I+V++K +
Sbjct: 135 NFILLLGGLVSLFFWFHWHDLLNTTLNAELAQIEGIPTQKVQLYYVLLLALLIAVAMKIV 194

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G+ LITSLLI+P   AR+FS SPE M   + + G + ++ GL  S+ +D P+GPSI+  +
Sbjct: 195 GVLLITSLLIIPAAAARKFSNSPERMLTFSMVFGFISVLFGLLSSIFWDLPTGPSIVAIA 254

Query: 249 LFLFILSFFYKK 260
             +F++S F K+
Sbjct: 255 TVIFLVSLFKKE 266


>gi|190149783|ref|YP_001968308.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263101|ref|ZP_07544723.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914914|gb|ACE61166.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306871727|gb|EFN03449.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 261

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 171/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I G G L I  +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 DFDDVVFI-GSGMLFIAGVLGYFWKKLLSITISPELAQIEGLNVVRLRLVLMLLTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A I  I  I  GL  S   DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSIFSITGGLLFSAWKDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +F+LS F K+
Sbjct: 242 SVVVCAGAIFLLSLFRKE 259


>gi|238751593|ref|ZP_04613083.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           rohdei ATCC 43380]
 gi|238710155|gb|EEQ02383.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           rohdei ATCC 43380]
          Length = 257

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 170/250 (68%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  + +L
Sbjct: 6   LAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIVMTMVLAL 65

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI L
Sbjct: 66  ILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWL 125

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + + +L   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +S+KF+G 
Sbjct: 126 IAAGVVVVLGVLCWQWRALLSMTISPELAHVDGINLERVRMLLMLVTALTIGLSMKFVGA 185

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S ++DTP+GPS+++ +  
Sbjct: 186 LIITSLLIIPAAAARRFARTPEQMAGIAIGIGIVAVTGGLTFSALYDTPAGPSVVLCAAA 245

Query: 251 LFILSFFYKK 260
           +FILS   K 
Sbjct: 246 MFILSLSQKP 255


>gi|304309836|ref|YP_003809434.1| ABC-type Mn2+/Zn2+ transport systems, permease component [gamma
           proteobacterium HdN1]
 gi|301795569|emb|CBL43767.1| ABC-type Mn2+/Zn2+ transport systems, permease component [gamma
           proteobacterium HdN1]
          Length = 264

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 156/235 (66%), Gaps = 2/235 (0%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
           +GPLG F++W R+AYFGDT+AHSALLGV LSL F   + + + ++  L ++VL       
Sbjct: 19  SGPLGAFVVWGRMAYFGDTLAHSALLGVGLSLAFGFHMLVGVALVTALVAIVLTLPSSQR 78

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI-LLIWGIGFLN 138
             ++D +LG++ H T++L L+++S       D+   LFGD+LAV   D+  ++ G   + 
Sbjct: 79  YFANDTLLGIMAHGTLALGLILVSLAGNARVDMMGLLFGDVLAVTWDDVRFIVAGSALVA 138

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
           + +LF  W+ LL+  ++ EL+ AEG+  E+++ + +++ +L ++V ++ +G  LIT+LLI
Sbjct: 139 VTLLFT-WRALLSCILSAELSAAEGVPVERLRALLMVLLALTVAVGMRVVGALLITALLI 197

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
           +P   ARR S++PE MA+ A+++G++ + +GL  S   DTP+GPSI++ ++ LF+
Sbjct: 198 IPPAAARRISSTPEQMALKASLVGVIAVSLGLGFSWYLDTPTGPSIVLAAVLLFM 252


>gi|26986862|ref|NP_742287.1| hypothetical protein PP_0117 [Pseudomonas putida KT2440]
 gi|24981463|gb|AAN65751.1|AE016201_3 zinc ABC transporter, permease protein ZnuB [Pseudomonas putida
           KT2440]
          Length = 260

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 168/240 (70%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL     +   + + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGFALDVSPALAVTVGCLLLAILLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++TTD+  I G   L ++
Sbjct: 80  LASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLL 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAALWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
              A+R + SPE MA+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 200 AAAAQRHARSPEQMALGASLMGVTAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 259


>gi|254467636|ref|ZP_05081045.1| ABC-3 [Rhodobacterales bacterium Y4I]
 gi|206684384|gb|EDZ44868.1| ABC-3 [Rhodobacterales bacterium Y4I]
          Length = 268

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 160/248 (64%), Gaps = 11/248 (4%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----L 57
           ++F IRA  +GIG+ L+  PLGCF++W+R+AYFGD  AH+++LGVAL+L F +      L
Sbjct: 5   DDFLIRAALAGIGVALAAAPLGCFVVWRRMAYFGDATAHASILGVALALSFDVSVFAGVL 64

Query: 58  TICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
              + M  T+++L           + D +LGV+ HS+++  LV +SF++ V  DL ++LF
Sbjct: 65  ATALAMATTVSAL------AGRGYAMDTLLGVLAHSSLAFGLVAVSFLQGVRIDLMAYLF 118

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           GDILAV   D+ +IWG   L + +L+  W  LL  T+N +LA A G+ P + +++  +  
Sbjct: 119 GDILAVGRADLAVIWGGAALVLGLLWWRWSALLTATLNPDLAHAAGIDPRREQMVLTIAL 178

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +L+++V+IK +G+ LI ++L++P   AR F+ +PE MA +A ++G+L    GL  +   D
Sbjct: 179 ALVVAVAIKVVGVLLIAAMLLIPAAAARPFAATPERMAAIAALLGMLSATGGLQLAFALD 238

Query: 238 TPSGPSII 245
           TP+GPSI+
Sbjct: 239 TPAGPSIV 246


>gi|254487642|ref|ZP_05100847.1| zinc ABC transporter, permease protein [Roseobacter sp. GAI101]
 gi|214044511|gb|EEB85149.1| zinc ABC transporter, permease protein [Roseobacter sp. GAI101]
          Length = 263

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 171/255 (67%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +GIG+ L+  PLGCF++W+R+AYFGD  +H+ALLGVAL+L   LP+   
Sbjct: 1   MLDDFVMRAALAGIGVALAAAPLGCFVVWRRMAYFGDATSHAALLGVALALSLDLPVFAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++A   +L++  +     +S+DA+LGV+ H  +++ LV +S +     DL+++LFG+I
Sbjct: 61  VLVVAMAMALIVSGLS-GRTVSTDALLGVMAHGALAIGLVAVSLLPNQRVDLSAYLFGEI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+++IWG   ++I +L   W+ LL+ T+N +LA A G+ P + +LI  +  +L 
Sbjct: 120 LAVTKGDLVIIWGGAAVSIALLVWRWQALLSATLNPDLATASGVNPHREQLILTVALALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V++K +G  LI +LLI+P   AR FS +PE MA++A  IG++  + GL  S  FDTP+
Sbjct: 180 VAVALKVVGALLIAALLIIPAAAARPFSRTPETMAMMAAGIGMVSTLGGLAASFAFDTPT 239

Query: 241 GPSIIITSLFLFILS 255
           GPSI+  +  +F +S
Sbjct: 240 GPSIVTVAAVIFAVS 254


>gi|238756973|ref|ZP_04618161.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           aldovae ATCC 35236]
 gi|238704803|gb|EEP97332.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           aldovae ATCC 35236]
          Length = 257

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 170/250 (68%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  + +L
Sbjct: 6   LAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIVMTMVLAL 65

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI L
Sbjct: 66  ILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWL 125

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I G   + + +L   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +S+KF+G 
Sbjct: 126 IAGGVVVVLAVLCWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGA 185

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS+++ +  
Sbjct: 186 LIITSLLIIPAAAARRFARTPEQMAGIAIGIGIVAVTGGLTFSAFYDTPAGPSVVLCAAA 245

Query: 251 LFILSFFYKK 260
           +F+LS   K 
Sbjct: 246 MFVLSLSQKA 255


>gi|294340096|emb|CAZ88464.1| High-affinity zinc uptake ABC system membrane protein [Thiomonas
           sp. 3As]
          Length = 266

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 164/241 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL  G+G+ L  GPLGCF++W+R+AYFG+T+AHSA LGVAL L+  L   I +  
Sbjct: 8   DFVWRALIGGLGVALLAGPLGCFVVWRRMAYFGETLAHSAFLGVALGLLLHLDPVIGVLA 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           ++ + +LVL + Q  E ++ D +LG++ H++++L LV+L+FM+ V  DL S+LFGDILA+
Sbjct: 68  VSVVIALVLARRQPAEGIAEDTLLGLLAHTSLALGLVVLAFMENVRVDLFSYLFGDILAL 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+  I  I  + + +L  +W+ LLA TV+ ELA  EG + + ++L F+++ ++ +++
Sbjct: 128 RAADLGWILLIDVVGLSLLAWLWQGLLALTVHEELAAVEGRRVKWLQLAFMLVLAVFVAL 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  ++LI+P   ARR + +P  MA+ A  IG + +++GL  SL  D PSGP+
Sbjct: 188 AMKLVGILLTVAMLIIPAAAARRLARTPLQMALGAAAIGAVAVLLGLLASLHSDLPSGPA 247

Query: 244 I 244
           +
Sbjct: 248 M 248


>gi|296136072|ref|YP_003643314.1| ABC-3 protein [Thiomonas intermedia K12]
 gi|295796194|gb|ADG30984.1| ABC-3 protein [Thiomonas intermedia K12]
          Length = 266

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 163/241 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL  G+G+ L  GPLGCF++W+R+AYFG+T+AHSA LGVAL L+  L   I +  
Sbjct: 8   DFVWRALIGGVGVALLAGPLGCFVVWRRMAYFGETLAHSAFLGVALGLLLHLDPVIGVLA 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           ++ + +LVL + Q  E ++ D +LG++ H++++L LV+L+FM+ V  DL S+LFGDILA+
Sbjct: 68  VSVVIALVLARRQPAEGIAEDTLLGLLAHTSLALGLVVLAFMEDVRVDLFSYLFGDILAL 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+  I  I  + + +L  +W+ LLA TV+ ELA  EG   + ++L F+++ ++ +++
Sbjct: 128 RAADLGWILLIDVVGLSLLAWLWQGLLALTVHEELAAVEGRLVKWLQLAFMLVLAVFVAL 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  S+LI+P   ARR + +P  MA+ A  IG + +++GL  SL  D PSGP+
Sbjct: 188 AMKLVGILLTVSMLIIPAAAARRLARTPVQMALGAAAIGAVAVLLGLLASLHSDLPSGPA 247

Query: 244 I 244
           +
Sbjct: 248 M 248


>gi|148244819|ref|YP_001219513.1| zinc ABC transporter permease [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326646|dbj|BAF61789.1| zinc ABC transporter permease [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 267

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 173/259 (66%), Gaps = 1/259 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  RA+ + IGI + +G LGCF+IW+R++YF ++I+HSALLG +L     L +   + 
Sbjct: 7   EDFIFRAILAAIGISIISGSLGCFVIWKRMSYFSESISHSALLGTSLGFASGLGMHFGLV 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           M+ T+ ++ ++ +Q+   LS+D ILG+ +H  +SL +V+L F+   NTD  S LFGDIL+
Sbjct: 67  MVGTIFAIFIVILQRKNFLSNDTILGIFSHIFLSLGIVVLGFIGGTNTDYFSLLFGDILS 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  +DI+ ++ I  +  ++L   W+ LL  T+N ELA A+G+  +  +L+F+++ +L +S
Sbjct: 127 ITNSDIVWVYVILTVLGLLLIIFWQRLLLLTLNEELAVAQGLNRDFYQLLFMLMIALAVS 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS++ +G+ LITSLLI+P   AR FS +P +M   + I+ ++ + IG+  S+ +D  +GP
Sbjct: 187 VSVQIVGVLLITSLLIIPPAVARVFSNTPSSMVFQSVIVSMVAVTIGIIASMFYDVATGP 246

Query: 243 SIIITSLFLFILS-FFYKK 260
           +I+IT   LF+LS F YKK
Sbjct: 247 AIVITLGVLFLLSQFAYKK 265


>gi|56695885|ref|YP_166236.1| zinc ABC transporter, permease protein [Ruegeria pomeroyi DSS-3]
 gi|56677622|gb|AAV94288.1| zinc ABC transporter, permease protein [Ruegeria pomeroyi DSS-3]
          Length = 265

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 164/259 (63%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +G G+ L++GPLGCF++W+R+AYFG+  AH+A+LGVAL+L    P+   
Sbjct: 2   MLDDFMIRAALAGAGVALASGPLGCFVVWRRMAYFGEATAHAAVLGVALALALSAPILPA 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + + A L +  +  + +    + D  LGV+ H+ ++  LV +S +  V  DL +FLFGDI
Sbjct: 62  VVLAAVLMASAV-TLMRGRGYAMDTALGVMAHTALAAGLVAVSLLADVRLDLMAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG G L + +    W  LL  T+N +LA A G+ P + +    +  +++
Sbjct: 121 LAVSRGDLAVIWGGGALVLGLTLWRWSDLLIATLNPDLAHAAGVDPRRAETWLTLALAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI +LL++P   AR  S +PE MA+ A  IG L  + GLYG+ +FDTP+
Sbjct: 181 VAVAIKVVGVLLIAALLVIPAAAARPLSGTPEGMALGAAGIGGLSALAGLYGAYLFDTPA 240

Query: 241 GPSIIITSLFLFILSFFYK 259
           GPSI+  +   FI++   +
Sbjct: 241 GPSIVCVAALSFIVTTLAR 259


>gi|330505749|ref|YP_004382618.1| ABC-3 protein [Pseudomonas mendocina NK-01]
 gi|328920035|gb|AEB60866.1| ABC-3 protein [Pseudomonas mendocina NK-01]
          Length = 262

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 165/226 (73%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           GPLG F++W+R+AYFGDT++H+ALLGVAL L+  +  T+ + +   L +++L+ +Q+ + 
Sbjct: 20  GPLGSFVVWRRMAYFGDTLSHAALLGVALGLLLDVSPTLTVTVGCVLLAVLLVTLQQRQP 79

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L+SD +LG++ HST+SL LV LSFM  V  DL S+LFGD+LAV+TTD+  I G   L + 
Sbjct: 80  LASDTLLGILAHSTLSLGLVALSFMHDVRIDLMSYLFGDLLAVSTTDLAWIIGGSALVLA 139

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +L  +W+PLLA TV+ ELA+ EG+    I+L  +++ +++I+V++K +G+ LITSLLI+P
Sbjct: 140 LLAWLWRPLLAITVHEELARVEGLPVAAIRLALMLLIAVVIAVAMKIVGVLLITSLLIIP 199

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
              A+R + +PE MA+ A+++G+L +  GL  S   DTP+GPSI++
Sbjct: 200 AAAAQRHARTPEQMAVGASLLGLLAVCCGLALSWYQDTPAGPSIVV 245


>gi|163742423|ref|ZP_02149810.1| ABC-3 [Phaeobacter gallaeciensis 2.10]
 gi|161384373|gb|EDQ08755.1| ABC-3 [Phaeobacter gallaeciensis 2.10]
          Length = 265

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 169/253 (66%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F IRA  +G+G+ ++  PLGCF++W+R+AYFGD  AH+++LG+AL+L F   + + + 
Sbjct: 5   DSFLIRAALAGVGVAIAAAPLGCFVVWRRMAYFGDATAHASILGIALALSFDTSIFVGVL 64

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A + + V+  +      + D +LGV+ HS+++  LV +SF++ V  DL ++LFGDILA
Sbjct: 65  AMALIMATVVSTL-SGRGYAVDTLLGVLAHSSLAFGLVAVSFLQGVRLDLMAYLFGDILA 123

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           VN  D+++IWG   L + +L+  W  LL  T+N +LA A G+ P + +L+  +  +++++
Sbjct: 124 VNANDLMVIWGGALLVVGLLWWRWSALLTATLNPDLAHAAGIDPRREQLVLTLALAVVVA 183

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+IK +G+ LI +LLI+P  TAR F+ +PE M I+A + G +  + GL  + IFDTP+GP
Sbjct: 184 VAIKVVGVLLIAALLIIPAATARPFAATPERMTIIAAVTGAISALGGLQLAFIFDTPTGP 243

Query: 243 SIIITSLFLFILS 255
           +I+  +  LF LS
Sbjct: 244 TIVCLAACLFALS 256


>gi|238754863|ref|ZP_04616213.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           ruckeri ATCC 29473]
 gi|238706874|gb|EEP99241.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           ruckeri ATCC 29473]
          Length = 236

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 166/235 (70%), Gaps = 4/235 (1%)

Query: 27  IIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           ++W+R++YFGDT+AH++LLGVA  L+  + P    I M+  L ++VL+ +++   L+ D 
Sbjct: 1   MVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIAMMLVL-AMVLVWLERRPQLAVDT 59

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIW-GIGFLNIMILFK 144
           +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +D+ LI  GI  + +++ ++
Sbjct: 60  LLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSVTLSDLWLIAAGIAAVLLVLCWQ 119

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            W+PLL+ T++ ELA  +G+  +++K++ +++T+L I +S+KF+G  +ITSLLI+P   A
Sbjct: 120 -WRPLLSMTISPELAHVDGVNLQRVKMLLMLVTALTIGLSMKFVGALIITSLLIIPAAAA 178

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
           RRFS +PE MA +A IIGIL +  GL  S  +DTP+GPS+++ +  +F+LS   K
Sbjct: 179 RRFSRTPEQMAGIAIIIGILAVSGGLAFSAFYDTPAGPSVVLCAAVMFVLSLSQK 233


>gi|163739231|ref|ZP_02146643.1| ABC-3 [Phaeobacter gallaeciensis BS107]
 gi|161387631|gb|EDQ11988.1| ABC-3 [Phaeobacter gallaeciensis BS107]
          Length = 265

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/253 (39%), Positives = 169/253 (66%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F IRA  +G+G+ ++  PLGCF++W+R+AYFGD  AH+++LG+AL+L F   + + + 
Sbjct: 5   DSFLIRAALAGVGVAIAAAPLGCFVVWRRMAYFGDATAHASILGIALALSFDTSIFVGVL 64

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A + + V+  +      + D +LGV+ HS+++  LV +SF++ V  DL ++LFGDILA
Sbjct: 65  AMALIMATVVSTL-SGRGYAVDTLLGVLAHSSLAFGLVAVSFLQGVRLDLMAYLFGDILA 123

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           VN  D+++IWG   L + +L+  W  LL  T+N +LA A G+ P + +L+  +  +++++
Sbjct: 124 VNANDLMVIWGGALLVVGLLWWRWSALLTATLNPDLAHAAGIDPRREQLVLTLALAVVVA 183

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+IK +G+ LI +LLI+P  TAR F+ +PE M I+A + G +  + GL  + +FDTP+GP
Sbjct: 184 VAIKVVGVLLIAALLIIPAATARPFAATPERMTIIAAVTGAISALGGLQLAFMFDTPTGP 243

Query: 243 SIIITSLFLFILS 255
           +I+  +  LF LS
Sbjct: 244 TIVCLAACLFALS 256


>gi|254510121|ref|ZP_05122188.1| hypothetical protein RKLH11_654 [Rhodobacteraceae bacterium KLH11]
 gi|221533832|gb|EEE36820.1| hypothetical protein RKLH11_654 [Rhodobacteraceae bacterium KLH11]
          Length = 265

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 161/252 (63%), Gaps = 1/252 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+  +  PLGCF++W+R+AYFGD  AH+A+LGVALSL FQL +   
Sbjct: 1   MLDDFMTRATLAGVGVAFAAAPLGCFVVWRRMAYFGDATAHAAILGVALSLTFQLSVFTG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +A + +L +  +      + D +LGV+ HS ++  LV +SF+  V  DL ++LFGDI
Sbjct: 61  ALAVALVMALTV-TLLTGRGYAMDTLLGVLAHSALAFGLVAVSFLSGVRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+L+IWG   L + ++   W  LL  T+N ELA A G  P++ +L+  +  ++ 
Sbjct: 120 LAVSRADLLVIWGGAALVVALIAWRWSQLLTATLNEELAYANGFNPKREQLVLTLSLAVT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI +LLI+P   AR  + SPE MA++A  IG    + GL  + +FDTP+
Sbjct: 180 VAVAIKVVGVLLIAALLIIPAAAARSLARSPETMALIAAAIGAFSSVAGLRAAYVFDTPA 239

Query: 241 GPSIIITSLFLF 252
           GPSI+  +  LF
Sbjct: 240 GPSIVCVAAVLF 251


>gi|123442632|ref|YP_001006609.1| high-affinity zinc transporter membrane component [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122089593|emb|CAL12442.1| high-affinity zinc uptake system membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 261

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  MTMLLALILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DI LI     + + IL   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +
Sbjct: 123 TLSDIWLIAAGVVVVLGILCWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPAAAARRFARTPEQMAGIAIGIGIIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +FILS   K 
Sbjct: 243 VVLCAALIFILSLSQKA 259


>gi|163746729|ref|ZP_02154086.1| ABC-3 [Oceanibulbus indolifex HEL-45]
 gi|161379843|gb|EDQ04255.1| ABC-3 [Oceanibulbus indolifex HEL-45]
          Length = 264

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 172/255 (67%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +G+G+ L+  PLGCF+IW+R+AYFGD  +H+ALLGVAL+L   LP+T  
Sbjct: 1   MLDDFILRAALAGLGVALAAAPLGCFVIWRRMAYFGDATSHAALLGVALALATDLPITAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++A + +LV+  +     +S+DA+LGV+ HS ++L LV +S +     DL+S+LFG+I
Sbjct: 61  VLLVALVMALVISTLSGRN-VSADALLGVMAHSALALGLVAVSLLPGQRVDLSSYLFGEI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+ +IWG      ++L   W  LLA T+N +LA+A G  P++ +LI  +  ++M
Sbjct: 120 LAVTRFDLAVIWGGAVAVALLLAWRWSALLAATLNPDLAQASGGNPKREQLILTLALAIM 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  LI ++LI+P  TAR F+ +PE MAI A  +G L  + GL  SL FDTP+
Sbjct: 180 VAVAIKVVGALLIAAMLIIPAATARPFARTPETMAIWAMGLGALAALGGLMASLEFDTPT 239

Query: 241 GPSIIITSLFLFILS 255
           GPSI+  +  LF LS
Sbjct: 240 GPSIVSIAAGLFALS 254


>gi|303249803|ref|ZP_07336007.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307251992|ref|ZP_07533893.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651370|gb|EFL81522.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306860684|gb|EFM92696.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 261

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 171/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I G G L I  +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 DFNDVIFI-GAGTLFIAGVLGYFWKKLLSITISPELAQIEGLNVVRLRLLLMLLTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A I  I  I  GL  S   DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSIFSITGGLLFSAWKDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +F+LS F K+
Sbjct: 242 SVVVCAGAIFLLSLFRKE 259


>gi|32034564|ref|ZP_00134720.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207923|ref|YP_001053148.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae L20]
 gi|165975899|ref|YP_001651492.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303252683|ref|ZP_07338846.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307245273|ref|ZP_07527364.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247444|ref|ZP_07529490.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249663|ref|ZP_07531649.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307254222|ref|ZP_07536066.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256491|ref|ZP_07538272.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258685|ref|ZP_07540420.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260916|ref|ZP_07542602.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126096715|gb|ABN73543.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|165876000|gb|ABY69048.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302648651|gb|EFL78844.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306853917|gb|EFM86131.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856060|gb|EFM88217.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858361|gb|EFM90431.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306862821|gb|EFM94771.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864901|gb|EFM96803.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867342|gb|EFM99195.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869483|gb|EFN01274.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 261

 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 171/258 (66%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D++ I G G L I  +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 DFNDVVFI-GAGTLFIAGVLGYFWKKLLSITISPELAQIEGLNVVRLRLLLMLLTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A I  I  I  GL  S   DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSIFSITGGLLFSAWKDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S+++ +  +F+LS F K+
Sbjct: 242 SVVVCAGAIFLLSLFRKE 259


>gi|118602716|ref|YP_903931.1| ABC-3 protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567655|gb|ABL02460.1| ABC-3 protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 262

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 172/259 (66%), Gaps = 1/259 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + IGI +  G LGCF+IW+R++YF ++I+HSALLGV+L L   L +   + 
Sbjct: 2   ENFIFRAVLAAIGISIIAGSLGCFVIWKRMSYFSESISHSALLGVSLGLASGLSVHFSLV 61

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++  + +++++ +Q+ + LS+DAILG+ +H  +SL +++LSF+   N D  S LFGDIL+
Sbjct: 62  IVGVIFAILVVILQRRQFLSNDAILGIFSHIALSLGIIVLSFIGNTNMDYFSLLFGDILS 121

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DI+ ++ I  +  ++L   W+ LL  T+N ELA A+G+  +  +L+F+++ +L +S
Sbjct: 122 ITNADIIWVYVILIVLGLLLIIFWQRLLLLTLNEELAVAQGLNRDFYQLLFMLMIALAVS 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS++ +G+ LITSLLI+P   AR F+ +P  M   + I+ ++ + +GL  S+ +D  +GP
Sbjct: 182 VSVQIVGVLLITSLLIIPPAVARVFANTPSGMVFQSVIVSMVAVALGLGTSMAYDLATGP 241

Query: 243 SIIITSLFLFILS-FFYKK 260
           +I+I    LFILS F YK+
Sbjct: 242 AIVIALGGLFILSQFMYKR 260


>gi|238788517|ref|ZP_04632310.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           frederiksenii ATCC 33641]
 gi|238723430|gb|EEQ15077.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           frederiksenii ATCC 33641]
          Length = 257

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 170/250 (68%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  + +L
Sbjct: 6   LAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIVMTMVLAL 65

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI L
Sbjct: 66  ILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIWL 125

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + + +L   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +S+KF+G 
Sbjct: 126 IAAGVVVVLGVLCWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGA 185

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S ++DTP+GPS+++ +  
Sbjct: 186 LIITSLLIIPAAAARRFARTPEQMAGIAIGIGIIAVTGGLTCSALYDTPAGPSVVLCAAV 245

Query: 251 LFILSFFYKK 260
           +F+LS   K 
Sbjct: 246 MFVLSLSQKA 255


>gi|83951714|ref|ZP_00960446.1| high-affinity zinc uptake system membrane protein ZnuB [Roseovarius
           nubinhibens ISM]
 gi|83836720|gb|EAP76017.1| high-affinity zinc uptake system membrane protein ZnuB [Roseovarius
           nubinhibens ISM]
          Length = 267

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 168/258 (65%), Gaps = 3/258 (1%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F IRA  + +G+ L+  PLGCF++W+R+AYFGD  +H+A+LGVALSL   LP+     
Sbjct: 5   DDFLIRAALAAVGVALAAAPLGCFVVWRRMAYFGDATSHAAILGVALSLALSLPIFAGAL 64

Query: 63  MIATLTSLVLLQI-QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +A + ++ +  + Q+  A+  D +LGV+ HS +++ LV +SF+  V  DL ++LFG+IL
Sbjct: 65  AVALIMAVAITMLSQRGHAM--DTLLGVMAHSALAVGLVAVSFLDGVRIDLMAYLFGEIL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  D+L+IW    L + +L   W  LL  T+N +LA A G+ P + + +  +  +L++
Sbjct: 123 AVSRLDLLVIWTGAALVLALLSWRWSALLTATLNTDLAHAAGVNPAREQAVLTLALALVV 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+IK +G+ LI +LLI+P  TAR  +T+PE MA+ A  IG L  + GL  S  +DTP+G
Sbjct: 183 AVAIKVVGVLLIAALLIIPAATARPLATTPERMAVAAAAIGALSGLAGLGLSYHYDTPAG 242

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I+  +  LF+LS   +
Sbjct: 243 PTIVCVAAGLFLLSTLLR 260


>gi|238919504|ref|YP_002933019.1| high-affinity zinc transporter membrane component [Edwardsiella
           ictaluri 93-146]
 gi|238869073|gb|ACR68784.1| high-affinity zinc uptake system membrane protein ZnuB
           [Edwardsiella ictaluri 93-146]
          Length = 261

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/235 (39%), Positives = 157/235 (66%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F++W+R++YFGDT+AH++LLGVA  L+ ++     +  +  L + +L+ +++   L  D 
Sbjct: 25  FVVWRRMSYFGDTLAHASLLGVAFGLLLEVNPFYTVIAVTLLLACMLVWLERRPQLGIDT 84

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKI 145
           +LG++ HS +SL LV+++ M  V  DL ++LFGD+LAV   D++ I     L + +L   
Sbjct: 85  LLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLAVTYRDVMTIAVGVVLVLALLLWQ 144

Query: 146 WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTAR 205
           W+ LL+ T++ ELA  +G+   ++KL+ ++ T+L I +++KF+G  +ITSLLI+P  TAR
Sbjct: 145 WRALLSMTISPELAHVDGIALGRVKLLLMLTTALTIGLAMKFVGALIITSLLIIPAATAR 204

Query: 206 RFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           RF+ +PE MA  A ++G+L I  GL  S  +DTP+GPS+++ +  LFILS   ++
Sbjct: 205 RFARTPEQMAAGAVLVGLLAISGGLAFSAWYDTPAGPSVVLGAALLFILSLGRRQ 259


>gi|238762967|ref|ZP_04623934.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           kristensenii ATCC 33638]
 gi|238698725|gb|EEP91475.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           kristensenii ATCC 33638]
          Length = 257

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/250 (39%), Positives = 169/250 (67%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSL 70
            +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + ++  + +L
Sbjct: 6   LAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIVMTMVLAL 65

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           +L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  +DI L
Sbjct: 66  ILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTLSDIGL 125

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + + IL   W+ LL+ T++ ELA  +G+  E+++++ +++T+L I +S+KF+G 
Sbjct: 126 IAAGVVVVLGILCWQWRSLLSMTISPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGA 185

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS+++ +  
Sbjct: 186 LIITSLLIIPAAAARRFARTPEQMAAIAIAIGIVAVTGGLTFSAFYDTPAGPSVVLCAAV 245

Query: 251 LFILSFFYKK 260
           +FILS   K 
Sbjct: 246 MFILSLSQKA 255


>gi|269138792|ref|YP_003295493.1| high-affinity zinc transporter membrane component [Edwardsiella
           tarda EIB202]
 gi|267984453|gb|ACY84282.1| high-affinity zinc transporter membrane component [Edwardsiella
           tarda EIB202]
 gi|304558784|gb|ADM41448.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Edwardsiella tarda FL6-60]
          Length = 261

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/235 (39%), Positives = 156/235 (66%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  L + +L+ +++   L  D 
Sbjct: 25  FVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIAVTLLLACMLVWLERRPQLGIDT 84

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKI 145
           +LG++ HS +SL LV+++ M  V  DL ++LFGD+LAV   D+++I     L + +L   
Sbjct: 85  LLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLAVTYQDVVMIALGVALVLALLLWQ 144

Query: 146 WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTAR 205
           W+ LL+ T++ ELA  +G+   ++KL+ ++ T+L I +++KF+G  +ITSLLI+P  TAR
Sbjct: 145 WRALLSMTISPELAHVDGVALGRVKLLLMLTTALTIGLAMKFVGALIITSLLIIPAATAR 204

Query: 206 RFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           RF+ +PE MA  A + G+L I  GL  S  +DTP+GPS+++ +  LFILS   ++
Sbjct: 205 RFARTPEQMAAGAVLAGLLAISGGLAFSAWYDTPAGPSVVLCAALLFILSLGRRQ 259


>gi|323493312|ref|ZP_08098435.1| zinc ABC transporter permease protein ZnuB [Vibrio brasiliensis LMG
           20546]
 gi|323312398|gb|EGA65539.1| zinc ABC transporter permease protein ZnuB [Vibrio brasiliensis LMG
           20546]
          Length = 261

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 179/252 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL L+  + L + + +
Sbjct: 3   EFLLPSVLAGLGIAAIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGLLLDINLYLALTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +Q+ + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQRQQLVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D++ I+    +   +L   W+ LL+TTVN +LA  EG   + ++L+ +++  L+I++
Sbjct: 123 TSQDLVYIYIGVVVVSAVLMIFWRSLLSTTVNEDLAAVEGHNVDLMRLVLMLLVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TARRF+ +PE MA+ A++IG + +++GL  S  +DTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARRFARAPEQMALFASLIGAVAVLMGLSLSWHYDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           ++I++  +F+LS
Sbjct: 243 VVISATAMFMLS 254


>gi|126740894|ref|ZP_01756578.1| ABC-3 [Roseobacter sp. SK209-2-6]
 gi|126717994|gb|EBA14712.1| ABC-3 [Roseobacter sp. SK209-2-6]
          Length = 234

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 146/233 (62%), Gaps = 11/233 (4%)

Query: 32  IAYFGDTIAHSALLGVALSLIFQLP-----LTICIFMIATLTSLVLLQIQKNEALSSDAI 86
           +AYFGD  AH+++LGVALSL FQ P     L + + M   ++SL           + D +
Sbjct: 1   MAYFGDATAHASILGVALSLAFQAPIFAGVLVVSLLMATAISSL------SGRGFAMDTL 54

Query: 87  LGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIW 146
           LGV+ HS ++  LV +SF+  V  DL ++LFGDILAV+  D+L+IWG   L I++L+  W
Sbjct: 55  LGVMAHSALAFGLVAVSFLDGVRIDLMAYLFGDILAVSRMDLLIIWGGACLVIVLLWFRW 114

Query: 147 KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARR 206
             LL  T++ +LA A G+ P++ +L   +  +L+++V+IK +G+ LI+++L++P   AR 
Sbjct: 115 SSLLTATLSEDLAHAAGINPKREQLALTICLALVVAVAIKVVGVLLISAMLLIPAAAART 174

Query: 207 FSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
           F+ +PE MA  A +IG L  + GL+ S   DTP+GP+I+  +  LF LS   K
Sbjct: 175 FAKTPETMAATAVVIGALAALGGLHLSFQLDTPTGPTIVCFAAVLFALSSIGK 227


>gi|297517891|ref|ZP_06936277.1| high-affinity zinc transporter membrane component [Escherichia coli
           OP50]
          Length = 228

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 153/227 (67%), Gaps = 2/227 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIG 229
           V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  G
Sbjct: 182 VAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGG 228


>gi|90019706|ref|YP_525533.1| zinc transport system permease [Saccharophagus degradans 2-40]
 gi|89949306|gb|ABD79321.1| ABC-3 [Saccharophagus degradans 2-40]
          Length = 262

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 165/252 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F + +L +G  I L+ GPLG F++W+R+AYFGDT+AHSALLGVA  ++  +   I I +
Sbjct: 3   SFLLLSLIAGSVIALTAGPLGAFVVWRRMAYFGDTLAHSALLGVAFGIVLNISPVIGIVL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            ++  +L+L  +QK+  L++D++LG+++HS ++L LV +        DL  +LFGD+L V
Sbjct: 63  ASSAIALLLWWMQKSTTLANDSLLGILSHSALALGLVCVGLFSNSRIDLYGYLFGDLLTV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  DI ++     + + ++   W+ LL   ++  LAK EG+  EK++L+ +++ +L+I++
Sbjct: 123 NMQDIAVVCAAASVILGLVCFFWRSLLMIAIDESLAKVEGLAVEKLRLMLMLLMALLIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI LIT+LLI+P   AR+ ++SPE MAI A  IG+  + +GL  S   DT  GPS
Sbjct: 183 AMKAVGILLITALLIIPPAAARKLTSSPEAMAICAACIGVASVWLGLAASYFLDTAPGPS 242

Query: 244 IIITSLFLFILS 255
           I+I S   FI++
Sbjct: 243 IVIASTIAFIIT 254


>gi|313496488|gb|ADR57854.1| ZnuB [Pseudomonas putida BIRD-1]
          Length = 243

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/226 (41%), Positives = 155/226 (68%)

Query: 35  FGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHST 94
           FGDT++H+ALLGVAL     +   + + +   L +++L+ +Q+ + L+SD +LG++  ST
Sbjct: 17  FGDTLSHAALLGVALGFALDVSPALAVTVGCLLLAILLVTLQQRQPLASDTLLGILAPST 76

Query: 95  ISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTV 154
           +SL LV+LSFM  V  DL ++LFGD+LA++T+D+  I G   L +++L  +W+PLLA TV
Sbjct: 77  LSLGLVVLSFMHDVRIDLMAYLFGDLLAISTSDLAWILGGSALVLLLLAVLWRPLLAVTV 136

Query: 155 NYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENM 214
           + ELA  EG+    ++L  +++ +++I+V++K +G+ LITSLLI+P   A+R + SPE M
Sbjct: 137 HEELAMVEGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQM 196

Query: 215 AILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           A+ A+++G+  +  GL  S   DTP+GPSI++ +  LF+LS    K
Sbjct: 197 ALGASLLGVTAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPK 242


>gi|294635836|ref|ZP_06714291.1| zinc uptake ABC transporter, permease protein ZnuB [Edwardsiella
           tarda ATCC 23685]
 gi|291090808|gb|EFE23369.1| zinc uptake ABC transporter, permease protein ZnuB [Edwardsiella
           tarda ATCC 23685]
          Length = 261

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 158/236 (66%), Gaps = 2/236 (0%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F++W+R++YFGDT+AH++LLGVA  L+  +     +  +  + +  L+ +++   L+ D 
Sbjct: 25  FVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIAVTLVLACALVWLERRPQLAVDT 84

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKI 145
           +LG++ HS +SL LV+++ M  V  DL ++LFGD+LAV   D++LI  IG + ++ L   
Sbjct: 85  LLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLAVTYQDVVLI-AIGVVLVLALLLW 143

Query: 146 -WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            W+ LL+ T++ +LA  +G+   + KL+ ++ T+L I +++KF+G  +ITSLLI+P  TA
Sbjct: 144 QWRALLSMTISPDLAHVDGVPLGRTKLLLMLTTALTIGLAMKFVGALIITSLLIIPAATA 203

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           RRF+ +PE MA  A ++G L I  GL  S  +DTP+GPS+++ + FLF+LS   ++
Sbjct: 204 RRFARTPEQMATGAVLVGWLAISGGLALSAWYDTPAGPSVVLCAAFLFMLSLSRRQ 259


>gi|114763037|ref|ZP_01442467.1| ABC zinc tranporter, inner membrane subunit ZnuB [Pelagibaca
           bermudensis HTCC2601]
 gi|114544361|gb|EAU47369.1| ABC zinc tranporter, inner membrane subunit ZnuB [Roseovarius sp.
           HTCC2601]
          Length = 262

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 169/253 (66%), Gaps = 3/253 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +G+G+ L+  PLGCF+ W+R+AYFGD  AH+A+LGVALSL   LP+ I 
Sbjct: 1   MLDDFLVRAALAGLGLALAAAPLGCFVAWRRMAYFGDATAHAAILGVALSLALSLPVVIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A L + ++  +  +  L+ D +LGV+ HS ++L LV ++F+  V  DL+++LFGDI
Sbjct: 61  TMVVALLMAFLVGSLT-DRGLAMDTVLGVLAHSALALGLVAVTFVPGVRLDLSAYLFGDI 119

Query: 121 LAVNTTDILLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           LAV   D+ +IW G G +  +I ++ W+ LL  TV+ +LA A G+ P + + I  +  +L
Sbjct: 120 LAVTKVDLAVIWAGAGAVIALIAWR-WQALLTATVSPDLAYASGLDPRREQRILTLALAL 178

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            ++V+IK +G  L++++L++P   AR  + SPE MA++A  IG +  + GL+G+ + DTP
Sbjct: 179 TVAVAIKVVGALLVSAMLLIPAAAARPLARSPEGMALIAAGIGAMAALSGLWGAFLLDTP 238

Query: 240 SGPSIIITSLFLF 252
           +GPS+I  +  LF
Sbjct: 239 AGPSMISAAALLF 251


>gi|92112325|ref|YP_572253.1| hypothetical protein Csal_0190 [Chromohalobacter salexigens DSM
           3043]
 gi|91795415|gb|ABE57554.1| ABC-3 protein [Chromohalobacter salexigens DSM 3043]
          Length = 275

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 163/249 (65%), Gaps = 11/249 (4%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSL-----IFQLP 56
           +++F +RA  +G+G+ L+  PLGC ++W+R+A+FGD  AH+A+LGVAL+L     IF   
Sbjct: 3   FDDFLVRATLAGVGVALAAAPLGCLVVWRRMAFFGDATAHAAILGVALALLLSTSIFAGV 62

Query: 57  LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFL 116
           L + + M ATL SL+       +  + D +LGV+ HS+++L LV +SF+  V  DL ++L
Sbjct: 63  LVVSLLM-ATLVSLL-----SGKGYAMDTLLGVMAHSSLALGLVAVSFVSGVRIDLMAYL 116

Query: 117 FGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMI 176
           FGDILAV   D+ +IW    L + ++   W  LL  T+N +LA A G+ P++ +LI  + 
Sbjct: 117 FGDILAVGKGDLAIIWSGAALVVALMGWRWSRLLTATLNADLAYASGIDPQREQLILTLS 176

Query: 177 TSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF 236
            +++++V++K +GI LI +LLI+P  TAR FS +PE M + A ++G++  + GL  +   
Sbjct: 177 LAIVVAVALKVVGILLIAALLIIPAATARTFSRTPETMVVAAALVGMMAAVGGLQTAYWL 236

Query: 237 DTPSGPSII 245
           DTP+GP+I+
Sbjct: 237 DTPTGPTIV 245


>gi|84502807|ref|ZP_01000920.1| ABC zinc transporter, inner membrane subunit ZnuB [Oceanicola
           batsensis HTCC2597]
 gi|84388790|gb|EAQ01660.1| ABC zinc transporter, inner membrane subunit ZnuB [Oceanicola
           batsensis HTCC2597]
          Length = 268

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 161/245 (65%), Gaps = 1/245 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +++EF IRA  +G+G+ L+   LG F++W+R+AYFGD +AH+A+LGVALSL+ +LP+ + 
Sbjct: 4   LFSEFMIRAALAGLGVALAAPWLGVFVVWRRMAYFGDAVAHAAVLGVALSLMLELPVVLG 63

Query: 61  IFMIATLTSLVLLQIQ-KNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           +  +A + +L +  ++     + +D++LGV++H  ++  L+ +SF+     +L ++LFGD
Sbjct: 64  VMGVAVIVALAIAAMETPRGGIGADSLLGVLSHGALAFGLIAVSFLPGARLNLEAYLFGD 123

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV+  D+ +IWG     + ++   W+ LL +TVN +LA + GM P+  + I  +  +L
Sbjct: 124 ILAVSWGDVAVIWGGAAAIVGVIAWRWRALLTSTVNPDLAWSSGMNPDHDRRILTLALAL 183

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +++++IK +G  LIT+LLI+P   AR  S SPE M +    IG +  + GL  S  FDTP
Sbjct: 184 LVALAIKVVGALLITALLIIPAAAARPLSRSPEVMLVAGMGIGAVSALCGLGLSYEFDTP 243

Query: 240 SGPSI 244
           +GPSI
Sbjct: 244 AGPSI 248


>gi|15616926|ref|NP_240139.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. APS (Acyrthosiphon pisum)]
 gi|11387288|sp|P57402|ZNUB_BUCAI RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|25316132|pir||A84967 hypothetical protein znuB [imported] - Buchnera sp. (strain APS)
 gi|10038991|dbj|BAB13025.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. APS (Acyrthosiphon pisum)]
          Length = 262

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 168/258 (65%), Gaps = 1/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +G+ + L+TGPLG FI+W+R++ FGDT++HS+LLG+ALS+ F +     I +
Sbjct: 3   ELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNINSFYAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
           + +  +++L  +++   +S D +L +I+HS++SL +V +S +      ++T++LFGD+L+
Sbjct: 63  LMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDLLS 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I     L + IL   W  +L++T+N EL++ +G+     +L  +++T+  I+
Sbjct: 123 VTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVLYARLTIMLMTAFTIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++IKF+G  LITSLLI+P  TA+ FS SPE M I+A I+ IL +  G+  S+ ++TP+ P
Sbjct: 183 IAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPASP 242

Query: 243 SIIITSLFLFILSFFYKK 260
           SI++ S FL ++S   K 
Sbjct: 243 SIVLCSSFLCLISNIKKH 260


>gi|219682235|ref|YP_002468619.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219621968|gb|ACL30124.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|311086055|gb|ADP66137.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. LL01 (Acyrthosiphon pisum)]
 gi|311086628|gb|ADP66709.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. TLW03 (Acyrthosiphon pisum)]
 gi|311087211|gb|ADP67291.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. JF99 (Acyrthosiphon pisum)]
          Length = 262

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 168/258 (65%), Gaps = 1/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +G+ + L+TGPLG FI+W+R++ FGDT++HS+LLG+ALS+ F +     I +
Sbjct: 3   ELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNVNSFYAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
           + +  +++L  +++   +S D +L +I+HS++SL +V +S +      ++T++LFGD+L+
Sbjct: 63  LMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDLLS 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I     L + IL   W  +L++T+N EL++ +G+     +L  +++T+  I+
Sbjct: 123 VTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVLYARLTIMLMTAFTIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++IKF+G  LITSLLI+P  TA+ FS SPE M I+A I+ IL +  G+  S+ ++TP+ P
Sbjct: 183 IAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPASP 242

Query: 243 SIIITSLFLFILSFFYKK 260
           SI++ S FL ++S   K 
Sbjct: 243 SIVLCSSFLCLISNIKKH 260


>gi|312115764|ref|YP_004013360.1| ABC transporter [Rhodomicrobium vannielii ATCC 17100]
 gi|311220893|gb|ADP72261.1| ABC-3 protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 265

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 143/220 (65%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSD 84
           CF++W+R+AYFG+T+A+S LLGVAL  +  + LT+ + + A   +L+L  +Q   A+  D
Sbjct: 25  CFVVWRRMAYFGETVAYSGLLGVALGFLLGVDLTLGVIVTAIAMALLLSGLQAQRAIPYD 84

Query: 85  AILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFK 144
            +LG++ H  ++  L+  +F+     DL  +LFGDILAV+  D+  IWG     +  L  
Sbjct: 85  TLLGILAHVALASGLIAANFVSGARLDLMGYLFGDILAVSRADVFWIWGGAAAVLAALTL 144

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
           +W+PLLA TV+ ELA AEG++  + +  FI++ ++ +++++K IGI LITSL+I P   A
Sbjct: 145 LWRPLLALTVHEELAAAEGVRVRRTETAFILLIAVTVALAMKVIGILLITSLMIFPAAVA 204

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           R F+ +PE MA+LA +   L +  GL+ SL  DT +GPSI
Sbjct: 205 RPFAKTPEQMAVLAALAAALAVAGGLFLSLKLDTAAGPSI 244


>gi|219681680|ref|YP_002468066.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|257471371|ref|ZP_05635370.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|219624523|gb|ACL30678.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
          Length = 262

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 168/258 (65%), Gaps = 1/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +G+ + L+TGPLG FI+W+R++ FGDT++HS+LLG+ALS+ F +     I +
Sbjct: 3   ELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNINSFYAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
           + +  +++L  +++   +S D +L +I+HS++SL +V +S +      ++T++LFGD+L+
Sbjct: 63  LMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDLLS 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I     L + IL   W  +L++T+N EL++ +G+     +L  +++T+  I+
Sbjct: 123 VTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVFYARLTIMLMTAFTIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++IKF+G  LITSLLI+P  TA+ FS SPE M I+A I+ IL +  G+  S+ ++TP+ P
Sbjct: 183 IAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPASP 242

Query: 243 SIIITSLFLFILSFFYKK 260
           SI++ S FL ++S   K 
Sbjct: 243 SIVLCSSFLCLISNIKKH 260


>gi|255745174|ref|ZP_05419123.1| zinc ABC transporter permease protein ZnuB [Vibrio cholera CIRS
           101]
 gi|262155968|ref|ZP_06029089.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae INDRE
           91/1]
 gi|262167702|ref|ZP_06035405.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae RC27]
 gi|255737004|gb|EET92400.1| zinc ABC transporter permease protein ZnuB [Vibrio cholera CIRS
           101]
 gi|262023907|gb|EEY42605.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae RC27]
 gi|262030279|gb|EEY48922.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae INDRE
           91/1]
          Length = 230

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 160/229 (69%), Gaps = 2/229 (0%)

Query: 32  IAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVIT 91
           +AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ +QK + +++D +LG++ 
Sbjct: 1   MAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVAMQKQKLIATDTLLGIMA 60

Query: 92  HSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI-MILFKIWKPLL 150
           HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  G + + +I++ +W+PLL
Sbjct: 61  HSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-FGVVTVSLIVYLLWQPLL 119

Query: 151 ATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTS 210
           +T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++ SLLI+P  TARR S +
Sbjct: 120 STSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIMGSLLIIPAATARRLSRT 179

Query: 211 PENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
           PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+L+ F +
Sbjct: 180 PEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFVLTQFKR 228


>gi|262191355|ref|ZP_06049546.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae CT
           5369-93]
 gi|262032774|gb|EEY51321.1| zinc ABC transporter permease protein ZnuB [Vibrio cholerae CT
           5369-93]
          Length = 230

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 160/229 (69%), Gaps = 2/229 (0%)

Query: 32  IAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVIT 91
           +AYFGDT+AH++LLG+AL  +  + L + + +     + +L+ +QK + +++D +LG++ 
Sbjct: 1   MAYFGDTLAHASLLGLALGFLLDINLYLALLVCCLGMAAILVAMQKQKLIATDTLLGIMA 60

Query: 92  HSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI-MILFKIWKPLL 150
           HS +SL ++ +SF+  V  DL S+LFGD+LA++ +D+  IW  G + + +I++ +W+PLL
Sbjct: 61  HSALSLGMIAVSFLDNVRIDLMSYLFGDLLAISPSDLTFIW-FGVVTVSLIVYLLWQPLL 119

Query: 151 ATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTS 210
           +T+VN ELA  EG   + ++LI +++  L+I+V +KF+G  ++ SLLI+P  TARR S +
Sbjct: 120 STSVNEELAFVEGTNTDLMRLILMLLIGLVIAVGMKFVGALIMGSLLIIPAATARRLSRT 179

Query: 211 PENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
           PE MA  A  +G+L +I GL  S  FDTP+GPS+++++  LF+L+ F +
Sbjct: 180 PEAMAFWAIGLGVLSVIGGLALSWHFDTPAGPSVVVSAAVLFVLTQFKR 228


>gi|311087732|gb|ADP67811.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. JF98 (Acyrthosiphon pisum)]
          Length = 262

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 167/258 (64%), Gaps = 1/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +G+ + L+TGPLG FI+W+R++ FGDT++HS+LLG+ALS+ F +     I +
Sbjct: 3   ELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNVNSFYAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
           + +  +++L  +++   +S D +L +I+HS++SL +V +S +      ++T++LFGD+L+
Sbjct: 63  LMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDLLS 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I     L + IL   W  +L++T+N EL++ +G+     +L  +++T+  I+
Sbjct: 123 VTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVLYARLTIMLMTAFTIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++IKF+G  LITSLLI+P  TA+ FS SPE M I+A I+ IL +  G+  S+ ++TP+ P
Sbjct: 183 IAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPASP 242

Query: 243 SIIITSLFLFILSFFYKK 260
           SI++ S FL + S   K 
Sbjct: 243 SIVLCSSFLCLTSNIKKH 260


>gi|86138162|ref|ZP_01056737.1| high-affinity zinc uptake system membrane protein ZnuB [Roseobacter
           sp. MED193]
 gi|85825189|gb|EAQ45389.1| high-affinity zinc uptake system membrane protein ZnuB [Roseobacter
           sp. MED193]
          Length = 270

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 171/255 (67%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + + F +RA  +G G+ ++  PLGCF++W+R+AYFGD  AH+++LGVAL+L FQ+P+   
Sbjct: 4   LLDSFLLRAALAGTGVAVAAAPLGCFVVWRRMAYFGDATAHASILGVALALGFQVPIFAG 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + +IA L +  +  +      + D +LGV+ HS+++  LV +SF++ +  DL ++LFGDI
Sbjct: 64  VLIIALLMATAVSGL-SGRGFAMDTLLGVLAHSSLAFGLVAVSFLQGIRIDLMAYLFGDI 122

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG   L +++L+  W  LL  T++ +LA A G+ P++ +L+  +  +L+
Sbjct: 123 LAVSRIDLAVIWGGASLVLLLLWARWSALLTATLSPDLAYAAGINPKREQLVLTIALALV 182

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI++LL++P   AR F+ +PE MA +A  IG L  + GL  S + DTP+
Sbjct: 183 VAVAIKVVGVLLISALLLVPAAAARPFAATPERMAAIAAGIGALSALAGLQLSFMLDTPT 242

Query: 241 GPSIIITSLFLFILS 255
           GP+I+  +  LF L+
Sbjct: 243 GPTIVCVAAVLFALT 257


>gi|260425275|ref|ZP_05779255.1| high-affinity zinc uptake system membrane protein ZnuB [Citreicella
           sp. SE45]
 gi|260423215|gb|EEX16465.1| high-affinity zinc uptake system membrane protein ZnuB [Citreicella
           sp. SE45]
          Length = 262

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 166/260 (63%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +G+G+ ++  PLGCF+ W+R+AYFGD  AH+A+LGVALSL   LP+ + 
Sbjct: 1   MLDDFLIRAALAGLGLAIAAAPLGCFVAWRRMAYFGDATAHAAILGVALSLALSLPVVVG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +  L    L+       L+ D +LGV+ HS ++  LV ++F+  V  DL+++LFGDI
Sbjct: 61  TLAV-VLVMAALVYALSERGLAMDTVLGVLAHSALAFGLVAVTFVPGVRLDLSAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ +D+ +IW      + ++   W+ LL  TV+ +LA A G+ P +   I  +  +++
Sbjct: 120 LAVSKSDLAVIWTGAAAVVALVVWRWQALLTATVSPDLAWASGLDPRRESRILTLALAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  L++++L++P   AR  + SPE+MA++A  I +L  + GL+G+ +FDTP+
Sbjct: 180 VAVAIKVVGALLVSAMLLIPAAAARPLARSPESMAVIAAGIAVLAALGGLWGAFLFDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPS++  +  +F  +   ++
Sbjct: 240 GPSMVCAAAVIFAATTLVQR 259


>gi|110833018|ref|YP_691877.1| zinc ABC transporter permease [Alcanivorax borkumensis SK2]
 gi|110646129|emb|CAL15605.1| zinc ABC transporter permease protein [Alcanivorax borkumensis SK2]
          Length = 282

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 162/244 (66%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           + L +GP+G F++W+R+A+FGDT+AH ALLG AL+L   + L + +  +    +  L  +
Sbjct: 37  VALVSGPMGAFVVWRRMAFFGDTLAHGALLGAALALALDISLYVAVVAVCLGLAAALSGL 96

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           Q+   L+ D +LG++ H+T++L ++ +S    +  DL ++LFGD+LAV   D+  +W   
Sbjct: 97  QRQRQLAGDTLLGIVAHTTLALGVIAISLQTGIQVDLFAYLFGDLLAVGWQDVTGLWVGA 156

Query: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITS 195
            + +M++   W+ LL+ TVN ELA+ EG+  ++ +L+ +++ +L+I+ +I+ +G+ LITS
Sbjct: 157 MVILMLMLWQWRALLSITVNEELAQVEGIAVQRTRLLLMLLLALLIAGAIRTVGVLLITS 216

Query: 196 LLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           LL++P  +ARR + +P  MA +A+++G L +++GL  S   +TP GPSI++ +  LF+L+
Sbjct: 217 LLVIPAASARRLTHTPAQMAAVASVLGTLSVLVGLAVSWYANTPVGPSIVVAASSLFVLT 276

Query: 256 FFYK 259
              +
Sbjct: 277 LLRR 280


>gi|255264470|ref|ZP_05343812.1| high-affinity zinc uptake system membrane protein ZnuB
           [Thalassiobium sp. R2A62]
 gi|255106805|gb|EET49479.1| high-affinity zinc uptake system membrane protein ZnuB
           [Thalassiobium sp. R2A62]
          Length = 265

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 169/261 (64%), Gaps = 13/261 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSL-----IFQL 55
           M+++F  RA+ +G+G+ ++  PLGCF++W+R+AYFGD  A++A+LGVALSL     +F  
Sbjct: 1   MFDDFQFRAILAGVGVAIAAAPLGCFVVWRRMAYFGDATANAAILGVALSLALSVSVFAG 60

Query: 56  PLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            LTI  FM  T+ +L           + D +LGV+ H  ++  LV +SF++ V  DL ++
Sbjct: 61  ALTIAFFMALTVNAL------SGRGFAMDTLLGVMAHLALAFGLVAVSFIQGVRLDLMAY 114

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIW-KPLLATTVNYELAKAEGMQPEKIKLIFI 174
           LFGDILAV   D+ +IWG G L++  L   W   LL  T+N +LA A G  P++ +LI  
Sbjct: 115 LFGDILAVGRVDLAVIWG-GALSVFALLAWWWTALLTATLNPDLAHASGFNPKREQLILT 173

Query: 175 MITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL 234
           +  +++++V+IK +G+ LI +LLI+P   AR  STSPE MA  A +IG+   I GL+ SL
Sbjct: 174 LCLAVVVAVAIKVVGVLLIAALLIIPAAAARPISTSPERMAATAGVIGVGSAIGGLHMSL 233

Query: 235 IFDTPSGPSIIITSLFLFILS 255
            +DTP+GPSI+  +  +FI++
Sbjct: 234 WYDTPAGPSIVCVATVMFIVT 254


>gi|42520242|ref|NP_966157.1| cation ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|225630218|ref|YP_002727009.1| cation ABC transporter, permease protein [Wolbachia sp. wRi]
 gi|42409980|gb|AAS14091.1| cation ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|225592199|gb|ACN95218.1| cation ABC transporter, permease protein [Wolbachia sp. wRi]
          Length = 266

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 165/257 (64%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FFI +L + + I L TG LG F+IWQR++Y GD+++HS+LLGVAL+LIF++  ++ I 
Sbjct: 4   QDFFINSLVAVVVISLVTGALGSFMIWQRLSYLGDSLSHSSLLGVALALIFKISPSLSIM 63

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +IA +T  +LL +  N   S+D IL ++T+  +S +L+++SF+   N  + S LFGDIL 
Sbjct: 64  LIA-ITFAILLSLNFNRLYSADTILNIVTNVVLSSSLILMSFLPSGNNSIISSLFGDILT 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ +DI+LI+    +  +IL   W+  L  ++N +LA  E +    ++L F++  ++ I+
Sbjct: 123 LDQSDIVLIFLTSAVVTLILIFRWRYWLMISINQDLAVVEKINVTFVRLEFLITLAIFIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++ + IGI LI + L++P  +AR  S +P  M I+AT+  ++  I GL  S  FD  +GP
Sbjct: 183 IAAQLIGILLIAAFLLIPAASARLISKTPMQMIIVATVFSVISGISGLMLSASFDLLTGP 242

Query: 243 SIIITSLFLFILSFFYK 259
           +II+ +    I+++F +
Sbjct: 243 AIILVAAVYLIIAYFIR 259


>gi|225677393|ref|ZP_03788361.1| cation ABC transporter, permease protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590569|gb|EEH11828.1| cation ABC transporter, permease protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 266

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 165/257 (64%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FFI +L + + I L TG LG F+IWQR++Y GD+++HS+LLGVAL+LIF++  ++ I 
Sbjct: 4   QDFFINSLVAVVVISLVTGALGSFMIWQRLSYLGDSLSHSSLLGVALALIFKISPSLSIM 63

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +IA +T  +LL +  N   S+D IL ++T+  +S +L+++SF+   N  + S LFGDIL 
Sbjct: 64  LIA-ITFAILLSLNFNRLYSADTILNIVTNVVLSSSLILMSFLPSGNNSIISSLFGDILT 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ +DI+LI+    +  +IL   W+  L  ++N +LA  E +    ++L F++  ++ I+
Sbjct: 123 LDQSDIVLIFLTSAVVTLILIFRWRYWLMISINQDLAVVEKINVTFVRLEFLITLAIFIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++ + IGI LI + L++P  +AR  S +P  M I+AT+  ++  I GL  S  FD  +GP
Sbjct: 183 IAAQLIGILLIAAFLLIPAASARLISKTPMQMIIVATVFSVISGISGLMLSASFDLLTGP 242

Query: 243 SIIITSLFLFILSFFYK 259
           +II+ +    I+++F +
Sbjct: 243 AIILVAAVYLIIAYFIR 259


>gi|84515277|ref|ZP_01002639.1| zinc ABC transporter, permease protein [Loktanella vestfoldensis
           SKA53]
 gi|84510560|gb|EAQ07015.1| zinc ABC transporter, permease protein [Loktanella vestfoldensis
           SKA53]
          Length = 265

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 169/260 (65%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  + +G  ++ G LGCF++W+R+AYFGD  AH+A+LGVAL+L+F   +T+ 
Sbjct: 1   MLDDFLLRAALAAVGTAVAAGLLGCFVVWRRMAYFGDATAHAAVLGVALALLFGTSITLG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++A L   VL+     +A++ D ILGV+ H  ++L LV ++ +     DL ++LFGD+
Sbjct: 61  VGIVA-LCMAVLIHSLSGQAVAVDTILGVLAHGALALGLVAVTLVPGQRIDLDAYLFGDV 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V   D+ +IWG G L + +L+  W  +L  T+N +LA A G+ P + +LI  ++ + +
Sbjct: 120 LSVTRADLAVIWGGGVLLVGVLWWQWSAMLTATLNPDLAHAAGINPRRQQLILTVLVAAV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  LIT+LLI+P  +AR F+++PE MA  A  IG L  + GL  ++ FDT  
Sbjct: 180 VAVAIKVVGALLITALLIIPAASARSFASTPERMAFFAMAIGALSALGGLRLAVHFDTQV 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSII  ++ +F +S   K 
Sbjct: 240 GPSIICVAVLIFAVSRVGKH 259


>gi|85703670|ref|ZP_01034774.1| ABC zinc transporter, inner membrane subunit ZnuB [Roseovarius sp.
           217]
 gi|85672598|gb|EAQ27455.1| ABC zinc transporter, inner membrane subunit ZnuB [Roseovarius sp.
           217]
          Length = 270

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 166/255 (65%), Gaps = 7/255 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  +G+G+ L+  PLG F++W+R+AYFGD  AH+A+LGVA++L F    ++ 
Sbjct: 2   MLDDFMVRAALAGLGVALAAAPLGSFVVWRRMAYFGDATAHAAILGVAMALAF----SVS 57

Query: 61  IFMIATLTSLVL---LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
           +F+ A   SL++   +        + D +LGV+ HS ++  LV +SF+  V  DL ++LF
Sbjct: 58  VFVGALAMSLIMATTVSTLSGRGFAMDTMLGVLAHSALAFGLVAVSFLSGVRIDLMAYLF 117

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           GDILAV+  D+L+IWG   L + +L   W+ LL TT++ +LA + G+ P + +L+  +  
Sbjct: 118 GDILAVSRGDLLVIWGGAALVLSLLAWRWQALLTTTLSPDLAWSAGIDPRREQLVLTLAL 177

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +++++V+IK +G+ LI ++LI+P   AR  + +PE MA++AT+I     + GL  S  FD
Sbjct: 178 AVVVAVAIKVVGVLLIAAMLIVPAAAARPLAITPERMAVIATLIASTSALGGLRLSFHFD 237

Query: 238 TPSGPSIIITSLFLF 252
           TP+GP+I+  +  +F
Sbjct: 238 TPTGPTIVCVAALIF 252


>gi|33152376|ref|NP_873729.1| high-affinity zinc uptake system membrane protein [Haemophilus
           ducreyi 35000HP]
 gi|33148599|gb|AAP96118.1| high-affinity zinc uptake system membrane protein [Haemophilus
           ducreyi 35000HP]
          Length = 261

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 168/258 (65%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++   A S D +LG+I H ++SL ++ +S +  +  DL S+LFGD+LA+
Sbjct: 63  MTLLLALLLVWLEYRTAYSLDTVLGIIAHCSLSLGVITISLLDNIRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  D+L I GIG L I  +L    + LL+ T+N ELA+ EG+   +++L+ +++T+L I+
Sbjct: 123 DFNDVLFI-GIGVLIIASVLAYFGQKLLSITINPELAQIEGLNVNRLRLLLMILTALTIA 181

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A +  IL I  GL  S   DTP+GP
Sbjct: 182 LSMKFVGALIITSLLIIPSAIARRFARTPEAMVGYAILFSILSISSGLLLSSWQDTPAGP 241

Query: 243 SIIITSLFLFILSFFYKK 260
           S++  +   F+ +   ++
Sbjct: 242 SVVCCAGVFFLCALLKRE 259


>gi|32490864|ref|NP_871118.1| hypothetical protein WGLp115 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166070|dbj|BAC24261.1| yebI [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 265

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 164/257 (63%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E FI    +GI + L+ GPLG F+IW++++YFGDT++HS+LLG+++  +F++     + +
Sbjct: 3   EIFIFGWIAGILLSLAIGPLGSFLIWRKMSYFGDTLSHSSLLGISIGFVFKIDPVYSVMI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L++  I++    S D IL +I+++ +SL LVI S ++   TDL  +LFGD+L V
Sbjct: 63  TMFFITLIITYIERVYQFSIDIILNIISNTALSLGLVISSLIEEFRTDLVHYLFGDLLKV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  DI++I  I  + I+I+   W  LL  ++N EL+  +G+   KIKLI ++I SL I +
Sbjct: 123 NLNDIIMISIIISIIILIILWNWNSLLLVSINSELSYIDGINIFKIKLILMIIISLTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KFIG     +L I+P  TAR +S SPE M+I AT+  I  I  GL+ S+I++ PSGPS
Sbjct: 183 TMKFIGALTTVALFIIPAATARPYSKSPEKMSIYATLFSISSITFGLFFSVIYNIPSGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +I+ S   F +S F K 
Sbjct: 243 VILCSTIFFFISLFTKN 259


>gi|254427901|ref|ZP_05041608.1| ABC 3 transport family [Alcanivorax sp. DG881]
 gi|196194070|gb|EDX89029.1| ABC 3 transport family [Alcanivorax sp. DG881]
          Length = 260

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 160/244 (65%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           + L +GP+G F++W+R+A+FGDT+AH ALLG AL L   + L + +  +    +  L  +
Sbjct: 15  VALVSGPMGAFVVWRRMAFFGDTLAHGALLGAALGLALDISLYVAVVAVCLGLAAALSGL 74

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           Q+   L+ D +LG++ H+T++L ++ +S    +  DL ++LFGD+LAV   D++ +W   
Sbjct: 75  QRQRQLAGDTLLGIVAHTTLALGVIAISLQTGIQVDLFAYLFGDLLAVGWQDVIGLWVGA 134

Query: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITS 195
            + ++++   W+ LL+ TVN ELA+ EG+  ++ +L+ +++ +L+I+ +I+ +G+ LITS
Sbjct: 135 IVILLLMLWQWRALLSITVNEELAQVEGIAVQRTRLLLMLLLALLIAGAIRTVGVLLITS 194

Query: 196 LLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           LL++P  +ARR + +P  MA +A+++G   ++ GL  S   +TP GPSI++ +  LF+L+
Sbjct: 195 LLVIPAASARRLTHTPAQMAAVASVLGTASVLAGLAVSWFANTPVGPSIVVAASSLFVLT 254

Query: 256 FFYK 259
              K
Sbjct: 255 LLRK 258


>gi|226329886|ref|ZP_03805404.1| hypothetical protein PROPEN_03799 [Proteus penneri ATCC 35198]
 gi|225200681|gb|EEG83035.1| hypothetical protein PROPEN_03799 [Proteus penneri ATCC 35198]
          Length = 190

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 130/184 (70%), Gaps = 2/184 (1%)

Query: 75  IQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
           ++    LS D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+VN  D++ I+ I
Sbjct: 3   LELKPQLSVDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSVNYQDVISIF-I 61

Query: 135 GFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           G + ++ ++ + W+PLL+ T+N ++A  +G+  ++ +L  +MIT+L I +++KF+G  +I
Sbjct: 62  GVVIVLCVIIRSWRPLLSMTINQDMAFVDGVNIQRERLKLMMITALTIGLAMKFVGALII 121

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
           TSLLI+P  TARRF+ SPE MA++A  +G+L I  GL  S  +DTP+GPS+++ +  LFI
Sbjct: 122 TSLLIIPAATARRFARSPEQMALIAIAVGMLAITGGLTFSAFYDTPAGPSVVLAASCLFI 181

Query: 254 LSFF 257
           LS F
Sbjct: 182 LSLF 185


>gi|27904788|ref|NP_777914.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. Bp (Baizongia pistaciae)]
 gi|46397189|sp|Q89AJ1|ZNUB_BUCBP RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|27904186|gb|AAO27019.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera
           aphidicola str. Bp (Baizongia pistaciae)]
          Length = 261

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 160/258 (62%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           MY  FF   L +G+ +   TGPLG FIIW+R++ FGDT++HS+LLG++ +++  +     
Sbjct: 1   MYKTFFFGWL-AGVLLTTITGPLGLFIIWRRMSSFGDTLSHSSLLGISFAVLLNIHPFFM 59

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVIL-SFMKWVNTDLTSFLFGD 119
           + +   L  ++++ +     LS D ILG+I +S +SL ++I+ S   +    LT++LFG+
Sbjct: 60  VIITILLFGMLIIWLNYTTVLSLDTILGIIGYSFLSLGMIIINSISNFQKNKLTNYLFGN 119

Query: 120 ILAVNTTDI--LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           +L V   DI  L+I  +  L +++ +  W  +L TT+N +LAK +G+   KI  I I + 
Sbjct: 120 LLEVTYIDIVILIISCVSILFVLVWY--WDLMLLTTINSDLAKIDGVNVLKINSILIFLI 177

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +L I ++IKFIG  +  SLLI+P  TA+RFSTSPE MA  + IIGI+ I  G+  S+ ++
Sbjct: 178 TLTIGIAIKFIGSLIAISLLIIPAATAQRFSTSPEKMAFFSVIIGIISITWGILMSVYYN 237

Query: 238 TPSGPSIIITSLFLFILS 255
               P+I+  S  +F++S
Sbjct: 238 LAISPTIVFCSSIVFVIS 255


>gi|58584435|ref|YP_198008.1| ABC-type Mn2+/Zn2+ transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418751|gb|AAW70766.1| ABC-type Mn2+/Zn2+ transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 269

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 165/257 (64%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FFI +L + + I L TG LG F+IWQR++Y GD+++HS+LLG+AL+LIF++  +I I 
Sbjct: 7   QDFFINSLIAIVIISLVTGALGSFMIWQRLSYLGDSLSHSSLLGIALALIFKISPSISIM 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +IA + + +LL +  N   S D IL ++T+  +S +L+++SF+   N+ + S LFG+IL 
Sbjct: 67  LIAIVFA-ILLSLNFNRLYSVDTILNIVTNVVLSSSLILMSFLPSSNSSIISSLFGNILT 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  +DI+LI     + ++IL   W+  L  ++N +LA  E +    ++L F++  ++ I+
Sbjct: 126 LEQSDIVLISLTSIVVVLILIFRWRYWLIISINQDLAIVEKVNVNLVRLEFLITLAIFIA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS + IGI LI + L++P  ++R  S +P  M I+AT+  ++  I GL  S  FD  +GP
Sbjct: 186 VSAQLIGILLIAAFLLIPAASSRLISKTPMQMIIVATVFSLISGISGLILSASFDLLTGP 245

Query: 243 SIIITSLFLFILSFFYK 259
           +II+T+    I+++F +
Sbjct: 246 AIILTATTYLIIAYFIR 262


>gi|218461517|ref|ZP_03501608.1| zinc uptake ABC transporter, permease protein [Rhizobium etli Kim
           5]
          Length = 117

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 98/112 (87%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDL 112


>gi|300024287|ref|YP_003756898.1| ABC transporter [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526108|gb|ADJ24577.1| ABC-3 protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 267

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 151/245 (61%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F +RA  + +G+ L   PLGC ++W+R++Y G+T+A + LLGVAL L   + LT+ + 
Sbjct: 6   EPFVLRAFLAAVGLALIAAPLGCIVVWRRMSYVGETLAQAGLLGVALGLALHIDLTLAVV 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           + A     VL  + +   +  D+ LG+  H+T++L +V ++  K    DL S+LFGD+ A
Sbjct: 66  IAAVAAVGVLTMLGRQRVVPLDSALGLTHHATLALGIVAIALAKGPGIDLMSYLFGDVFA 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V +TD++ ++  G + +  +F +W+PL+  +++ +LA AEG+ P   +  F ++ +++I+
Sbjct: 126 VTSTDLIWVYAGGAVVLAAIFYLWEPLVRLSLHEDLATAEGLNPRLTRAAFDLLLAVVIA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V++K +GI L+ + L++P V AR  S +P  M +LA  I +   I GL+ SL  D P GP
Sbjct: 186 VAMKIVGILLVMAFLVVPAVAARPLSGTPARMVLLAAAIAVASTIFGLWLSLSSDLPGGP 245

Query: 243 SIIIT 247
           SI+I 
Sbjct: 246 SIVIA 250


>gi|190570630|ref|YP_001974988.1| Putative cation ABC transporter [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019119|ref|ZP_03334926.1| putative cation ABC transporter [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190356902|emb|CAQ54280.1| Putative cation ABC transporter [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995228|gb|EEB55869.1| putative cation ABC transporter [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 269

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 164/257 (63%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             FFI +L + I I L TG LG F+IWQR++Y GD+++HS+LLG+AL+LIF +  ++ I 
Sbjct: 7   QSFFINSLIAVIMISLVTGALGSFMIWQRLSYLGDSLSHSSLLGIALALIFNISPSVSIM 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +IA + + +LL +  N+  S+D IL ++T+  +S +L+++SF+   N  + S LFGDIL 
Sbjct: 67  LIAIMFA-ILLSLNFNKLYSADTILNIVTNVVLSSSLILMSFLPSGNNSIISSLFGDILM 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ ++I+ I+    +  +IL   W+  L  ++N +LA  E +    ++L F++I ++ I+
Sbjct: 126 IDQSNIISIFLTSVIVTLILIFRWRYWLMISINQDLATVEKVHVNFVRLEFLIILAIFIA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S + IGI LI + L++P  +AR  S +P  M I+AT+  ++  + GL  S  FD  +GP
Sbjct: 186 ISAQLIGILLIAAFLLIPAASARLISKTPMQMIIVATVFSVISGVSGLILSASFDLLTGP 245

Query: 243 SIIITSLFLFILSFFYK 259
           +II+ +    I+++F +
Sbjct: 246 AIILIAAVYLIIAYFIR 262


>gi|149915721|ref|ZP_01904246.1| ABC-3 [Roseobacter sp. AzwK-3b]
 gi|149810303|gb|EDM70148.1| ABC-3 [Roseobacter sp. AzwK-3b]
          Length = 268

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 167/260 (64%), Gaps = 11/260 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL----- 55
           M ++F IRA+ +G+G+ L+  PLGCF++W+R+AYFGD  AH+++LGVAL+L F +     
Sbjct: 2   MLDDFLIRAMLAGLGVALAAAPLGCFVVWRRMAYFGDATAHASILGVALALAFGISVFTG 61

Query: 56  PLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            L + + M A ++SL          ++ D +LGV+ HS ++  LV +SF++ V  DL  +
Sbjct: 62  ALVVALIMAAAVSSL------SGRGMAMDTLLGVMAHSALAFGLVAVSFLQGVRIDLMGY 115

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFGDILAV   D+ +IWG     + +L   W+ LL  T++ +LAKA G+ P + +L   +
Sbjct: 116 LFGDILAVGKADLAVIWGGAVAVVALLAWRWQALLTATLSPDLAKASGIDPRREQLGLTL 175

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
             +++++V+IK +G+ LI ++LI+P   AR  + +PE MA++A  +  L  + G+ GS +
Sbjct: 176 ALAVVVAVAIKVVGVLLIAAMLIVPAAAARPLAATPERMALIAVGLAALAALGGVQGSFV 235

Query: 236 FDTPSGPSIIITSLFLFILS 255
            DTP+GP+I+  +  +F+L+
Sbjct: 236 LDTPTGPTIVCVAAAIFVLT 255


>gi|261883823|ref|ZP_06007862.1| zinc ABC transporter, permease protein [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 170

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 113/148 (76%)

Query: 97  LALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNY 156
           L+ +    M WV  DL SFLFGDILAV+  DI  I+G G L + +L  +W+PLLA TV+ 
Sbjct: 7   LSALFYGLMTWVRVDLLSFLFGDILAVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSE 66

Query: 157 ELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAI 216
           ++A+AEGM P   ++IF+++ +++I++++K +GI LITSLLI+P  TARRF+++PE MA+
Sbjct: 67  DIARAEGMNPALSRIIFMLLLAIVIAIAMKIVGILLITSLLIIPAATARRFASTPEQMAV 126

Query: 217 LATIIGILGIIIGLYGSLIFDTPSGPSI 244
           LA++IG  G+I GLYGS+ FDTPSGPSI
Sbjct: 127 LASLIGAAGVIGGLYGSIHFDTPSGPSI 154


>gi|253989947|ref|YP_003041303.1| high-affinity zinc uptake system membrane protein znub
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781397|emb|CAQ84560.1| high-affinity zinc uptake system membrane protein znub
           [Photorhabdus asymbiotica]
          Length = 213

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 132/192 (68%), Gaps = 2/192 (1%)

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +++L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V   DI
Sbjct: 20  AIILVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSVTYEDI 79

Query: 129 LLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKF 187
            LI  IG  + + +LF  W  LL+ T++ E+A  +G++ ++++++ +++T+L I +++KF
Sbjct: 80  WLI-AIGVTIVVTLLFWQWNSLLSMTISQEMAFVDGIKIQRLRVLLMLVTALTIGLAMKF 138

Query: 188 IGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIIT 247
           +G  +ITSLLI+P  TARRF+ +PE MA +A   GI+ I  GL  S  +DTP+GPS+++ 
Sbjct: 139 VGALIITSLLIIPAATARRFARTPEQMAGIAIATGIVAITGGLAFSAFYDTPAGPSVVLC 198

Query: 248 SLFLFILSFFYK 259
           +  LFI+S   K
Sbjct: 199 AAMLFIISLVSK 210


>gi|211639072|emb|CAR67685.1| high-affinity zinc uptake system membrane protein znub
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
          Length = 212

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 132/192 (68%), Gaps = 2/192 (1%)

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
           +++L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V   DI
Sbjct: 19  AIILVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSVTYEDI 78

Query: 129 LLIWGIGF-LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKF 187
            LI  IG  + + +LF  W  LL+ T++ E+A  +G++ ++++++ +++T+L I +++KF
Sbjct: 79  WLI-AIGVTIVVTLLFWQWNSLLSMTISQEMAFVDGIKIQRLRVLLMLVTALTIGLAMKF 137

Query: 188 IGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIIT 247
           +G  +ITSLLI+P  TARRF+ +PE MA +A   GI+ I  GL  S  +DTP+GPS+++ 
Sbjct: 138 VGALIITSLLIIPAATARRFARTPEQMAGIAIATGIVAITGGLAFSAFYDTPAGPSVVLC 197

Query: 248 SLFLFILSFFYK 259
           +  LFI+S   K
Sbjct: 198 AAMLFIISLVSK 209


>gi|296272219|ref|YP_003654850.1| ABC protein [Arcobacter nitrofigilis DSM 7299]
 gi|296096394|gb|ADG92344.1| ABC-3 protein [Arcobacter nitrofigilis DSM 7299]
          Length = 269

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 148/255 (58%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F IRA  +GI I +    LG F++ +R +   D++AH +LLGVAL  +F +  T    +I
Sbjct: 8   FMIRAFVAGIFIAILAPTLGTFVVVRRYSMLSDSLAHISLLGVALGFLFSISTTFSAIII 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L SL +  ++KN  + SD+IL +   S ++LA++I+S     N  L S+LFG I+AV+
Sbjct: 68  ALLASLFIEYLRKNHNIYSDSILSIFLSSALALAIIIVSISNSFNVALFSYLFGSIVAVS 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI  I   G L+ + +   ++ LL    + E+AKA G+    +  + + + ++ + +S
Sbjct: 128 KEDIWTICIFGVLSALFIINNYQKLLFVAFDEEVAKASGINVSFLNYMLVSLVAITVGLS 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           IK IG+ LI +L+I+P ++A +F  S     +LA    +L +I+GL+ S     PSG +I
Sbjct: 188 IKIIGVLLIGALMIMPVISAMQFEKSFFITCLLAVSFAVLAVIVGLFVSFYISLPSGATI 247

Query: 245 IITSLFLFILSFFYK 259
           ++ SL LFILS   K
Sbjct: 248 VVVSLILFILSLMLK 262


>gi|213581977|ref|ZP_03363803.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-0664]
          Length = 181

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 125/178 (70%), Gaps = 2/178 (1%)

Query: 84  DAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM-IL 142
           D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV   D++ I  IG + ++ IL
Sbjct: 3   DTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAVTPEDLISI-AIGVVIVLAIL 61

Query: 143 FKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTV 202
           F  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V++KF+G  +ITSLLI+P  
Sbjct: 62  FWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGVTMKFVGALIITSLLIIPAA 121

Query: 203 TARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS+++ +  LFI S   K+
Sbjct: 122 TARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPSVVLCAALLFIFSMMKKQ 179


>gi|56416902|ref|YP_153976.1| zinc ABC transporter, permease protein [Anaplasma marginale str.
           St. Maries]
 gi|254995090|ref|ZP_05277280.1| zinc ABC transporter, permease protein [Anaplasma marginale str.
           Mississippi]
 gi|56388134|gb|AAV86721.1| zinc ABC transporter, permease protein [Anaplasma marginale str.
           St. Maries]
          Length = 267

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 157/260 (60%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +FFI  + + +   L T PLG  +IW R++Y GD+IAHS+LLGV ++L+ ++ L+I 
Sbjct: 5   IFEDFFINGILAILTASLITAPLGSVMIWNRLSYMGDSIAHSSLLGVGIALLLEIHLSIG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A L +L++  +  ++  + D IL ++T   +SL++++LS +      +   LFGD+
Sbjct: 65  VFVVAVLLALII-SLTTDKIHAVDTILNIMTSVVMSLSMILLSLVPSPGERVIHSLFGDV 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V  +D+L +  I  + I +L   W+  +A +V+ +L+ + G++  +IK   +++++L 
Sbjct: 124 LMVGRSDLLEMVAIAAIGIFVLVWRWRYWVAVSVSRDLSLSAGIRAGQIKTEILVVSALA 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I +  + +GI LITS L +P   AR  S +P  M I + +I  +  I+GL  +  FDT  
Sbjct: 184 IVLFSRSVGILLITSFLTIPASGARLISKTPVQMVITSVVISAISGILGLLCAAKFDTFP 243

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP II+ S  + +L + + K
Sbjct: 244 GPMIIVASFSMLLLVYVFSK 263


>gi|58697065|ref|ZP_00372520.1| zinc ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58698434|ref|ZP_00373344.1| zinc ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58535057|gb|EAL59146.1| zinc ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58536663|gb|EAL59964.1| zinc ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 239

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 150/233 (64%), Gaps = 1/233 (0%)

Query: 27  IIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAI 86
           +IWQR++Y GD+++HS+LLGVAL+LIF++  ++ I +IA +T  +LL +  N   S+D I
Sbjct: 1   MIWQRLSYLGDSLSHSSLLGVALALIFKISPSLSIMLIA-ITFAILLSLNFNRLYSADTI 59

Query: 87  LGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIW 146
           L ++T+  +S +L+++SF+   N  + S LFGDIL ++ +DI+LI+    +  +IL   W
Sbjct: 60  LNIVTNVVLSSSLILMSFLPSGNNSIISSLFGDILTLDQSDIVLIFLTSAVVTLILIFRW 119

Query: 147 KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARR 206
           +  L  ++N +LA  E +    ++L F++  ++ I+++ + IGI LI + L++P  +AR 
Sbjct: 120 RYWLMISINQDLAVVEKINVTFVRLEFLITLAIFIAIAAQLIGILLIAAFLLIPAASARL 179

Query: 207 FSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
            S +P  M I+AT+  ++  I GL  S  FD  +GP+II+ +    I+++F +
Sbjct: 180 ISKTPMQMIIVATVFSVISGISGLMLSASFDLLTGPAIILVAAVYLIIAYFIR 232


>gi|222475269|ref|YP_002563685.1| zinc ABC transporter, permease protein (znuB) [Anaplasma marginale
           str. Florida]
 gi|255003254|ref|ZP_05278218.1| zinc ABC transporter, permease protein (znuB) [Anaplasma marginale
           str. Puerto Rico]
 gi|255004382|ref|ZP_05279183.1| zinc ABC transporter, permease protein (znuB) [Anaplasma marginale
           str. Virginia]
 gi|222419406|gb|ACM49429.1| zinc ABC transporter, permease protein (znuB) [Anaplasma marginale
           str. Florida]
          Length = 267

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 157/260 (60%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +FFI  + + +   L T PLG  +IW R++Y GD+IAHS+LLGV ++L+ ++ L+I 
Sbjct: 5   IFEDFFINGILAILTASLITAPLGSVMIWNRLSYMGDSIAHSSLLGVGIALLLEIHLSIG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A L +L++  +  ++  + D IL ++T   +SL++++LS +      +   LFGD+
Sbjct: 65  VFVVAVLLALII-SLTTDKIHAVDTILNIMTSVVMSLSMILLSLVPSPGERVIHSLFGDV 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V  +D+L +  I  + I +L   W+  +A +V+ +L+ + G++  +IK   +++++L 
Sbjct: 124 LMVGRSDLLEMVAIAAIGIFVLVWRWRYWVAVSVSRDLSLSAGIRAGQIKTEILVVSALA 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I +  + +GI LITS L +P   AR  S +P  M I + +I  +  I+GL  +  FDT  
Sbjct: 184 IVLFSRSVGILLITSFLTIPASGARLISKTPVQMVITSVVISAISGILGLLCAAKFDTFP 243

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP II+ S  + +L + + K
Sbjct: 244 GPMIIVASFSMLLLIYVFSK 263


>gi|88606800|ref|YP_505004.1| ABC 3 transport family protein [Anaplasma phagocytophilum HZ]
 gi|88597863|gb|ABD43333.1| ABC 3 transport family protein [Anaplasma phagocytophilum HZ]
          Length = 264

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 156/258 (60%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             FFI  +F+ +   + T PLG  ++W R++Y GD+IAHS+LLGV ++ + Q+  +  + 
Sbjct: 7   ESFFINGVFAILIASIVTAPLGSMMVWNRLSYMGDSIAHSSLLGVGVATVLQMDASFTVL 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++A + + V++    ++  S DA+L ++T   +S+ +V+LSF+      +   LFGDIL 
Sbjct: 67  VVALILA-VIISFVIDKVHSIDAVLNIMTSVVMSVGMVLLSFIPSSGERIIHSLFGDILM 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +++ +++ +  I  + + ++   WK  ++ +++Y+L  + G+ P +IK+  +++++L + 
Sbjct: 126 ISSGELVQMLCISLVGVCVIIYRWKYWVSVSISYDLFLSTGISPRRIKMEILIMSALAVV 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +  + +GI L+T+ LI+P   AR  S +P  M +++  + ++  I+GL  S+ FDT  GP
Sbjct: 186 LFSRSVGILLVTAFLIIPASGARLLSRTPAQMVMVSMALSVISGIVGLMLSVRFDTFPGP 245

Query: 243 SIIITSLFLFILSFFYKK 260
             IITS FL +L+    K
Sbjct: 246 MTIITSFFLLVLAHVLSK 263


>gi|149201952|ref|ZP_01878926.1| ABC-3 [Roseovarius sp. TM1035]
 gi|149145000|gb|EDM33029.1| ABC-3 [Roseovarius sp. TM1035]
          Length = 269

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 163/257 (63%), Gaps = 11/257 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL----- 55
           M ++F +RA  +G+G+ L+  PLG F++W+R+AYFGD  AH+A+LGVA++L F +     
Sbjct: 1   MLDDFMVRAALAGLGVALAAAPLGSFVVWRRMAYFGDATAHAAILGVAMALAFSMSVFVG 60

Query: 56  PLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
            L + + M  T+++L           + D +LGV+ HS ++  LV +SF+  V  DL ++
Sbjct: 61  ALAMSLIMATTVSTL------SGRGFAMDTMLGVLAHSALAFGLVAVSFLSGVRIDLMAY 114

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFGDILAV+  D+L+IWG   L + +L   W+ LL  T++ +LA + G+ P + +L+  +
Sbjct: 115 LFGDILAVSRADLLVIWGGAALVLSLLAWRWQALLTATLSPDLAWSAGIDPRREQLVLTL 174

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
             +++++V+IK +G+ LI ++LI+P   AR  + +PE MA +AT+I     + GL  S  
Sbjct: 175 ALAVVVAVAIKVVGVLLIAAMLIVPAAAARPLAATPERMAAIATLIAGGSALGGLRLSFQ 234

Query: 236 FDTPSGPSIIITSLFLF 252
           FDTP+GP+I+  +  +F
Sbjct: 235 FDTPTGPTIVCVAALIF 251


>gi|269958684|ref|YP_003328471.1| putative zinc transporter protein ZnuB [Anaplasma centrale str.
           Israel]
 gi|269848513|gb|ACZ49157.1| putative zinc transporter protein ZnuB [Anaplasma centrale str.
           Israel]
          Length = 263

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 161/261 (61%), Gaps = 3/261 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +FFI  + + +   L T PLG  +IW R++Y GD+IAHS+LLGV ++L+ ++ +++ 
Sbjct: 5   IFEDFFINGILAILTASLITAPLGSVMIWNRLSYMGDSIAHSSLLGVGIALLLEVHMSLG 64

Query: 61  IFMIATLTSLVL-LQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
           +F++A L +L++ L + +  A+  D IL ++T   +SL++++LS +      +   LFGD
Sbjct: 65  VFVVAILLALIISLAMDRIHAI--DTILNIMTSVVMSLSMILLSLVPSSGERVIHSLFGD 122

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           +L V  +D+  +  I  + I++L   W+  +A +V+ +L+ + G++  +IK   +++++L
Sbjct: 123 VLMVGKSDLFEMAVIAIIGIVVLVWRWRYWVAVSVSRDLSLSAGIRAGQIKTEILVVSAL 182

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +I +  + +GI LITS L +P   A+  S +P  M I++ +I  +  I+GL  +  FDT 
Sbjct: 183 VIVLFSRSVGILLITSFLTIPASGAKLISKTPVQMVIISVVISAVSGILGLLCAAKFDTF 242

Query: 240 SGPSIIITSLFLFILSFFYKK 260
            GP III+S  + +L+   KK
Sbjct: 243 PGPMIIISSFAMLLLTHLLKK 263


>gi|21672583|ref|NP_660650.1| high-affinity zinc uptake system membrane protein [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
 gi|25091744|sp|Q8K9M7|ZNUB_BUCAP RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|21623212|gb|AAM67861.1| high-affinity zinc uptake system membrane protein [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
          Length = 261

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 162/245 (66%), Gaps = 1/245 (0%)

Query: 12  SGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLV 71
           +GI +  +TGPLG FIIW+RI+ FGDT++HS++LG+A+S++FQ+          +  +++
Sbjct: 11  AGILLSFATGPLGSFIIWRRISSFGDTLSHSSILGLAISILFQIDSFYTELFFMSFLAII 70

Query: 72  LLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAVNTTDILL 130
           L+ +++  ++S + IL +I+HS++SL ++ +S M   +  DL+++LFGD+L V   D+ +
Sbjct: 71  LVWMEQLLSVSLETILSIISHSSLSLGIICISLMSTSHHIDLSNYLFGDLLLVTVFDLCI 130

Query: 131 IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGI 190
           I     + + ILF  W  +L  TVN ELA+ +G+     +L  ++ T++ IS++IKF+G+
Sbjct: 131 IALGSLIVLTILFFRWNSILLLTVNEELAQIDGVNIFYARLTLMLTTAICISIAIKFVGV 190

Query: 191 TLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLF 250
            LITSLLI+P  TA+ FS SPE     + +I I+ +  G++ S  ++ P+ PSI++ S  
Sbjct: 191 LLITSLLIIPPATAQIFSNSPEKTIGFSILISIISVTGGIFLSFFYNVPTSPSIVLFSSC 250

Query: 251 LFILS 255
           +++LS
Sbjct: 251 VYLLS 255


>gi|126729166|ref|ZP_01744980.1| ABC-3 [Sagittula stellata E-37]
 gi|126710156|gb|EBA09208.1| ABC-3 [Sagittula stellata E-37]
          Length = 261

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 161/255 (63%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA+ + +G  L+  PLG F++W+R+AYFGD  AH+A+LGVAL+L    P+   
Sbjct: 1   MLDDFLVRAVLAAVGAALAAAPLGVFVVWRRMAYFGDATAHAAVLGVALALAISAPVFAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A + +L + ++       +D +LGV  H  ++  LV +S ++    DL ++LFGDI
Sbjct: 61  TLVVALVMALTVARLA-GRGYGADMVLGVAAHGALAFGLVAVSLLEGPRLDLEAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+ +IWG G +   ++   W+ L+ +TV+ +LA A G+ P++ +LI ++  +L+
Sbjct: 120 LAVGKVDLAVIWGGGAVVAALIGWRWQALVTSTVSEDLAFAAGIDPKRERLILMLALALV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V++K +G  LI +LLI+P   AR +S +PE M      +G+L  + GL+G+ + D P+
Sbjct: 180 VAVALKVVGALLIGALLIIPAAAARPWSRTPEVMLAGTAALGVLSALGGLWGAWVLDLPA 239

Query: 241 GPSIIITSLFLFILS 255
           GP+++  +  LF +S
Sbjct: 240 GPAVVCAAALLFAVS 254


>gi|68171641|ref|ZP_00545006.1| ABC-3 [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998934|gb|EAM85620.1| ABC-3 [Ehrlichia chaffeensis str. Sapulpa]
          Length = 267

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 157/256 (61%), Gaps = 3/256 (1%)

Query: 3   NE-FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           NE FF+  + + + + L TG LG F+IW+ ++Y GD+I+H+++LGVAL+++  + ++  I
Sbjct: 7   NEYFFVNGIIAILIVSLVTGSLGSFMIWKNLSYLGDSISHASILGVALAVLLDISISSGI 66

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             I+ + +L LL    N+  S D +L ++T+  +SL +++LSF    + ++   LFGD+L
Sbjct: 67  LCISIIFAL-LLSYSINKIYSIDTVLNIVTNVIMSLGMILLSFFPSASNNIIHSLFGDVL 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D++++  +  + I ++   WK  L  +V+ +L+ +EG+    IKL F++I S+ I
Sbjct: 126 MLTNRDLIIMALVALVIITLVIYRWKYWLIISVSNDLSASEGVNVGFIKLEFLVILSVFI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + + + +GI LIT+ L++P   AR  S +P  M +++TII I   I GL  S  FD   G
Sbjct: 186 AFAAQLVGILLITAFLVIPAAAARLMSKTPLQMIVISTIISIFSGITGLLLSEKFDIFPG 245

Query: 242 PSIIITSLFLFILSFF 257
           P II+ S FLF+L  +
Sbjct: 246 PLIIMVS-FLFLLVMY 260


>gi|255320609|ref|ZP_05361786.1| high-affinity zinc uptake system membrane protein ZnuB
           [Acinetobacter radioresistens SK82]
 gi|262380757|ref|ZP_06073910.1| high-affinity zinc uptake system membrane protein znuB
           [Acinetobacter radioresistens SH164]
 gi|255302225|gb|EET81465.1| high-affinity zinc uptake system membrane protein ZnuB
           [Acinetobacter radioresistens SK82]
 gi|262297705|gb|EEY85621.1| high-affinity zinc uptake system membrane protein znuB
           [Acinetobacter radioresistens SH164]
          Length = 267

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 154/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAVAGALSLPLWMGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            ++A L   VL  +  +  L SDA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  TLLALLLVAVLWVLH-DPRLPSDALLALCSATLLCSGLLFIQHLPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            ++  D+     +  L + +L+K W+  + T ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 TISWNDLPTFAAVILLALAVLYKSWQAQIRTAIDPDIAASEGIHNQWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P +TAR  + SP  M I A ++  +GI +GL+ S   D  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALTARLLAHSPRQMVIWAFVMAQIGITVGLWSSAGLDISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++T   LFIL F  +K
Sbjct: 243 LSIVLTMAILFILIFTVQK 261


>gi|169632156|ref|YP_001705892.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii SDF]
 gi|169150948|emb|CAO99563.1| high affinity Zn transport protein (ABC superfamily, membrane)
           [Acinetobacter baumannii]
          Length = 276

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 154/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGCF++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCFMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|262376911|ref|ZP_06070138.1| high-affinity zinc uptake system membrane protein znuB
           [Acinetobacter lwoffii SH145]
 gi|262308256|gb|EEY89392.1| high-affinity zinc uptake system membrane protein znuB
           [Acinetobacter lwoffii SH145]
          Length = 266

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 155/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWMGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             IA L  + +L +  +  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  TFIALLL-VGILWVLHDPRLPNDALLALCSATLLCSGLLFIQHLPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            ++ TD+     +  L + +L+K W+  +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 TISWTDLPTFAIVIILALAVLYKSWQAQIQIAIDPDMAVSEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +++K +G  L+ +LL++P +TAR  + SP+ M I A +I  +G+ +GL+ S   +T +G
Sbjct: 183 VLALKAVGSLLMGALLVIPALTARLLAHSPKQMVIWAFVIAQIGVTVGLWSSAGLNTSTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            +I++T   LF L F  +K
Sbjct: 243 LTIVLTMAVLFALIFCVQK 261


>gi|218508898|ref|ZP_03506776.1| zinc uptake ABC transporter, permease protein [Rhizobium etli
           Brasil 5]
          Length = 135

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 91/111 (81%)

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
           +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++I++++K +GI LITSLLI+P   A
Sbjct: 9   LWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVVIAIAMKIVGIMLITSLLIIPAAAA 68

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           RRFS +PE MA+ A++IG   ++ GL+GSL +DTPSGPSI++ +L LFILS
Sbjct: 69  RRFSVTPEIMAVFASLIGAAAVVGGLFGSLTYDTPSGPSIVVAALVLFILS 119


>gi|58617248|ref|YP_196447.1| high-affinity zinc uptake system membrane protein znuB [Ehrlichia
           ruminantium str. Gardel]
 gi|58416860|emb|CAI27973.1| High-affinity zinc uptake system membrane protein znuB [Ehrlichia
           ruminantium str. Gardel]
          Length = 266

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 157/253 (62%), Gaps = 2/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           +FI  + + + + L TG LG F+IW+ ++Y GD+I+H++LLGVALS++  + ++  I   
Sbjct: 9   YFINGMIAIVIVSLVTGSLGSFMIWKNLSYLGDSISHASLLGVALSILLNVNISAGILCT 68

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + + +  LL    ++  S D +L ++T+ T+SL +++LSF    N ++   LFGD+L + 
Sbjct: 69  SVIFAF-LLSYGISKVHSIDTVLSIVTNVTMSLGMILLSFFPSANNNIIHSLFGDMLMLT 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+++++ +  + I+++   WK  L  +++ +L+ +EG+    IKL F++I S+ I+ +
Sbjct: 128 NRDLVIMFSVAIVVIVLIIYRWKYWLIMSISNDLSASEGLNMGLIKLEFLIILSIFIAFA 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
            + +G+ LIT+ L++P   AR  S +P  M I++T+I +   IIGL  S  FD   GP +
Sbjct: 188 AQLVGVLLITAFLVIPAAAARFISKTPLQMIIISTVISVFSGIIGLLLSEKFDIFPGPIV 247

Query: 245 IITSLFLFILSFF 257
           I+ S F+F+L  +
Sbjct: 248 IMVS-FIFLLCMY 259


>gi|57239233|ref|YP_180369.1| high-affinity zinc uptake system membrane protein znuB [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579195|ref|YP_197407.1| high-affinity zinc uptake system membrane protein znuB [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161312|emb|CAH58235.1| putative ABC transporter, membrane-spanning protein [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417821|emb|CAI27025.1| High-affinity zinc uptake system membrane protein znuB [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 266

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 157/253 (62%), Gaps = 2/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           +FI  + + + + L TG LG F+IW+ ++Y GD+I+H++LLGVALS++  + ++  I   
Sbjct: 9   YFINGMIAIVIVSLVTGSLGSFMIWKNLSYLGDSISHASLLGVALSILLNVNISAGILCT 68

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + + +  LL    ++  S D +L ++T+ T+SL +++LSF    N ++   LFGD+L + 
Sbjct: 69  SVIFAF-LLSYGISKVHSIDTVLSIVTNVTMSLGMILLSFFPSANNNIIHSLFGDMLMLT 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+++++ +  + I+++   WK  L  +++ +L+ +EG+    IKL F++I S+ I+ +
Sbjct: 128 NRDLVIMFSVAIVVIVLIIYRWKYWLIMSISNDLSASEGLNMGLIKLEFLVILSIFIAFA 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
            + +G+ LIT+ L++P   AR  S +P  M I++T+I +   IIGL  S  FD   GP +
Sbjct: 188 AQLVGVLLITAFLVIPAAAARFISKTPLQMIIISTVISVFSGIIGLLLSEKFDIFPGPIV 247

Query: 245 IITSLFLFILSFF 257
           I+ S F+F+L  +
Sbjct: 248 IMVS-FIFLLCMY 259


>gi|146329371|ref|YP_001209273.1| zinc uptake system protein [Dichelobacter nodosus VCS1703A]
 gi|146232841|gb|ABQ13819.1| zinc uptake system protein [Dichelobacter nodosus VCS1703A]
          Length = 268

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 137/233 (58%), Gaps = 8/233 (3%)

Query: 19  STGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKN 78
           +  PLG  I W+R+ YFG+T+AH++LLG+AL+L+   P+ + I++++ L  ++L  +++ 
Sbjct: 21  TAAPLGALISWRRLVYFGETLAHASLLGIALALLMGFPIYLGIWLMSVLMVVLLFILKQQ 80

Query: 79  EALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLN 138
               S+ ILG + H  ++L ++ L+ M  + TDL  +LFGDIL+   +D+ +I    F  
Sbjct: 81  SNADSNNILGTLAHIFLALGMITLTSMPHIRTDLVGYLFGDILSTTISDLKIIGFASFFL 140

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
            ++L KIW+PL+  TVN  +AKAE         IF++I  L + + + ++G+ LI + LI
Sbjct: 141 AVVLKKIWQPLILLTVNESIAKAESRYMVYYDFIFLLIIGLYLGLMVHYLGLMLIIAFLI 200

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGL----YGSLIFDTPSGPSIIIT 247
           +P   A   S +PE   ++A  I  +   +G     YG+L    P  P+I+++
Sbjct: 201 IPVHIAAPMSQTPEECVLIALFIAAIATTVGFGIAYYGNL----PVAPTIVVS 249


>gi|262371358|ref|ZP_06064676.1| high affinity Zn transporter [Acinetobacter johnsonii SH046]
 gi|262313695|gb|EEY94744.1| high affinity Zn transporter [Acinetobacter johnsonii SH046]
          Length = 266

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 154/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGAMALPLWMGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             IA L  + +L +  +  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AFIAGLL-VAILWVLHDPRLPNDALLALCSATLLCSGLMFIQHIPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D+ +   +  + + +L+K W+  +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 TITWADLPIFATVIVVALAVLYKSWQAQIQIAIDPDMAVSEGVSAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P +TAR  + SP+ M I A +I  +G+ +GL+ S   +T +G
Sbjct: 183 ILALRAVGSLLMGALLVIPALTARLLAHSPKQMVIWAFVIAQIGVTVGLWSSAGLNTSTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++T   LF L F  +K
Sbjct: 243 LSIVLTMSTLFALIFIAQK 261


>gi|88657914|ref|YP_507332.1| putative cation ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599371|gb|ABD44840.1| putative cation ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 267

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 156/256 (60%), Gaps = 3/256 (1%)

Query: 3   NE-FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           NE FF+  + + + + L TG LG F+IW+ ++Y GD+I+H+++LGVAL+++  + ++  I
Sbjct: 7   NEYFFVNGIIAILIVSLVTGSLGSFMIWKNLSYLGDSISHASILGVALAVLLDISISSGI 66

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             I+ + +L LL    N+  S D +L ++T+  +S  +++LSF    + ++   LFGD+L
Sbjct: 67  LCISIIFAL-LLSYSINKIYSIDTVLNIVTNVIMSSGMILLSFFPSASNNIIHSLFGDVL 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D++++  +  + I ++   WK  L  +V+ +L+ +EG+    IKL F++I S+ I
Sbjct: 126 MLTNRDLIIMALVALVIITLVIYRWKYWLIISVSNDLSASEGVNVGFIKLEFLVILSVFI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + + + +GI LIT+ L++P   AR  S +P  M +++TII I   I GL  S  FD   G
Sbjct: 186 AFAAQLVGILLITAFLVIPAAAARLMSKTPLQMIVISTIISIFSGITGLLLSEKFDIFPG 245

Query: 242 PSIIITSLFLFILSFF 257
           P II+ S FLF+L  +
Sbjct: 246 PLIIMVS-FLFLLVMY 260


>gi|260551333|ref|ZP_05825534.1| high affinity Zn transporter [Acinetobacter sp. RUH2624]
 gi|260405647|gb|EEW99138.1| high affinity Zn transporter [Acinetobacter sp. RUH2624]
          Length = 269

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPVFTLIIAISLAILYRFWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|323516224|gb|ADX90605.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 269

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPIFTLIIAVSLTILYRFWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|260557598|ref|ZP_05829812.1| high affinity Zn transporter [Acinetobacter baumannii ATCC 19606]
 gi|260408771|gb|EEX02075.1| high affinity Zn transporter [Acinetobacter baumannii ATCC 19606]
 gi|322506356|gb|ADX01810.1| znuB [Acinetobacter baumannii 1656-2]
          Length = 269

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|239503054|ref|ZP_04662364.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii AB900]
          Length = 268

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 3   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 62

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 63  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 121

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 122 SIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 181

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 182 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 241

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 242 LSIVLCMALSFALIFMVQK 260


>gi|299771954|ref|YP_003733980.1| High-affinity zinc uptake system membrane protein znuB
           [Acinetobacter sp. DR1]
 gi|298702042|gb|ADI92607.1| High-affinity zinc uptake system membrane protein znuB
           [Acinetobacter sp. DR1]
          Length = 268

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 151/257 (58%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +  
Sbjct: 5   QLLLPAWMMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGVAG 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L++
Sbjct: 65  TAVLLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLLSI 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ +   I  L++ IL++ W+P +   ++ ++A +EG+     +LIF+++ +L   +
Sbjct: 124 DWPDLPVFTLIIALSLAILYRFWQPQIQFAIDPDIAISEGVNANWQRLIFMLLLALFTVL 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  L+ +LL++P ++AR  + SP+ M + A ++  LG+ +GL+ S   +  +G S
Sbjct: 184 ALRAVGSLLMGALLVIPALSARLLANSPKQMVVWAFVLAQLGVSVGLWSSAALNISTGLS 243

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F + F  +K
Sbjct: 244 IVLCMALTFAVIFITQK 260


>gi|169797655|ref|YP_001715448.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii AYE]
 gi|213155551|ref|YP_002317596.1| high affinity Zn transport protein [Acinetobacter baumannii AB0057]
 gi|215485009|ref|YP_002327250.1| High-affinity zinc uptake system membrane protein znuB
           [Acinetobacter baumannii AB307-0294]
 gi|301345716|ref|ZP_07226457.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii AB056]
 gi|301512758|ref|ZP_07237995.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii AB058]
 gi|301594487|ref|ZP_07239495.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii AB059]
 gi|332852643|ref|ZP_08434297.1| ABC 3 transport family protein [Acinetobacter baumannii 6013150]
 gi|332869359|ref|ZP_08438737.1| ABC 3 transport family protein [Acinetobacter baumannii 6013113]
 gi|332875621|ref|ZP_08443433.1| ABC 3 transport family protein [Acinetobacter baumannii 6014059]
 gi|169150582|emb|CAM88491.1| high affinity Zn transport protein (ABC superfamily, membrane)
           [Acinetobacter baumannii AYE]
 gi|213054711|gb|ACJ39613.1| high affinity Zn transport protein [Acinetobacter baumannii AB0057]
 gi|213988212|gb|ACJ58511.1| High-affinity zinc uptake system membrane protein znuB
           [Acinetobacter baumannii AB307-0294]
 gi|332729111|gb|EGJ60458.1| ABC 3 transport family protein [Acinetobacter baumannii 6013150]
 gi|332732777|gb|EGJ63993.1| ABC 3 transport family protein [Acinetobacter baumannii 6013113]
 gi|332736194|gb|EGJ67209.1| ABC 3 transport family protein [Acinetobacter baumannii 6014059]
          Length = 269

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPIFTLIIAVSLAILYRYWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|193076034|gb|ABO10626.2| high affinity Zn transport protein [Acinetobacter baumannii ATCC
           17978]
          Length = 268

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 3   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 62

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 63  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 121

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 122 SIDWPDLPIFTLIIAVSLAILYRYWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 181

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 182 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 241

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 242 LSIVLCMALSFALIFMVQK 260


>gi|293611158|ref|ZP_06693456.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826409|gb|EFF84776.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 269

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 152/257 (59%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +  
Sbjct: 6   QLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGVAG 65

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   VL  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L++
Sbjct: 66  TAVLLVGVLWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLLSI 124

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ +   I  ++++IL++ W+P +   ++ ++A +EG+     +LIF+++ +L   +
Sbjct: 125 DWPDLPVFTLIIAISLVILYRFWQPQIQFAIDPDIAISEGVNANWQRLIFMLLLALFTVL 184

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G S
Sbjct: 185 ALRAVGSLLMGALLVIPALSARLLANSPKQMVIWAFVLAQLGVSVGLWSSAALNISTGLS 244

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F + F  +K
Sbjct: 245 IVLCMALSFAVIFITQK 261


>gi|160902451|ref|YP_001568032.1| ABC-3 protein [Petrotoga mobilis SJ95]
 gi|160360095|gb|ABX31709.1| ABC-3 protein [Petrotoga mobilis SJ95]
          Length = 272

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 153/257 (59%), Gaps = 10/257 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
           I A+ SG G    +  L  FI+ +++ + G+  AH A   +A +L F L + +   ++A 
Sbjct: 15  IGAILSGFG----SALLSNFIVLKKMEFIGNGAAHVAFGAIAFALFFGLNMNLLSIIVAI 70

Query: 67  LTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTT 126
           + ++ + Q+ K E +  ++++G++   ++++ +++LSF K    ++ SFLFGD+L +   
Sbjct: 71  IFAITIHQLGKKERVQENSVIGMLLSLSMAIGIILLSFKKGYVPEIDSFLFGDVLMITQE 130

Query: 127 DILLIWGIGFLNIMILFKIW---KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           D++L   +G  +++ILF +    K L   + N  L+K  G+    I L+F+ ITS+ I V
Sbjct: 131 DLIL---LGIFDLLILFMVIFLNKELKYYSFNQRLSKIFGVPANIINLVFLTITSVTIVV 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K IGI LIT+LLI P V A+ ++ S   M I++ I+G+   ++G++ S   + PSGP 
Sbjct: 188 SVKIIGIILITALLITPGVIAKLYAKSINQMLIISVIVGVFSSVLGIFLSYYLNVPSGPM 247

Query: 244 IIITSLFLFILSFFYKK 260
           I++T   +F++++  +K
Sbjct: 248 IVLTMFLIFLIAYLLRK 264


>gi|325124130|gb|ADY83653.1| high affinity Zn transport protein (ABC superfamily, membrane)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 269

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 151/257 (58%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +  
Sbjct: 6   QLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGVAG 65

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   VL  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L++
Sbjct: 66  TAVLLVGVLWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLLSI 124

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ +   I  +++ IL++ W+P +   ++ ++A +EG+     +LIF+++ +L   +
Sbjct: 125 DWPDLPVFTLIIAISLAILYRFWQPQIQFAIDPDIAISEGVNANWQRLIFMLLLALFTVL 184

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G S
Sbjct: 185 ALRAVGSLLMGALLVIPALSARLLANSPKQMVIWAFVLAQLGVSVGLWSSAALNISTGLS 244

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F + F  +K
Sbjct: 245 IVLCMALSFAVIFITQK 261


>gi|213025231|ref|ZP_03339678.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 189

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 123/185 (66%), Gaps = 2/185 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLASGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I 
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIG 181

Query: 183 VSIKF 187
           V++KF
Sbjct: 182 VTMKF 186


>gi|262281317|ref|ZP_06059098.1| high affinity Zn transporter [Acinetobacter calcoaceticus RUH2202]
 gi|262257143|gb|EEY75880.1| high affinity Zn transporter [Acinetobacter calcoaceticus RUH2202]
          Length = 269

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 151/257 (58%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +  
Sbjct: 6   QLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGVAG 65

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L++
Sbjct: 66  TAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLLSI 124

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ +   +  ++++IL++ W+P +   ++ ++A +EG+     +LIF+++ +L   +
Sbjct: 125 DWPDLPVFTLVIAISLVILYRFWQPQIQFAIDPDIAVSEGVNANWQRLIFMLLLALFTVL 184

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  L+ +LL++P ++AR  + SP+ M I A  +  LG+ +GL+ S   +  +G S
Sbjct: 185 ALRAVGSLLMGALLVIPALSARLLANSPKQMVIWAFALAQLGVSVGLWSSAALNISTGLS 244

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F + F  +K
Sbjct: 245 IVLCMALTFAVIFITQK 261


>gi|254463376|ref|ZP_05076792.1| zinc ABC transporter, permease protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206679965|gb|EDZ44452.1| zinc ABC transporter, permease protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 268

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 164/251 (65%), Gaps = 1/251 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F +RA  +G+G+ L+  PLGCF++W+R+AYFG+  AH+++LG+AL+L F   +   + 
Sbjct: 5   DSFLVRAALAGLGVALAAAPLGCFVVWRRMAYFGEATAHASILGIALALSFSTSILAGVL 64

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++A L    +  +      + D +LGV+ HS +++ LV +SF++ V  DL ++LFGDILA
Sbjct: 65  IVALLMGWSVSTL-SGRGYAMDTLLGVMAHSALAIGLVAVSFLQGVRIDLMAYLFGDILA 123

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+L++W    L +++L+  W  LL  T++ +LA A G+ P + +++  +  +++++
Sbjct: 124 VSRFDLLIVWIGVLLVLLLLWWRWSALLTATLSNDLAHAAGIDPRREQMVLTIALAVVVA 183

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+IK +G+ LI +LLI+P   AR F+ +PE MA +A  IG +  + GL  + IFDTP+GP
Sbjct: 184 VAIKVVGVLLIAALLIIPAAAARPFAGTPERMAFIAAGIGAISAMAGLQAAYIFDTPTGP 243

Query: 243 SIIITSLFLFI 253
           +I+  +   F+
Sbjct: 244 TIVCVAATCFV 254


>gi|184156487|ref|YP_001844826.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           baumannii ACICU]
 gi|183208081|gb|ACC55479.1| high affinity Zn transport protein (ABC superfamily, membrane)
           [Acinetobacter baumannii ACICU]
          Length = 269

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 152/259 (58%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
              A L   +L  +  N  L +DA+L + + + +   L+ +  +  +  +L S+LFGD+L
Sbjct: 64  AGTAILLVAILWALHDNR-LPNDALLALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++  D+ +   I  +++ IL++ W+  +   ++ ++A +EG+  +  +LIF+++ +L  
Sbjct: 123 SIDWPDLPVFTLIIAVSLAILYRYWQSQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++  LG+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F L F  +K
Sbjct: 243 LSIVLCMALSFALIFMVQK 261


>gi|148262133|ref|YP_001228839.1| ABC-3 protein [Geobacter uraniireducens Rf4]
 gi|146395633|gb|ABQ24266.1| ABC-3 protein [Geobacter uraniireducens Rf4]
          Length = 272

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 157/263 (59%), Gaps = 13/263 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLI--FQLPLTI--- 59
           F  RAL +G  I +    LG F++ +R++  GD +AH     VAL+L   F   LT    
Sbjct: 11  FLQRALVAGSLIAVLCSVLGVFLVLRRLSLIGDGLAHVTFGSVALALFLGFHSALTTVAA 70

Query: 60  --CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLF 117
             C+     L SL +L++ +   +  D  +G+++   I++ +++ S     N DL S+LF
Sbjct: 71  IPCVL----LASLGVLRLTEKAKIYGDTAIGIVSSLGIAIGVLLASMAGGFNVDLFSYLF 126

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKI-WKPLLATTVNYELAKAEGMQPEKIKLIFIMI 176
           G+IL+++TT++L+  G+ FL +++   + +  L A T + ELAK+ G+  ++I  I +++
Sbjct: 127 GNILSISTTELLISAGL-FLVVLVSVALNYNELFAITFDEELAKSAGISTKRINSILVLL 185

Query: 177 TSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF 236
           T+L + +++K +GI LI++LLILP V+A + +   +   +LA +IG+  +IIG++ S + 
Sbjct: 186 TALTVVLAMKVVGIMLISALLILPAVSALQLAKGFKTAILLAALIGMGTVIIGIFASFVM 245

Query: 237 DTPSGPSIIITSLFLFILSFFYK 259
           + P+G +I++ +  LF L+F  K
Sbjct: 246 NLPTGATIVLVNFVLFALTFVIK 268


>gi|153867769|ref|ZP_01998025.1| high-affinity zinc uptake system membrane protein [Beggiatoa sp.
           SS]
 gi|152144912|gb|EDN71976.1| high-affinity zinc uptake system membrane protein [Beggiatoa sp.
           SS]
          Length = 199

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 122/189 (64%), Gaps = 15/189 (7%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI--- 59
            +F  RAL  G+G+ +  GPLGCFI+W+R+AYFGDT+AHSALLG+AL  +  L LT+   
Sbjct: 2   EDFLWRALLGGLGVAVIAGPLGCFIVWRRMAYFGDTLAHSALLGIALGFLLNLKLTVHLE 61

Query: 60  ----------CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK--W 107
                        ++    +L+L+ ++  +  ++D +LG++ HS +SL LV L+F++   
Sbjct: 62  LLTLSSLLMLSTLIVCLAIALLLVILESQKRFATDTLLGILAHSALSLGLVALAFLQGEG 121

Query: 108 VNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPE 167
           +  DL ++LFGD+LA+  TD+  I+G G L ++ L  IW+ LL+ T++ ELA+ EG+   
Sbjct: 122 LRIDLYAYLFGDLLAITRTDLYWIYGGGGLILLSLVFIWQSLLSITIHEELAQVEGVSVP 181

Query: 168 KIKLIFIMI 176
            I+L+F+++
Sbjct: 182 WIRLLFMLM 190


>gi|288555767|ref|YP_003427702.1| Mn2+ ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288546927|gb|ADC50810.1| ABC transporter permease protein Mn2+ [Bacillus pseudofirmus OF4]
          Length = 292

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 150/258 (58%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   +  +AL + + + +  G +GCFII + +A  GD I+H+ L GV +S +  +     
Sbjct: 12  MRYPYLQQALLAAVLVGIICGVIGCFIILRGMALMGDAISHAVLPGVVVSYMIGINFFFG 71

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   LT+L +  + +N  +  D+ +G++  +  +L +V+++ ++    DL   LFG++
Sbjct: 72  AVLTGVLTALAIGYVSQNSRIKDDSAIGILFTAAFALGIVMITGLRGTGVDLWHILFGNV 131

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+ +  GIGF  I+++   ++PLL +T +  +AKA G+    I  + +++ SL+
Sbjct: 132 LAVSRTDLWVTAGIGFFVILLIVIFYRPLLISTFDPVMAKATGIPVRFIHYLLMLLLSLV 191

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S+K +GI L+ ++LI P  TA   +     M  L+ + G++  I+G+Y S+I+D  S
Sbjct: 192 TVASLKSVGIVLVVAMLITPGATAYLLTDRLPVMLSLSAVFGVISAIVGIYFSVIYDVAS 251

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++ +  LF L+FF+
Sbjct: 252 GASIVLAASVLFGLAFFF 269


>gi|226952201|ref|ZP_03822665.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           sp. ATCC 27244]
 gi|226837039|gb|EEH69422.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           sp. ATCC 27244]
          Length = 268

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 154/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++ I  LP  + +
Sbjct: 3   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGILGLPFWLGV 62

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +A L  + +L +  +  L +DA+L + + + +   L+++  +  +  +L S+LFGD+L
Sbjct: 63  GFLALLL-VAILWVLHDSRLPNDALLALCSATLLCAGLLLIQQVPSLRPELLSYLFGDLL 121

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           ++  +D+ +   +  + +++L++ W   +   ++ ++A +EG+     +LIF+++ +L  
Sbjct: 122 SIEWSDLPIFAVVIMIALVVLYRSWSAQIQIAIDPDIAMSEGINANWQRLIFMLLLALFT 181

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M + A I+  LGI +GL+ S   +  +G
Sbjct: 182 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVLWAFILAQLGITVGLWSSAALNIATG 241

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++    +F + F  +K
Sbjct: 242 LSIVLFMALIFAVIFMLQK 260


>gi|294648860|ref|ZP_06726316.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292825251|gb|EFF83998.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 269

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 154/259 (59%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + +  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++ I  LP  + +
Sbjct: 4   WLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGILSLPFWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +A L  + +L +  +  L +DA+L + + + +   L+++  +  +  +L S+LFGD+L
Sbjct: 64  GFLALLL-VAILWVLHDSRLPNDALLALCSATLLCAGLLLIQQVPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           ++  +D+ +   +  + +++L++ W   +   ++ ++A +EG+     +LIF+++ +L  
Sbjct: 123 SIEWSDLPIFAVVIMIALVVLYRSWSAQIQIAIDPDIAMSEGINANWQRLIFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M + A ++  LGI +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVLWAFLLAQLGITVGLWSSAALNIATG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++    +F + F  +K
Sbjct: 243 LSIVLFMALIFAVIFMLQK 261


>gi|262374646|ref|ZP_06067919.1| high affinity Zn transporter [Acinetobacter junii SH205]
 gi|262310436|gb|EEY91527.1| high affinity Zn transporter [Acinetobacter junii SH205]
          Length = 272

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 152/259 (58%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + E  + A   G  +V  T PLGC ++W+R+++F DT+AH  LLGVA++ + QLP  + +
Sbjct: 4   WLELLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAIAGMLQLPFWLGV 63

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +A L  + +L +  +  L +DA+L + + + +   L+++  +  +  +L S+LFGD+L
Sbjct: 64  GCLAGLL-VAILWVLHDSRLPNDALLALCSATLLCSGLLLIQHLPSLRPELLSYLFGDLL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           ++   D+ L   +    +++L++ W   +  +++ ++A +EG+  +  +L+F+++ +L  
Sbjct: 123 SIEWADLPLFAIVIAAALVVLYRSWSAQIQISIDPDIAISEGVNAKWQRLVFMLLLALFT 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G  L+ +LL++P ++AR  + SP+ M I A ++   G+ +GL+ S   +  +G
Sbjct: 183 VLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFMLAQFGVTVGLWSSAALNIATG 242

Query: 242 PSIIITSLFLFILSFFYKK 260
            SI++     F   F  +K
Sbjct: 243 LSIVLCMALTFAAIFATQK 261


>gi|50083458|ref|YP_044968.1| high affinity Zn ABC transporter membrane protein [Acinetobacter
           sp. ADP1]
 gi|49529434|emb|CAG67146.1| high affinity Zn transport protein (ABC superfamily, membrane)
           [Acinetobacter sp. ADP1]
          Length = 271

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 149/246 (60%), Gaps = 3/246 (1%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           +V  T PLGC ++W+R+++F DT+AH  LLGVA++    LPL   +  +  L  + +L +
Sbjct: 18  LVFLTAPLGCLMLWRRMSFFADTMAHGTLLGVAVAGALSLPLWFGV-TLLALLLVGILWV 76

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI-LLIWGI 134
             +  L +DA+L + + + +   L+ + ++  +  +L S+LFGD+L +N  ++ + I  I
Sbjct: 77  LHDPRLPNDALLALCSATLLCSGLLFIQYLPSLRPELLSYLFGDLLTINWDELPIFIVVI 136

Query: 135 GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLIT 194
           GF  + IL++ W+P +   ++ ++A +EG+  +  +LIF+++ +L   ++++ +G  L+ 
Sbjct: 137 GF-ALTILYRYWQPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFTVLALRAVGSLLMG 195

Query: 195 SLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFIL 254
           +LL++P +TAR  + SP+ M I A +   LG+ +GL+ S   +  +G SI++    LF  
Sbjct: 196 ALLVIPALTARLVAHSPKQMVIWAFVFAQLGVSVGLWSSAGLNIATGLSIVLCMSILFGG 255

Query: 255 SFFYKK 260
            F ++K
Sbjct: 256 IFLFQK 261


>gi|71066589|ref|YP_265316.1| ABC zinc transporter, inner membrane subunit ZnuB [Psychrobacter
           arcticus 273-4]
 gi|71039574|gb|AAZ19882.1| ABC zinc transporter, inner membrane subunit ZnuB [Psychrobacter
           arcticus 273-4]
          Length = 277

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 150/252 (59%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G  + L + PLGC ++W+R+A+F D +AH  LLGVAL++ +QLP+ I I ++  + 
Sbjct: 11  AWIAGSILALLSAPLGCLVLWRRMAFFADALAHGTLLGVALAVWWQLPMGIGIALVNVMV 70

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            L L+ I  +E L  DA+L V+  S + L L+ L+ +     ++  FLFG++L ++  D+
Sbjct: 71  VLGLVFID-DERLPVDAVLAVVAVSLLCLGLLTLTQLTDQQANVLGFLFGNLLELDWADL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
            LI G   + + +L  IW   +    +  LA+ +G+ P + +L F+ + +   +++++ +
Sbjct: 130 PLIAGSVLVGLALLIYIWPAQIKLATHEALARIQGINPTRQRLFFMGVLAGFCAIALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LL+LP +TAR +S SP+ M I+A  I  LG+ +G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLVLPALTARLWSASPKQMVIMALCIAQLGVTLGVWGSIWLDIQTGLSIVLVL 249

Query: 249 LFLFILSFFYKK 260
             LF  +    K
Sbjct: 250 ASLFFTALIVSK 261


>gi|322418091|ref|YP_004197314.1| ABC-3 protein [Geobacter sp. M18]
 gi|320124478|gb|ADW12038.1| ABC-3 protein [Geobacter sp. M18]
          Length = 274

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 154/259 (59%), Gaps = 3/259 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---LTICI 61
           F  RAL  G  I +    LG F++ +R++  GD +AH     VAL+L F+L    +T+ I
Sbjct: 11  FMQRALIGGSLIAILCSVLGVFLVLRRLSLIGDGLAHVTFGSVALALFFRLQSVYMTLAI 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +   ++L +L++ +   +  DA +G+++   I+  +++ S     N DL S+LFG+IL
Sbjct: 71  IPVVLASALGILKLAQKARIYGDAAIGMVSAIGIATGVLLASVAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++++++ +   + F+ I  +   +  L A+T + ELAK+ G+  ++I  + +++T+L +
Sbjct: 131 SISSSELAIAAVLFFIVIAGVVMFYNELFASTFDEELAKSSGLDTDRINAVLVLLTALTV 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +++K +GI LI++LLILP V+A + +   +   + A  IG+  +I G+  S + + P+G
Sbjct: 191 VLAMKVVGIMLISALLILPAVSALQIAKGFKTAIVSAAGIGVATVICGISVSFVLNLPTG 250

Query: 242 PSIIITSLFLFILSFFYKK 260
            +I++T+  +F+L+F  + 
Sbjct: 251 ATIVLTNFVVFLLAFAARN 269


>gi|330883538|gb|EGH17687.1| zinc ABC transporter permease [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 160

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 113/159 (71%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +   L +++L+ +Q+ + L+SD 
Sbjct: 2   FVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTVGCLLLAVLLVTLQQRQPLASDT 61

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKI 145
           +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA++  D+  I     L ++++  +
Sbjct: 62  LLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAISPADLTWILDGSALVLVLIVAL 121

Query: 146 WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           W+PLLA TV+ ELA+ EG+    +++  +++ +++I+V+
Sbjct: 122 WRPLLAITVHEELARVEGLPVAALRMALMLLIAVVIAVA 160


>gi|73667132|ref|YP_303148.1| ABC transporter [Ehrlichia canis str. Jake]
 gi|72394273|gb|AAZ68550.1| ABC transporter, family 3 [Ehrlichia canis str. Jake]
          Length = 267

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 155/259 (59%), Gaps = 2/259 (0%)

Query: 3   NE-FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           NE FF+  + + + + L TG LG F+IW+ ++Y GD+I+H+++LGVAL+++  + ++  I
Sbjct: 7   NEYFFVNGVVAILIVSLVTGSLGSFMIWKNLSYLGDSISHASILGVALAILLNISISSGI 66

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             I+ + +L LL    N+  S D +L ++T+  +SL +++LSF     +++   LFGD+L
Sbjct: 67  LCISIIFAL-LLSYSMNKIYSIDTVLSIVTNVIMSLGMILLSFFPSATSNIIHSLFGDVL 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D++++  +  + I I+   WK  L  +++ +L+ +EG+    IKL F++I S+ I
Sbjct: 126 MLTNKDLIIMALVSLIIITIIVYRWKYWLIISISNDLSASEGVNIGFIKLEFLIILSIFI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + + + +GI LIT+ L++P   AR  S +P  M I++TII I   I GL  S  FD   G
Sbjct: 186 AFAAQLVGILLITAFLVIPAAAARLISRTPLQMIIISTIISIFSGITGLLLSEKFDIFPG 245

Query: 242 PSIIITSLFLFILSFFYKK 260
           P II+ S  L +  +   +
Sbjct: 246 PLIIMVSFLLLLCMYCINR 264


>gi|145640368|ref|ZP_01795952.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae R3021]
 gi|145274954|gb|EDK14816.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 22.4-21]
          Length = 171

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 108/168 (64%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKL 171
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K  L
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKCVL 170


>gi|270293211|ref|ZP_06199422.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           M143]
 gi|270279190|gb|EFA25036.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           M143]
          Length = 282

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 148/254 (58%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G L ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMWITIGVGALILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G L  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSGLGALASVVGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|329767717|ref|ZP_08259234.1| membrane protein in scaA 5'region [Gemella haemolysans M341]
 gi|328838955|gb|EGF88547.1| membrane protein in scaA 5'region [Gemella haemolysans M341]
          Length = 279

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 150/258 (58%), Gaps = 2/258 (0%)

Query: 1   MYNEFFIR-ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI 59
           +YN  F++ AL + I I +  G +GCFI+ + ++  GD I+H+ L GVALS I  +   I
Sbjct: 9   LYNFHFLQNALITAIVIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVALSFILGIDFFI 68

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
              +   L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+
Sbjct: 69  GAIVFGLLASIIITFIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGN 127

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV   D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L
Sbjct: 128 ILAVQDVDMYITIGVGVFVLLVITLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTL 187

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +   +++ +G  LI ++LI P  TA  ++ S + M  L++ IG    ++GL+    F+  
Sbjct: 188 VSVTAMQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGACCSVLGLFIGYSFNIA 247

Query: 240 SGPSIIITSLFLFILSFF 257
           +G SI++TS  +F +SFF
Sbjct: 248 AGSSIVLTSAIVFAISFF 265


>gi|226311066|ref|YP_002770960.1| manganese ABC transporter permease protein [Brevibacillus brevis
           NBRC 100599]
 gi|226094014|dbj|BAH42456.1| manganese ABC transporter permease protein [Brevibacillus brevis
           NBRC 100599]
          Length = 286

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  +ALF+ + + L  G +G FII + ++  GD I+H+ L GVALS  F +   +   +
Sbjct: 11  EFLQKALFTSVVVGLICGVIGSFIILRGMSLMGDAISHAVLPGVALSYAFGINFFVGAVL 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              LT++ +  + +N  + +D  +G++  S  ++ +++++ +K  +TDL   LFG++LAV
Sbjct: 71  TGVLTAVGIGYVSQNSRIKNDTAIGILFTSAFAIGIIMVTMLKS-STDLYHILFGNVLAV 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            ++D+ +  GIG + I+ ++  +K LL T+ +  +A A G++   I  + + + +++   
Sbjct: 130 RSSDMWVTVGIGVIVIVTVYAFFKELLLTSFDPTIAAAYGLRNNLIHYLLMTLLTMVTVA 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  LA   G+L  +IGLY S  ++  SG +
Sbjct: 190 SLQTVGIVLVVAMLITPAATAYLLTDRLSIMIFLAGGFGMLSSVIGLYFSFTYNLASGAT 249

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  LF L+F + +
Sbjct: 250 IVVVATVLFFLAFLFSR 266


>gi|93007162|ref|YP_581599.1| hypothetical protein Pcryo_2338 [Psychrobacter cryohalolentis K5]
 gi|92394840|gb|ABE76115.1| ABC-3 [Psychrobacter cryohalolentis K5]
          Length = 277

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 149/252 (59%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G  + L + PLGC ++W+R+A+F D +AH  LLGVAL++ +Q+P+ I I +++ + 
Sbjct: 11  AWIAGSILALLSAPLGCLVLWRRMAFFADALAHGTLLGVALAVWWQMPMGIGIALVSVMV 70

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            L L     +E L +DA+L V+  S + L L+ L+ +     ++  FLFG++L ++  D+
Sbjct: 71  VLGL-AFMDDERLPADAVLAVVAVSLLCLGLLTLTQLTDQQANVLGFLFGNLLELDWADL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
            LI G   + + +L  IW   +    +  LA+ +G+ P + +L F+ + +   +++++ +
Sbjct: 130 PLIAGSVLVGLALLIYIWPAQIKLATHEALARIQGINPTRQRLFFMGVLAGFCAIALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LL+LP +TAR +S SP+ M I+A     LG+ +G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLVLPALTARLWSASPKQMVIIALFTAQLGVTLGVWGSIWLDIQTGLSIVLVL 249

Query: 249 LFLFILSFFYKK 260
             LF  +    K
Sbjct: 250 ASLFFTALIISK 261


>gi|213621459|ref|ZP_03374242.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
          Length = 159

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 109/157 (69%), Gaps = 2/157 (1%)

Query: 105 MKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEG 163
           M  V  DL ++LFGD+LAV   D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G
Sbjct: 2   MSNVRVDLMAYLFGDLLAVTPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDG 60

Query: 164 MQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGI 223
           ++ +++KL+ +++T+L I V++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G+
Sbjct: 61  VKLQRVKLLLMLVTALTIGVTMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGM 120

Query: 224 LGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           + +  GL  S  +DTP+GPS+++ +  LFI S   K+
Sbjct: 121 IAVTGGLTFSAFYDTPAGPSVVLCAALLFIFSMMKKQ 157


>gi|253702188|ref|YP_003023377.1| ABC transporter [Geobacter sp. M21]
 gi|251777038|gb|ACT19619.1| ABC-3 protein [Geobacter sp. M21]
          Length = 274

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 154/255 (60%), Gaps = 3/255 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---LTICI 61
           F  RAL  G  I +    LG F++ +R++  GD +AH     VAL+L+F+L    LT+ I
Sbjct: 11  FMQRALVGGSLIAILCSVLGVFLVLRRLSLIGDGLAHVTFGSVALALLFRLQSVYLTLAI 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +   +S+ +L++ +   +  DA +G+++   I+  +++ S     N DL S+LFG+IL
Sbjct: 71  IPVVLASSMGILKLAQKARIYGDAAIGIVSAIGIATGVMLASVAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++T+++++   +  + I  +   +  L A+T + +LAK+ G+  E+I  + +++T+L +
Sbjct: 131 SISTSELVIAALLFVIVIACVVMFYNELFASTFDEDLAKSSGIDTERINSVLVLMTALTV 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +++K +GI LI++LLILP V+A + +   ++  I A +IG++ +I G+  S + + PSG
Sbjct: 191 VLAMKVVGIMLISALLILPAVSALQIAKGFKSAIITAAVIGVVTVICGISLSFVMNLPSG 250

Query: 242 PSIIITSLFLFILSF 256
            +I++ +  + + +F
Sbjct: 251 ATIVLMNFAVLLGAF 265


>gi|15613953|ref|NP_242256.1| hypothetical protein BH1390 [Bacillus halodurans C-125]
 gi|20455070|sp|Q9KD29|MNTC_BACHD RecName: Full=Manganese transport system membrane protein mntC
 gi|10174006|dbj|BAB05109.1| BH1390 [Bacillus halodurans C-125]
          Length = 292

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 148/256 (57%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            +  +AL + I + +  G +GCFII + +A  GD I+H+ L GV ++ +      I   +
Sbjct: 15  SYLQQALTAAILVGIICGVIGCFIILRGMALMGDAISHAVLPGVVIAYMIGASFFIGAVI 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T+L +  + +N  +  D+ +G++  +  +L +V+++ M+    DL   LFG++LAV
Sbjct: 75  TGVITALAIGYVSQNSRVKEDSAIGILFTAAFALGIVLITGMRGTGVDLWHILFGNVLAV 134

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD+ +  GIG   ++I+   ++PLL +T +  +A+A G+  + I  + +++ SL+   
Sbjct: 135 SRTDLWVTLGIGLFVLLIIILFYRPLLLSTFDPVMAQATGIPVQMIHYLLMLLLSLVTVA 194

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +GI L+ ++LI P  TA   +     M  LA + G++  I G+Y S+I+D  SG S
Sbjct: 195 ALQTVGIVLVVAMLITPGATAYLLTNRLPVMLCLAAMFGVISAIAGIYFSVIYDVASGAS 254

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF L+FF+ 
Sbjct: 255 IVLVASTLFALAFFFS 270


>gi|306829050|ref|ZP_07462241.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus mitis ATCC 6249]
 gi|304428855|gb|EFM31944.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus mitis ATCC 6249]
          Length = 282

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G L ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMWITIGVGALILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTLGATASVLGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|197119894|ref|YP_002140321.1| divalent manganese/zinc ABC transporter membrane protein [Geobacter
           bemidjiensis Bem]
 gi|197089254|gb|ACH40525.1| divalent manganese/zinc ABC transporter, membrane protein
           [Geobacter bemidjiensis Bem]
          Length = 274

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 154/255 (60%), Gaps = 3/255 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---LTICI 61
           F  RAL  G  I +    LG F++ +R++  GD +AH     VAL+L+F+L    +T+ I
Sbjct: 11  FMQRALVGGSLIAILCSVLGVFLVLRRLSLIGDGLAHVTFGSVALALLFRLQSVYMTLAI 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +   +S+ +L++ +   +  DA +G+++   I+  +++ S     N DL S+LFG+IL
Sbjct: 71  IPVVLASSMGILKLAQKARIYGDAAIGIVSAIGIATGVMLASVAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +++++++++   +  + I  +   +  L A+T + +LAK+ G+  E+I  + +++T+L +
Sbjct: 131 SISSSELVIAALLFVIVIACVVMFYNELFASTFDEDLAKSSGIDTERINTVLVLMTALTV 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +++K +GI LI++LLI+P V+A + +   ++  I A +IG++ +I G+  S + + PSG
Sbjct: 191 VLAMKVVGIMLISALLIIPAVSALQIAKGFKSAIITAAVIGVVTVICGISLSFVMNLPSG 250

Query: 242 PSIIITSLFLFILSF 256
            +I++ +  + + SF
Sbjct: 251 ATIVLINFAVLLASF 265


>gi|50913740|ref|YP_059712.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10394]
 gi|50902814|gb|AAT86529.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10394]
          Length = 284

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I ++   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILRVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|332686920|ref|YP_004456694.1| manganese ABC transporter inner membrane permease SitD
           [Melissococcus plutonius ATCC 35311]
 gi|332370929|dbj|BAK21885.1| manganese ABC transporter, inner membrane permease protein SitD
           [Melissococcus plutonius ATCC 35311]
          Length = 280

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 149/258 (57%), Gaps = 2/258 (0%)

Query: 1   MYNEFFIR-ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI 59
           +YN  F++ AL + I I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I
Sbjct: 9   LYNYHFLQNALITAIVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISFILGINFFI 68

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
              +   L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+
Sbjct: 69  GAILFGLLASIIITYIRGNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGN 127

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV  TD  +  G+  + ++++F  +K LL T+ +  +AKA GM+      + +++ +L
Sbjct: 128 ILAVQDTDKWITIGVSIVVLLLIFLFFKELLITSFDPLMAKAMGMKVNFYHYLLMILLTL 187

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +   +++ +G  LI ++LI P  TA  ++ S + M  L+  +G L  IIGL+    F+  
Sbjct: 188 VAVTAMQSVGTILIVAMLITPASTAYLYTNSLKVMIFLSATLGALASIIGLFIGYSFNIA 247

Query: 240 SGPSIIITSLFLFILSFF 257
           +G SI++TS   F++SFF
Sbjct: 248 AGSSIVLTSAVFFVISFF 265


>gi|307705372|ref|ZP_07642233.1| putative manganese ABC transporter permease [Streptococcus mitis
           SK597]
 gi|307621077|gb|EFO00153.1| putative manganese ABC transporter permease [Streptococcus mitis
           SK597]
          Length = 282

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIRGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|307709590|ref|ZP_07646043.1| manganese ABC transporter permease protein [Streptococcus mitis
           SK564]
 gi|307619626|gb|EFN98749.1| manganese ABC transporter permease protein [Streptococcus mitis
           SK564]
          Length = 282

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|322386613|ref|ZP_08060238.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus cristatus ATCC 51100]
 gi|321269286|gb|EFX52221.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus cristatus ATCC 51100]
          Length = 283

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G L ++++   +K LL T+ +  LAKA GM+      + +++ +L+   
Sbjct: 137 QDLDMWISIGVGILVLLVIAIFFKQLLLTSFDPLLAKAMGMKVNFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGAGASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLVSFF 270


>gi|322411278|gb|EFY02186.1| integral membrane protein MtsC [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 282

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 148/259 (57%), Gaps = 5/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + I I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALVTAIVIGVVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGINFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGIILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIG--FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV  +D  +  G+    L I+ILF  +K LL T+ +  LAK+ GM       + +++ +
Sbjct: 129 LAVQDSDKWITIGVSVFVLGIIILF--FKELLITSFDPILAKSMGMNVNAYHYMLMILLT 186

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +G  LI +LLI P  TA  ++ S + M ++++ IG L  ++GLY    F+ 
Sbjct: 187 LVSVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSAIGALSSVLGLYLGYTFNV 246

Query: 239 PSGPSIIITSLFLFILSFF 257
            +G SI++TS  +F++SFF
Sbjct: 247 AAGSSIVLTSAAIFLISFF 265


>gi|94993768|ref|YP_601866.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10750]
 gi|94547276|gb|ABF37322.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10750]
          Length = 284

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M + F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSHHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|332637426|ref|ZP_08416289.1| Hydrophobic membrane protein [Weissella cibaria KACC 11862]
          Length = 279

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 145/252 (57%), Gaps = 1/252 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL +G+ I L +G +G F I Q  A  GD ++H+ L G+A++ +  +P      + 
Sbjct: 16  FLQNALLAGVIIGLVSGVIGAFSILQGTALIGDAMSHAVLPGIAIAALLGIPYYWGAGVF 75

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +L++  I ++  L +DA +G+   S  +L  +I++      T LT  LFG+ILAV+
Sbjct: 76  GLLAALIINFIAEHTPLKTDAAIGLTFSSFFALGTIIMT-AGHSTTKLTDILFGNILAVS 134

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D++    IG + I+++   ++ L  TT +   A+A+G++    + + +++ +L+I V+
Sbjct: 135 GGDLISSLVIGLIVILVVAIFYRELYLTTFDRSYAQAQGIRANLFRNLLVVMITLVIIVA 194

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G+ L+T+LLI P  +AR      + M  L+   G+L   +GL+ S  FD PSGP+I
Sbjct: 195 LRAVGVILVTALLITPAASARLLVKRFQPMIWLSAAFGVLSAFVGLFLSYTFDWPSGPAI 254

Query: 245 IITSLFLFILSF 256
           ++T   +FILSF
Sbjct: 255 VVTGAVIFILSF 266


>gi|325982342|ref|YP_004294744.1| ABC-type transporter, integral membrane subunit [Nitrosomonas sp.
           AL212]
 gi|325531861|gb|ADZ26582.1| ABC-type transporter, integral membrane subunit [Nitrosomonas sp.
           AL212]
          Length = 277

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 145/256 (56%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EFF  AL + + +  S G +G +++ + ++Y G  ++H+A+ G  + +   L        
Sbjct: 11  EFFRHALLAALMVGASGGLIGVYVVLRGMSYVGHGLSHAAIGGAVIGITLNLNFYAGACA 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L + ++ +I +N  +  DA +G++T +  +L + I+S M+    +  + LFG+IL +
Sbjct: 71  MGLLAAFIINKITENNKIKLDAAIGIVTTAMFALGVAIVSKMRNFKQNFEAALFGNILGI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+++I  + F  ++ +F  ++ LL +T + E A+  G++   ++ +F ++ +  +  
Sbjct: 131 TEQDLMIIGLVAFFTLITMFITYRALLFSTFDNEAARVFGIKTVSVQWLFSLLLTFSVIA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+  IG+T++ + LI P +TAR  +    +M I +TIIG +  ++G+Y S IF+  SG +
Sbjct: 191 SLNVIGVTMVAATLIAPAMTARMLTDRFSSMIIYSTIIGAVTGVMGMYLSYIFNVASGTT 250

Query: 244 IIITSLFLFILSFFYK 259
           I++ S+ +F LS   K
Sbjct: 251 IVLFSVLVFGLSMLVK 266


>gi|322392289|ref|ZP_08065750.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus peroris ATCC 700780]
 gi|321144824|gb|EFX40224.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus peroris ATCC 700780]
          Length = 282

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGVDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIVKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|322388253|ref|ZP_08061857.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus infantis ATCC 700779]
 gi|321140925|gb|EFX36426.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus infantis ATCC 700779]
          Length = 282

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIVKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|251781904|ref|YP_002996206.1| metal cation ABC transporter membrane protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|242390533|dbj|BAH80992.1| metal cation ABC transporter membrane protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|323126718|gb|ADX24015.1| integral membrane protein MtsC [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 282

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 148/259 (57%), Gaps = 5/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + I I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALVTAIVIGVVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGINFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGIILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIG--FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV  +D  +  G+    L ++ILF  +K LL T+ +  LAK+ GM       + +++ +
Sbjct: 129 LAVQDSDKWITIGVSVFVLGVIILF--FKELLITSFDPILAKSMGMNVNAYHYMLMILLT 186

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +G  LI +LLI P  TA  ++ S + M ++++ IG L  ++GLY    F+ 
Sbjct: 187 LVSVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSAIGALSSVLGLYLGYTFNV 246

Query: 239 PSGPSIIITSLFLFILSFF 257
            +G SI++TS  +F++SFF
Sbjct: 247 AAGSSIVLTSAAIFLISFF 265


>gi|15674575|ref|NP_268749.1| ABC transporter permease [Streptococcus pyogenes M1 GAS]
 gi|71903025|ref|YP_279828.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS6180]
 gi|71910183|ref|YP_281733.1| manganese transporter membrane protein [Streptococcus pyogenes
           MGAS5005]
 gi|94988004|ref|YP_596105.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS9429]
 gi|94991887|ref|YP_599986.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS2096]
 gi|5932386|gb|AAD56938.1|AF180520_3 integral membrane protein MtsC [Streptococcus pyogenes]
 gi|13621683|gb|AAK33470.1| ABC transporter (permease protein) [Streptococcus pyogenes M1 GAS]
 gi|71802120|gb|AAX71473.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS6180]
 gi|71852965|gb|AAZ50988.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS5005]
 gi|94541512|gb|ABF31561.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS9429]
 gi|94545395|gb|ABF35442.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS2096]
          Length = 284

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|139474303|ref|YP_001129019.1| metal cation ABC transporter membrane protein [Streptococcus
           pyogenes str. Manfredo]
 gi|134272550|emb|CAM30816.1| metal cation ABC transporter membrane protein [Streptococcus
           pyogenes str. Manfredo]
          Length = 284

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|85859047|ref|YP_461249.1| Mn2+/Zn2+ ABC transporter permease [Syntrophus aciditrophicus SB]
 gi|85722138|gb|ABC77081.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Syntrophus aciditrophicus SB]
          Length = 274

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 149/257 (57%), Gaps = 2/257 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFM 63
           F  RAL +G+ I L     G F++ +R++  GD +AH+    VAL+L+F+  PL + + +
Sbjct: 11  FVQRALIAGLFIALLCSTQGVFLVLRRLSLIGDGLAHATFGTVALALLFKSSPLVVSLPL 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + S+ +++I +   L  DA +GVI+   I+  ++I S     N DL SFLFG IL++
Sbjct: 71  V-MICSIGIMKITQKMRLYGDAAIGVISSLGIAGGVMISSLAGGFNVDLFSFLFGSILSI 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  ++ +   +    I+ L   +   L  T + E AKA G+  + +  +F ++T++ + +
Sbjct: 130 SRLEVFIAIILSAAVILFLSFFYNEWLLITFDGESAKAAGINVKALDNVFAILTAITVVL 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K +GI LI+SLLILP VTA + + S     ++A +  +  ++ G+  S   D P+G +
Sbjct: 190 SMKVVGIMLISSLLILPAVTALQLARSFRTTMLIAAVSALTSVLTGIIFSFYLDVPTGAA 249

Query: 244 IIITSLFLFILSFFYKK 260
           I+I +L  FI ++FYK+
Sbjct: 250 IVILNLVFFISAYFYKR 266


>gi|306825724|ref|ZP_07459063.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304432085|gb|EFM35062.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 282

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G L ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMWITIGMGALILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G L  ++GL+     +  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSSLGALASVVGLFIGYSLNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|78778257|ref|YP_394572.1| hypothetical protein Suden_2063 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498797|gb|ABB45337.1| ABC-3 [Sulfurimonas denitrificans DSM 1251]
          Length = 265

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 143/233 (61%), Gaps = 2/233 (0%)

Query: 24  GCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFMIATLTSLVLLQIQKNEALS 82
           G FI+ +R +  G+T+AHSALLGVA+ L+ +  PL + + + A  ++ ++  ++   ++ 
Sbjct: 28  GTFIVLRRYSLIGETLAHSALLGVAIGLVAEYNPLWMAV-LFALFSAWLIEYLRSAFSIY 86

Query: 83  SDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMIL 142
           SDAIL ++   ++SLA++I+S     N  L S+LFG IL+V++ DI++I   G ++++ L
Sbjct: 87  SDAILAILLSGSLSLAIIIVSLGGAFNNSLFSYLFGSILSVSSEDIVVISIFGAISLVTL 146

Query: 143 FKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTV 202
               K       + E+AK  G++   +  + + + +++I++SI+ +G  LI++L+I+PT+
Sbjct: 147 LLFSKEFYFIAYDEEVAKTSGVKVNFLNFLLVSVVAIIIALSIRIVGSLLISALMIIPTI 206

Query: 203 TARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
            A +F        +L+ +I +  ++ G+  S  F  PSG +I++  LF+FILS
Sbjct: 207 AALQFRVGFLKTVLLSLVIALFSVVAGMTLSFYFSLPSGATIVVCVLFIFILS 259


>gi|1171961|sp|P42361|P29K_STRGN RecName: Full=29 kDa membrane protein in scaA 5'region; AltName:
           Full=ORF2
 gi|310632|gb|AAA71946.1| hydrophobic membrane protein [Streptococcus gordonii]
          Length = 278

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIT 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   
Sbjct: 132 QDLDMWISIGVGILVLLVISIFFKQLLLTSFDPLLAQAMGMKVNFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGAGASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 252 IVLTSALIFLVSFF 265


>gi|157150856|ref|YP_001451070.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus gordonii str. Challis substr. CH1]
 gi|157075650|gb|ABV10333.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus gordonii str. Challis substr. CH1]
          Length = 278

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIT 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   
Sbjct: 132 QDLDMWISIGVGILVLLVISIFFKQLLLTSFDPLLAQAMGMKVNFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGAGASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 252 IVLTSALIFLVSFF 265


>gi|15903536|ref|NP_359086.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus pneumoniae R6]
 gi|15459153|gb|AAL00297.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus pneumoniae R6]
          Length = 282

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I + +  G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALITAIVVGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIIKSDTAIGITFSSFLALGIILIGVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLIAPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|262283440|ref|ZP_06061206.1| hydrophobic membrane protein [Streptococcus sp. 2_1_36FAA]
 gi|262260931|gb|EEY79631.1| hydrophobic membrane protein [Streptococcus sp. 2_1_36FAA]
          Length = 283

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   
Sbjct: 137 QDLDMWISIGVGILVLLVISIFFKQLLLTSFDPLLAQAMGMKVNFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGTGASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLVSFF 270


>gi|111657858|ref|ZP_01408572.1| hypothetical protein SpneT_02000955 [Streptococcus pneumoniae
           TIGR4]
 gi|116516771|ref|YP_816918.1| manganese ABC transporter, permease protein, putative
           [Streptococcus pneumoniae D39]
 gi|118090037|ref|YP_873934.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae TIGR4]
 gi|148984082|ref|ZP_01817377.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP3-BS71]
 gi|148988694|ref|ZP_01820127.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP6-BS73]
 gi|148993781|ref|ZP_01823208.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP9-BS68]
 gi|148997699|ref|ZP_01825263.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP11-BS70]
 gi|149006716|ref|ZP_01830402.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP18-BS74]
 gi|149011490|ref|ZP_01832737.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP19-BS75]
 gi|149021259|ref|ZP_01835505.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP23-BS72]
 gi|168483481|ref|ZP_02708433.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC1873-00]
 gi|168486983|ref|ZP_02711491.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC1087-00]
 gi|168488637|ref|ZP_02712836.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae SP195]
 gi|168491469|ref|ZP_02715612.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC0288-04]
 gi|168493550|ref|ZP_02717693.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC3059-06]
 gi|168575163|ref|ZP_02721126.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae MLV-016]
 gi|169833900|ref|YP_001695034.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae Hungary19A-6]
 gi|182684592|ref|YP_001836339.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae CGSP14]
 gi|194398501|ref|YP_002038264.1| manganese ABC transporter permease [Streptococcus pneumoniae G54]
 gi|221232388|ref|YP_002511541.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae ATCC 700669]
 gi|225855079|ref|YP_002736591.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae JJA]
 gi|225857266|ref|YP_002738777.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae P1031]
 gi|225859405|ref|YP_002740915.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae 70585]
 gi|225861478|ref|YP_002742987.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|237649278|ref|ZP_04523530.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CCRI 1974]
 gi|237822415|ref|ZP_04598260.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CCRI 1974M2]
 gi|298230026|ref|ZP_06963707.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298254444|ref|ZP_06978030.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298503394|ref|YP_003725334.1| metal cation ABC superfamily transporter membrane protein
           [Streptococcus pneumoniae TCH8431/19A]
 gi|303255972|ref|ZP_07342000.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae BS455]
 gi|303258579|ref|ZP_07344559.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP-BS293]
 gi|303262666|ref|ZP_07348606.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP14-BS292]
 gi|303263607|ref|ZP_07349529.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS397]
 gi|303266367|ref|ZP_07352256.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS457]
 gi|303268240|ref|ZP_07354038.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS458]
 gi|307068277|ref|YP_003877243.1| Mn2+/Zn2+ ABC transporter permease [Streptococcus pneumoniae AP200]
 gi|307127861|ref|YP_003879892.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae 670-6B]
 gi|85720554|gb|ABC75780.1| putative manganese ABC transporter, permease protein [Streptococcus
           pneumoniae TIGR4]
 gi|116077347|gb|ABJ55067.1| manganese ABC transporter, permease protein, putative
           [Streptococcus pneumoniae D39]
 gi|147756198|gb|EDK63240.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP11-BS70]
 gi|147761631|gb|EDK68595.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP18-BS74]
 gi|147764480|gb|EDK71411.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP19-BS75]
 gi|147923371|gb|EDK74484.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP3-BS71]
 gi|147925895|gb|EDK76970.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP6-BS73]
 gi|147927737|gb|EDK78761.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP9-BS68]
 gi|147930360|gb|EDK81344.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP23-BS72]
 gi|168996402|gb|ACA37014.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae Hungary19A-6]
 gi|172043145|gb|EDT51191.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC1873-00]
 gi|182629926|gb|ACB90874.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae CGSP14]
 gi|183570129|gb|EDT90657.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC1087-00]
 gi|183572592|gb|EDT93120.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae SP195]
 gi|183574185|gb|EDT94713.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC0288-04]
 gi|183576357|gb|EDT96885.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae CDC3059-06]
 gi|183578865|gb|EDT99393.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae MLV-016]
 gi|194358168|gb|ACF56616.1| manganese ABC transporter, permease protein [Streptococcus
           pneumoniae G54]
 gi|220674849|emb|CAR69424.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae ATCC 700669]
 gi|225721272|gb|ACO17126.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae 70585]
 gi|225723699|gb|ACO19552.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae JJA]
 gi|225725213|gb|ACO21065.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae P1031]
 gi|225728155|gb|ACO24006.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298238989|gb|ADI70120.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus pneumoniae TCH8431/19A]
 gi|301794633|emb|CBW37083.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae INV104]
 gi|301800465|emb|CBW33101.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae OXC141]
 gi|301802353|emb|CBW35107.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae INV200]
 gi|302597031|gb|EFL64149.1| metal cation ABC transporter membrane protein [Streptococcus
           pneumoniae BS455]
 gi|302636222|gb|EFL66717.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP14-BS292]
 gi|302640080|gb|EFL70535.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae SP-BS293]
 gi|302642191|gb|EFL72540.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS458]
 gi|302644067|gb|EFL74325.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS457]
 gi|302646645|gb|EFL76870.1| putative manganese ABC transporter permease [Streptococcus
           pneumoniae BS397]
 gi|306409814|gb|ADM85241.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Streptococcus pneumoniae AP200]
 gi|306484923|gb|ADM91792.1| manganese transport system membrane protein MntB [Streptococcus
           pneumoniae 670-6B]
 gi|327389836|gb|EGE88181.1| ABC 3 transport family protein [Streptococcus pneumoniae GA04375]
 gi|332072479|gb|EGI82962.1| ABC 3 transport family protein [Streptococcus pneumoniae GA17570]
 gi|332072817|gb|EGI83298.1| ABC 3 transport family protein [Streptococcus pneumoniae GA17545]
 gi|332073983|gb|EGI84461.1| ABC 3 transport family protein [Streptococcus pneumoniae GA41301]
 gi|332199679|gb|EGJ13754.1| ABC 3 transport family protein [Streptococcus pneumoniae GA41317]
 gi|332200209|gb|EGJ14282.1| ABC 3 transport family protein [Streptococcus pneumoniae GA47368]
 gi|332201075|gb|EGJ15146.1| ABC 3 transport family protein [Streptococcus pneumoniae GA47901]
          Length = 282

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I + +  G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALITAIVVGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIIKSDTAIGITFSSFLALGIILIGVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G   +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAAILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|306827892|ref|ZP_07461159.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus pyogenes ATCC 10782]
 gi|304429811|gb|EFM32853.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus pyogenes ATCC 10782]
          Length = 284

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|307707444|ref|ZP_07643926.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus mitis NCTC 12261]
 gi|307616396|gb|EFN95587.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus mitis NCTC 12261]
          Length = 282

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L ++++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLAAIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G + +++++  +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMFITMGVGAVILLLIWIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++  G    ++GL+     +  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTFGATASVLGLFIGYSLNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T+   F++SFF
Sbjct: 252 IVLTAASFFLISFF 265


>gi|209558942|ref|YP_002285414.1| Integral membrane protein MtsC, ABC transporter [Streptococcus
           pyogenes NZ131]
 gi|209540143|gb|ACI60719.1| Integral membrane protein MtsC, ABC transporter [Streptococcus
           pyogenes NZ131]
          Length = 284

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITYSSFLALGVILIGAAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|19745582|ref|NP_606718.1| integral membrane protein MtsC [Streptococcus pyogenes MGAS8232]
 gi|94989882|ref|YP_597982.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10270]
 gi|19747706|gb|AAL97217.1| integral membrane protein MtsC [Streptococcus pyogenes MGAS8232]
 gi|94543390|gb|ABF33438.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10270]
          Length = 284

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|126640244|ref|YP_001083228.1| high affinity Zn transport protein [Acinetobacter baumannii ATCC
           17978]
          Length = 241

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 141/234 (60%), Gaps = 1/234 (0%)

Query: 27  IIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAI 86
           ++W+R+++F DT+AH  LLGVA++    LPL + +   A L   +L  +  N  L +DA+
Sbjct: 1   MLWRRMSFFADTMAHGTLLGVAIAGALSLPLWLGVAGTAILLVAILWALHDNR-LPNDAL 59

Query: 87  LGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIW 146
           L + + + +   L+ +  +  +  +L S+LFGD+L+++  D+ +   I  +++ IL++ W
Sbjct: 60  LALCSATLLCSGLLFIQHVPSLRPELLSYLFGDLLSIDWPDLPIFTLIIAVSLAILYRYW 119

Query: 147 KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARR 206
           +P +   ++ ++A +EG+  +  +LIF+++ +L   ++++ +G  L+ +LL++P ++AR 
Sbjct: 120 QPQIQIAIDPDIAISEGVNAKWQRLIFMLLLALFTVLALRAVGSLLMGALLVIPALSARL 179

Query: 207 FSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            + SP+ M I A ++  LG+ +GL+ S   +  +G SI++     F L F  +K
Sbjct: 180 LAHSPKQMVIWAFVLAQLGVSVGLWSSAALNISTGLSIVLCMALSFALIFMVQK 233


>gi|161529161|ref|YP_001582987.1| ATP-binding domain-containing protein [Nitrosopumilus maritimus
           SCM1]
 gi|160340462|gb|ABX13549.1| ABC-3 protein [Nitrosopumilus maritimus SCM1]
          Length = 272

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 140/245 (57%), Gaps = 1/245 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL SGI I +    +G F++ +R + FGD IAHS+  G+AL L+  +      + 
Sbjct: 9   SFMHRALISGIAIAILCSVVGLFLVLRRYSLFGDAIAHSSFGGIALGLLAGVYPLWTAYG 68

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           ++ +++L++ +I+    +S DA + V+  S I++ LV++        D+ SFLFG IL V
Sbjct: 69  VSIVSALIITRIKDRFNISGDASIAVLLSSGIAVGLVVIGLSGGFTIDIFSFLFGSILLV 128

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D +LI  +    +++L  +++ +L +T N E AK  G+  EKI  + + +  + +  
Sbjct: 129 SVDDTVLILALTGAILIVLLVLYRQILYSTFNEEQAKVSGIPVEKINYLIVFMAGITVVT 188

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD-TPSGP 242
           SI+ +G+ LI++L ++P V+A  +    +  AI++    I  ++ G+  S IFD TP+G 
Sbjct: 189 SIQLVGVLLISALFVIPNVSAIMYGKGFKQTAIISMSFSIFSVVTGILVSYIFDITPAGT 248

Query: 243 SIIIT 247
            ++I+
Sbjct: 249 IVLIS 253


>gi|21909856|ref|NP_664124.1| integral membrane protein MtsC, ABC transporter (permease protein)
           [Streptococcus pyogenes MGAS315]
 gi|28896449|ref|NP_802799.1| ABC transporter (permease) [Streptococcus pyogenes SSI-1]
 gi|21904043|gb|AAM78927.1| integral membrane protein MtsC, ABC transporter (permease protein)
           [Streptococcus pyogenes MGAS315]
 gi|28811700|dbj|BAC64632.1| putative ABC transporter (permease) [Streptococcus pyogenes SSI-1]
          Length = 284

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVIAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 249 GSSIVLTSAMMFLISFF 265


>gi|56807849|ref|ZP_00365687.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Streptococcus pyogenes M49 591]
          Length = 283

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 9   MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 69  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 128 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 188 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNIAA 247

Query: 241 GPSIIITSLFLFILSFF 257
           G SI++TS  +F++SFF
Sbjct: 248 GSSIVLTSAMMFLISFF 264


>gi|315222470|ref|ZP_07864368.1| metal ion ABC transporter, permease protein [Streptococcus
           anginosus F0211]
 gi|315188438|gb|EFU22155.1| metal ion ABC transporter, permease protein [Streptococcus
           anginosus F0211]
          Length = 287

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASVIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 137 QDIDMWITIGVGIAVLIIIGLFFKELLITSFDPLLAKAMGMPVNLYHYLLMILLTLVAVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M IL++ +G +  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVAMLITPAATAYLYANSLKTMIILSSSLGAIASVLGLFIGYTFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F +SFF
Sbjct: 257 IVLTSAIIFAISFF 270


>gi|319940228|ref|ZP_08014580.1| hypothetical protein HMPREF9459_01570 [Streptococcus anginosus
           1_2_62CV]
 gi|319810530|gb|EFW06866.1| hypothetical protein HMPREF9459_01570 [Streptococcus anginosus
           1_2_62CV]
          Length = 282

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASVIITYIRGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDIDMWITIGVGIAVLIVIGMFFKELLITSFDPLLAKAMGMPVNFYHYLLMILLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M IL++ +G +  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIILSSSLGAIASVLGLFIGYTFNVAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F +SFF
Sbjct: 252 IVLTSAIIFAISFF 265


>gi|158336212|ref|YP_001517386.1| zinc ABC transporter permease [Acaryochloris marina MBIC11017]
 gi|158306453|gb|ABW28070.1| zinc ABC transporter, permease protein [Acaryochloris marina
           MBIC11017]
          Length = 279

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 144/256 (56%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA+ SGI   L+ G LG F I +++++F D + HS LLG++  ++     T  +   
Sbjct: 18  FMQRAVISGILTGLAGGMLGSFTILRQLSFFSDALGHSTLLGLSFGILLGWNPTAIVLPF 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L +L +  + +   L +DA+L ++  S+++LA+++LSF       +   LFGDILAV+
Sbjct: 78  AVLFALGVTYLLERTRLWTDALLNIVYSSSLALAVIVLSFTGTYKGGIHQLLFGDILAVH 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           TTD+ +   +  +  + +   ++  +  T+N  LA A G+     +  FI++ +L++ +S
Sbjct: 138 TTDLFICGALLLVCALYMGLTFRTQMLITLNEPLAVARGVSVSFHRTTFIVLLALVVGIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           IK +G+ LI++ +++P   +R      ++  +L+  +G    ++G+  S   + PSGPSI
Sbjct: 198 IKAVGVLLISAFIVIPACASRLLCRQFKHHIVLSASLGAFSAVVGMLLSAGLNLPSGPSI 257

Query: 245 IITSLFLFILSFFYKK 260
           +I  L +F+ +  Y +
Sbjct: 258 VIAQLGIFMGAMIYPQ 273


>gi|332364319|gb|EGJ42093.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK355]
          Length = 287

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITSIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAKS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+  L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   
Sbjct: 137 QDIDMWISIGVALLVLLVIAIFFKQLLITSFDPLLAQAMGMKVNFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F+ SFF
Sbjct: 257 IVLTSALIFLTSFF 270


>gi|241888769|ref|ZP_04776075.1| metal ion ABC transporter, permease protein [Gemella haemolysans
           ATCC 10379]
 gi|241864445|gb|EER68821.1| metal ion ABC transporter, permease protein [Gemella haemolysans
           ATCC 10379]
          Length = 277

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFI+ + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVALSFILGIDFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L+   
Sbjct: 132 QDIDMYITIGVGVFVLLVIKLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  L++ IG    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGASCSVLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T   +F +SFF
Sbjct: 252 IVLTLAVVFAISFF 265


>gi|290579681|ref|YP_003484073.1| putative Mn/Zn ABC transporter [Streptococcus mutans NN2025]
 gi|254996580|dbj|BAH87181.1| putative Mn/Zn ABC transporter [Streptococcus mutans NN2025]
          Length = 279

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 146/264 (55%), Gaps = 8/264 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L SL++  I++N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILIGLANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   
Sbjct: 132 QDMDKWITLGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF-------FYKK 260
           I++TS  +F+LSF       F+KK
Sbjct: 252 IVLTSALIFLLSFVFAPKQRFFKK 275


>gi|332358585|gb|EGJ36409.1| Mn2+/Zn2+ ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1056]
          Length = 287

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F+LSFF
Sbjct: 257 IVLTSALIFLLSFF 270


>gi|125717137|ref|YP_001034270.1| Mn/Zn ABC transporter permease [Streptococcus sanguinis SK36]
 gi|125497054|gb|ABN43720.1| ABC-type Mn2+/Zn2+ transport systems, permease component, putative
           [Streptococcus sanguinis SK36]
 gi|324992232|gb|EGC24154.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK405]
 gi|324994323|gb|EGC26237.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK678]
 gi|327459149|gb|EGF05497.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1057]
          Length = 287

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|324990407|gb|EGC22345.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK353]
          Length = 287

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|82702359|ref|YP_411925.1| hypothetical protein Nmul_A1230 [Nitrosospira multiformis ATCC
           25196]
 gi|82410424|gb|ABB74533.1| ABC-3 protein [Nitrosospira multiformis ATCC 25196]
          Length = 301

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 139/252 (55%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EFF   L + + +  S G +G  +I + ++Y G  ++H+A  G  +  I  L        
Sbjct: 12  EFFWHGLLATLMVGASCGLIGALVILRGMSYVGHGLSHAAFGGAVVGFILNLNFYAGAGA 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L  L++ +I ++  +  DA +G++T++  +L + I+S ++  +    + LFG+IL +
Sbjct: 72  MGLLAVLLINRITRSGTIKLDAAIGIVTNAMFALGVAIISQVRAFSQSFEAALFGNILGI 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+LLI  +    +  +F +++PLL +T + E A+  G++   ++LIF ++ +L+I  
Sbjct: 132 TEGDLLLIGFVSLSTLTTMFLMYRPLLFSTFDQEAARVFGIRTASVQLIFSLLLTLIIIA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+  +G+T+I + LI P  TAR  +     M I A IIG    + G+Y S IF+T SG +
Sbjct: 192 SMNVVGVTMIAATLITPAATARLMTDCFSRMLIYALIIGGTTGVAGMYLSYIFNTASGAT 251

Query: 244 IIITSLFLFILS 255
           I++    L+ LS
Sbjct: 252 IVLFGASLYCLS 263


>gi|222053161|ref|YP_002535523.1| ABC transporter [Geobacter sp. FRC-32]
 gi|221562450|gb|ACM18422.1| ABC-3 protein [Geobacter sp. FRC-32]
          Length = 273

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 155/259 (59%), Gaps = 5/259 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLI--FQ-LPLTICI 61
           F  RAL  G  I +    LG F++ +R +  GD +AH     VAL+L   FQ + +T+  
Sbjct: 11  FLQRALVGGSLIAVLCSTLGIFLVLRRFSLIGDGLAHVTFGSVALALFLGFQSVLMTVAA 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +  L S+ +L++     +  D  +G+++   I++ +++ S     N DL S+LFG+IL
Sbjct: 71  IPVVLLASIGILKLTDKAKIYGDTAIGIVSSLGIAVGVMLASKAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMI-LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +++ T+ L++  + FL ++I +F  +  L ATT + +LA++ G+Q  +I ++ +++T+L 
Sbjct: 131 SISMTE-LMLAAVLFLVVLISIFFFYNELFATTFDEDLARSAGIQTSRINMVLVLLTALT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + +++K +GI LI++LLILP V+A + + S +     + +IG+  ++I +  SL+ + P+
Sbjct: 190 VVLAMKVVGIMLISALLILPAVSALQLARSFKGAIFSSALIGMGTVMISICLSLVLNLPA 249

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ +  +F  SF ++
Sbjct: 250 GATIVLFNFVIFAASFCFR 268


>gi|325688578|gb|EGD30595.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK72]
 gi|328945315|gb|EGG39468.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1087]
          Length = 287

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|323353547|ref|ZP_08088080.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis VMC66]
 gi|322121493|gb|EFX93256.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis VMC66]
 gi|325689519|gb|EGD31524.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK115]
 gi|325697828|gb|EGD39712.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK160]
          Length = 287

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSAIIFLISFF 270


>gi|315612700|ref|ZP_07887612.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis ATCC 49296]
 gi|315315287|gb|EFU63327.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis ATCC 49296]
          Length = 282

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 148/254 (58%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G + ++I+   +K LL T+ +  LAKA GM  +    + +++ +L+   
Sbjct: 132 QDMDMWITIGVGAIILLIIGIFFKQLLITSFDELLAKAMGMPVDFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G L  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSSLGALASVVGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|327459549|gb|EGF05895.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1]
          Length = 287

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPATTAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|332359369|gb|EGJ37190.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK49]
          Length = 287

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNIAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|329770210|ref|ZP_08261600.1| membrane protein in scaA 5'region [Gemella sanguinis M325]
 gi|328837016|gb|EGF86660.1| membrane protein in scaA 5'region [Gemella sanguinis M325]
          Length = 278

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFI+ + ++  GD I+H+ L GVA+S I  +   I    
Sbjct: 13  HFLQNALITAIVIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVAISYILGIDFFIGAIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGILASVIITFIKGNSIIKSDTAIGITFSSFLALGVILIGVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L+   
Sbjct: 132 QDIDMYITIGVGIFVLLVIRLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  L++ IG +  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGAVCSVLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++T   +F++SFF
Sbjct: 252 IVLTLAAVFVISFF 265


>gi|225870955|ref|YP_002746902.1| metal cation ABC transporter membrane protein [Streptococcus equi
           subsp. equi 4047]
 gi|225700359|emb|CAW94683.1| metal cation ABC transporter membrane protein [Streptococcus equi
           subsp. equi 4047]
          Length = 277

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 150/259 (57%), Gaps = 5/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   + 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGINFFVG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGIANS-STDLFHILFGNI 128

Query: 121 LAVNTTD--ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV  +D  I +I  +  L I++LF  +K LL T+ +  LA++ GM+      + +++ +
Sbjct: 129 LAVQDSDKWITIIVSVFVLAIIVLF--FKELLITSFDPVLARSMGMKVTAYHYLLMILLT 186

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +G  LI ++LI P  TA  ++ S + M ++++ +G +  ++GLY    F+ 
Sbjct: 187 LVSVTAMQSVGTILIVAMLITPAATAYLYANSLKVMLVISSCLGAMTSVLGLYLGYTFNI 246

Query: 239 PSGPSIIITSLFLFILSFF 257
            +G SI++TS  +F++SFF
Sbjct: 247 AAGSSIVLTSAVVFLISFF 265


>gi|332364847|gb|EGJ42616.1| Mn/Zn ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1059]
          Length = 287

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  ++ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYVKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|195978569|ref|YP_002123813.1| ABC metal transporter permease protein MtsC-like [Streptococcus
           equi subsp. zooepidemicus MGCS10565]
 gi|195975274|gb|ACG62800.1| ABC metal transporter permease protein MtsC-like [Streptococcus
           equi subsp. zooepidemicus MGCS10565]
          Length = 277

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 150/259 (57%), Gaps = 5/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGIANS-STDLFHILFGNI 128

Query: 121 LAVNTTD--ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV  +D  I +I  +  L I++LF  +K LL T+ +  LA++ GM+      + +++ +
Sbjct: 129 LAVQDSDKWITIIVSVFVLAIIVLF--FKELLITSFDPVLARSMGMKVTAYHYLLMILLT 186

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +G  LI ++LI P  TA  ++ S + M ++++ +G +  ++GLY    F+ 
Sbjct: 187 LVSVTAMQSVGTILIVAMLITPAATAYLYANSLKVMLVISSCLGAVTSVLGLYLGYTFNI 246

Query: 239 PSGPSIIITSLFLFILSFF 257
            +G SI++TS  +F++SFF
Sbjct: 247 AAGSSIVLTSAVVFLISFF 265


>gi|225868093|ref|YP_002744041.1| metal cation ABC transporter membrane protein [Streptococcus equi
           subsp. zooepidemicus]
 gi|225701369|emb|CAW98429.1| metal cation ABC transporter membrane protein [Streptococcus equi
           subsp. zooepidemicus]
          Length = 277

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 150/259 (57%), Gaps = 5/259 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGINFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNI 128

Query: 121 LAVNTTD--ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV  +D  I +I  +  L I++LF  +K LL T+ +  LA++ GM+      + +++ +
Sbjct: 129 LAVQDSDKWITIIVSVFVLAIIVLF--FKELLITSFDPVLARSMGMKVTAYHYLLMILLT 186

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +G  LI ++LI P  TA  ++ S + M ++++ +G +  ++GLY    F+ 
Sbjct: 187 LVSVTAMQSVGTILIVAMLITPAATAYLYANSLKVMLVISSCLGAVTSVLGLYLGYTFNI 246

Query: 239 PSGPSIIITSLFLFILSFF 257
            +G SI++TS  +F++SFF
Sbjct: 247 AAGSSIVLTSAVVFLISFF 265


>gi|8925938|gb|AAF81673.1|AF232688_2 SloB [Streptococcus mutans]
          Length = 279

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 146/264 (55%), Gaps = 8/264 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L SL++  I++N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILIGLANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   
Sbjct: 132 QDMDKWITLGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF-------FYKK 260
           I++TS  +F++SF       F+KK
Sbjct: 252 IVLTSALIFLISFVFAPKQRFFKK 275


>gi|258545041|ref|ZP_05705275.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
 gi|258519705|gb|EEV88564.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
          Length = 272

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 120/192 (62%)

Query: 22  PLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEAL 81
           P+G  I W+R+ YFG+ ++H++LLG+AL+L   LP  I I+ I  L  L+L  I+++   
Sbjct: 23  PIGALIGWRRLVYFGEALSHASLLGIALALWLGLPPAIGIWSITLLLVLLLYLIERSGRE 82

Query: 82  SSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMI 141
           +   ILG ++H  ++L  +++S M+ V TDL ++LFGDILA    D++ I     ++++ 
Sbjct: 83  NPSNILGSLSHIALALGYLVMSQMENVRTDLLAYLFGDILATEAHDLVAIAIAAAVSLLA 142

Query: 142 LFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPT 201
           L  +W+PL+  TV+  +AK E     +  L+F+++  L I  ++++ G+ L+ +LLI+P 
Sbjct: 143 LRVLWQPLILMTVSPAIAKTEYPASRRYDLVFLLLIGLFIGTTVQYFGLLLVIALLIIPA 202

Query: 202 VTARRFSTSPEN 213
            TA R + +PE 
Sbjct: 203 NTANRLAKTPEQ 214


>gi|327468666|gb|EGF14145.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK330]
          Length = 287

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|325693839|gb|EGD35758.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK150]
          Length = 287

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|327490750|gb|EGF22531.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1058]
          Length = 287

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|322374772|ref|ZP_08049286.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           C300]
 gi|321280272|gb|EFX57311.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           C300]
          Length = 282

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G + ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMWITIGVGAIILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTLGATASVLGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|312863037|ref|ZP_07723275.1| metal ion ABC transporter, permease protein [Streptococcus
           vestibularis F0396]
 gi|322516021|ref|ZP_08068959.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus vestibularis ATCC 49124]
 gi|311100573|gb|EFQ58778.1| metal ion ABC transporter, permease protein [Streptococcus
           vestibularis F0396]
 gi|322125556|gb|EFX96897.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus vestibularis ATCC 49124]
          Length = 277

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVA+S I  +   I    
Sbjct: 13  HFLQNALITAIAIGIVAGVVGCFIILRGMSLMGDAISHAVLPGVAMSFILGINFFIGAIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAIGITFSSFLALGVILIGIAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDQDMWMTIGVGVAVLLVICLLFRPLLLTSFDPVLAQSMGVRVKVYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  I+GL+    F+   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYTKSLWSMMLLSSGLGALASILGLFIGYSFNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|24378697|ref|NP_720652.1| putative Mn/Zn ABC transporter [Streptococcus mutans UA159]
 gi|24376561|gb|AAN57958.1|AE014869_3 putative Mn/Zn ABC transporter [Streptococcus mutans UA159]
          Length = 279

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 146/264 (55%), Gaps = 8/264 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L SL++  I++N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILIGLANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   
Sbjct: 132 QDMDKWITVGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF-------FYKK 260
           I++TS  +F++SF       F+KK
Sbjct: 252 IVLTSALIFLISFVFAPKQRFFKK 275


>gi|331266869|ref|YP_004326499.1| ABC transporter membrane-spanning permease-manganese transport
           [Streptococcus oralis Uo5]
 gi|326683541|emb|CBZ01159.1| ABC transporter membrane-spanning permease-manganese transport
           [Streptococcus oralis Uo5]
          Length = 282

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+ +  G+G + ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDTDMWITIGVGAIILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSTLGATASVLGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|401551|sp|P31309|P29K_STRPA RecName: Full=29 kDa membrane protein in fimA 5'region; AltName:
           Full=ORF1
 gi|153833|gb|AAA53076.1| ORF1; putative [Streptococcus parasanguinis]
          Length = 280

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAIGITFSSFLALGVILIGVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDQDMWMTIGVGVTVLLVICLLFRPLLLTSFDPVLAQSMGVRVKIYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  I+GL+     +   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLWSMMLLSSSLGALASILGLFIGYSLNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|327472962|gb|EGF18389.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK408]
          Length = 287

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 143/254 (56%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 18  HFLQNAFITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGVNFFIGAIT 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 78  FGLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   
Sbjct: 137 QDIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVT 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 197 AMQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSS 256

Query: 244 IIITSLFLFILSFF 257
           I++TS  +F++SFF
Sbjct: 257 IVLTSALIFLISFF 270


>gi|310780165|ref|YP_003968497.1| ABC-3 protein [Ilyobacter polytropus DSM 2926]
 gi|309749488|gb|ADO84149.1| ABC-3 protein [Ilyobacter polytropus DSM 2926]
          Length = 274

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 149/260 (57%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIF 62
            F  RA+ SGI I LS   LG F++ + ++  GD +AH A   VAL ++  L P+ + + 
Sbjct: 13  SFIQRAILSGIFISLSCSFLGPFLVLKNLSLIGDGLAHVAFATVALGIMLSLSPILVSVP 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++  + S ++L++ +   +  DA +G+++   +SL ++I S  K  N DL SFLFG+IL 
Sbjct: 73  LV-IMASFLILKLNEKANIDGDAAIGLVSSLAVSLGVLIASLSKGFNVDLFSFLFGNILI 131

Query: 123 VNTTDILL--IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +   +I++  I  +  +  +ILF  +  L   T + E A ++G+    +  + I++TS+ 
Sbjct: 132 ITKGEIIMSGILCVTVVAGVILF--YPDLFTITYDEEFAVSQGLNVRLLNQLLIILTSVT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++ I+ +G  LI+SL++ P VTA + +   ++    + +     +I+G++ S I D P+
Sbjct: 190 IALGIRIVGTMLISSLIVFPAVTALQVAKGFKSTLAFSALFSSTSVILGIFTSYILDIPT 249

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +I+I +   FI +F +KK
Sbjct: 250 GATIVIINSIYFISAFVFKK 269


>gi|22537674|ref|NP_688525.1| manganese ABC transporter permease [Streptococcus agalactiae
           2603V/R]
 gi|25011628|ref|NP_736023.1| hypothetical protein gbs1587 [Streptococcus agalactiae NEM316]
 gi|76788539|ref|YP_330160.1| metal ABC transporter permease [Streptococcus agalactiae A909]
 gi|77406839|ref|ZP_00783869.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae H36B]
 gi|77409235|ref|ZP_00785943.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae COH1]
 gi|77412531|ref|ZP_00788827.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae CJB111]
 gi|22534562|gb|AAN00398.1|AE014262_3 manganese ABC transporter, permease protein [Streptococcus
           agalactiae 2603V/R]
 gi|24413168|emb|CAD47246.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76563596|gb|ABA46180.1| metal ABC transporter, permease protein [Streptococcus agalactiae
           A909]
 gi|77161416|gb|EAO72431.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae CJB111]
 gi|77172148|gb|EAO75309.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae COH1]
 gi|77174551|gb|EAO77390.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae H36B]
          Length = 277

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 142/256 (55%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  + I I +  G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNAFITAIVIGIVAGAVGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L+S+++  I++N  +  D  +G+   S ++L ++++       TDL   LFG+ILAV
Sbjct: 73  FGLLSSIIITYIKENSVIKGDTAIGITFSSFLALGIILIGLANS-TTDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D  +   +G + + ++   +K LL T+ +  LAK+ GM+      + +++ +L+   
Sbjct: 132 QDSDKYMTIIVGLIVLTLITIFFKELLLTSFDPVLAKSMGMRVSFYHYLLMILLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  +  S   M  L++ +G +  ++GLY    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYVKSLRTMLFLSSALGAVASVLGLYIGYTFNIAAGSS 251

Query: 244 IIITSLFLFILSFFYK 259
           I++TS F+F+L+F + 
Sbjct: 252 IVLTSTFMFLLAFLFS 267


>gi|332798122|ref|YP_004459621.1| ABC transporter integral membrane subunit [Tepidanaerobacter sp.
           Re1]
 gi|332695857|gb|AEE90314.1| ABC-type transporter, integral membrane subunit [Tepidanaerobacter
           sp. Re1]
          Length = 270

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 150/254 (59%), Gaps = 5/254 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIF 62
           +F  RA  +GI   L    +G FI+ +R++  GD+++H+AL GVA  ++  + P      
Sbjct: 8   DFMQRAFMAGIITALLASVMGVFIVLRRMSMVGDSLSHAALAGVAGGMLVGIYPFYGA-- 65

Query: 63  MIATLTSLVLLQIQKNE-ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           +I +  + VL++I ++  +  ++  L V+    + LA+V +S  K  N DL S+LFG ++
Sbjct: 66  LIFSGAAAVLIEIIRSAFSKYAEVALAVVLSGGMGLAVVFISIGKSFNADLMSYLFGSLV 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV++ D+LLI  +GF+ +  +  +++ L + T + E A+  G+  + + + F ++T+L++
Sbjct: 126 AVSSQDLLLIAILGFIIMFSMILLYRELFSITFDEEAARLSGIPVKAVNMYFTLMTALVV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD-TPS 240
           ++SI+ +G  LI++L+++P     + + S ++  I+A  + I  ++ GLY S IFD  P 
Sbjct: 186 ALSIRVVGALLISALMVIPAAVGMQLAKSFKSTFIIAVGVAIFSVVSGLYTSFIFDLAPG 245

Query: 241 GPSIIITSLFLFIL 254
           G  ++I +  L I+
Sbjct: 246 GTIVLIATAILMIV 259


>gi|67078362|ref|YP_245980.1| manganese ABC transporter, permease [Bacillus cereus E33L]
 gi|66970668|gb|AAY60642.1| manganese ABC transporter, permease [Bacillus cereus E33L]
          Length = 288

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I 
Sbjct: 11  MQYSFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 71  AVLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++
Sbjct: 130 LSVRSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMV 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  S
Sbjct: 190 TVASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLAS 249

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ + FLF L+FF+ 
Sbjct: 250 GATIVLVATFLFGLAFFFS 268


>gi|312867997|ref|ZP_07728201.1| metal ion ABC transporter, permease protein [Streptococcus
           parasanguinis F0405]
 gi|311096401|gb|EFQ54641.1| metal ion ABC transporter, permease protein [Streptococcus
           parasanguinis F0405]
          Length = 280

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASVLITYIKSNSIIKSDTAIGITFSSFLALGVILIGVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDRDMWITIGVGAAVLLVIVLLFRPLLLTSFDPVLAQSMGVRVKVYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  I+GL+     +   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYTNSLWSMMLLSSGLGALASILGLFIGYSLNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|229134018|ref|ZP_04262838.1| Manganese transport system membrane protein mntC [Bacillus cereus
           BDRD-ST196]
 gi|228649353|gb|EEL05368.1| Manganese transport system membrane protein mntC [Bacillus cereus
           BDRD-ST196]
          Length = 278

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 153/261 (58%), Gaps = 5/261 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I 
Sbjct: 1   MQYGFLQKALLTSVMVGVICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 61  AVLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNV 119

Query: 121 LAVNTTDI--LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           L+V ++D+   LI G+  ++++ILF  +K LL +T +  +A++ G+  + I    +++ +
Sbjct: 120 LSVRSSDMWMTLIIGVVIISLVILF--YKELLVSTFDPTMAQSYGLPNKWIHYGLMILLT 177

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           ++   S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++ 
Sbjct: 178 MVTVASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNL 237

Query: 239 PSGPSIIITSLFLFILSFFYK 259
            SG +I++ + FLF L+FF+ 
Sbjct: 238 ASGATIVLVATFLFGLAFFFS 258


>gi|188587395|ref|YP_001918940.1| ABC-3 protein [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352082|gb|ACB86352.1| ABC-3 protein [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 289

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 149/256 (58%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           ++   A+ +G  + +  G +GCFII +R++  GD I+H+ L GV +S +  +   I   +
Sbjct: 21  QYLQNAIIAGTLVGILCGVIGCFIILRRLSLMGDAISHAVLPGVVISYMLGITFFIGAVI 80

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L +  + +N  L  D+ +G++  +  +L +V+++ +     DL   LFG++LAV
Sbjct: 81  TGVATALGIGYVSQNSKLKDDSSIGILFTAAFALGIVMITALDGTEVDLWHILFGNVLAV 140

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+LL    G ++++ +F  ++ L+ +T +  +A+A G+  +K+  + +++ SL+   
Sbjct: 141 SRSDLLLTASTGIVSLIGIFIYYRELVISTFDPIMARAIGIATDKLHYLLMLLLSLVTVA 200

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   + +   M IL+ IIG++  + G+Y S I+D  +G +
Sbjct: 201 SLQTVGIVLVVAMLITPAATAFLLTRNLARMLILSAIIGVISSLAGVYFSFIYDVATGGA 260

Query: 244 IIITSLFLFILSFFYK 259
           I++    LF+ +F + 
Sbjct: 261 IVLAVSVLFLAAFLFS 276


>gi|172058754|ref|YP_001815214.1| ABC-3 protein [Exiguobacterium sibiricum 255-15]
 gi|171991275|gb|ACB62197.1| ABC-3 protein [Exiguobacterium sibiricum 255-15]
          Length = 286

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 143/256 (55%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  ++L + + + +  G +GCFII + ++  GD I+H+ L GVA+S +  +   I    
Sbjct: 14  DFLQKSLVTSVMVGIICGVIGCFIILRGMSLMGDAISHAVLPGVAISYLLGINFFIGAVA 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              LT+L +  + +N  + +D  +G++  S  +L ++++SF++  ++DL   LFG++LAV
Sbjct: 74  TGLLTALGIGFVSQNSRIKNDTAIGILFTSAFALGIILISFLR-SSSDLYHILFGNVLAV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ +   IG + +  +F  +K LL T+ +  +A A G+    I  + + + +L+   
Sbjct: 133 RPSDMWMTLAIGLIVLAAIFLFYKELLVTSFDPTMAAAYGLSTRLIHYLLMTMLTLVTVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  L+  +G +  ++GLY S  ++  SG S
Sbjct: 193 SLQTVGIILVVAMLITPAATAYLLTNRLSRMIFLSAGLGTISSVVGLYFSFTYNLSSGAS 252

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF L F + 
Sbjct: 253 IVLVATALFALVFIFS 268


>gi|22298044|ref|NP_681291.1| zinc ABC transporter, permease protein [Thermosynechococcus
           elongatus BP-1]
 gi|22294222|dbj|BAC08053.1| zinc ABC transporter, permease protein [Thermosynechococcus
           elongatus BP-1]
          Length = 284

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 147/251 (58%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL++GI      G LG F I +++++F D + HSALLG++L +I  L  ++ +   
Sbjct: 14  FMQRALWAGIFTGGMAGALGSFTILRQLSFFSDALGHSALLGISLGIILGLNPSLMLLPF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A + +L +  + ++  L +DA+L +I   +++LA+V+LS        L + LFGDILAV 
Sbjct: 74  AVVFALGVTYLLEHTRLWTDALLNIIYSGSLALAVVLLSLSDRYQGGLNNLLFGDILAVR 133

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+++   +  L  + L    +  L  TVN  LA A+G    + +L+FI + +L+++VS
Sbjct: 134 PADLVMSGTLCTLVGLFLLLTLRVQLLITVNEALAVAQGAAVRRQRLLFITLLALVVAVS 193

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           IK +G+ LI++ +++P   AR +S       +LA ++G+   I+G+  S   + PSGPSI
Sbjct: 194 IKTVGVLLISAFVVIPACGARLWSRQFSQYVVLAALVGVGSAIVGMLVSAGMNWPSGPSI 253

Query: 245 IITSLFLFILS 255
           ++  L  F++S
Sbjct: 254 VVCQLAFFLIS 264


>gi|330720447|gb|EGG98758.1| Zinc ABC transporter2C inner membrane permease protein ZnuB [gamma
           proteobacterium IMCC2047]
          Length = 163

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 108/150 (72%), Gaps = 2/150 (1%)

Query: 108 VNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQP 166
           V  DL  +LFGD+L V   ++L I+ IG   I+ +L   W+PLLA TV+ +LA+AEG   
Sbjct: 4   VRVDLLGYLFGDLLTVTGDELLWIY-IGVAAILSLLLVFWRPLLAITVDEDLAQAEGYPV 62

Query: 167 EKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGI 226
             I+L+ +++ +++I+V++K +G+ LITSL+++P   ARR + +PE MA L++++G L +
Sbjct: 63  LWIRLLLMLLIAIVIAVAMKIVGVLLITSLMVIPAACARRLTNTPETMAALSSLLGCLAV 122

Query: 227 IIGLYGSLIFDTPSGPSIIITSLFLFILSF 256
           ++GL+GSL +DTP+GPSI++ +  LF+L +
Sbjct: 123 MMGLFGSLQWDTPTGPSIVVGATGLFLLVY 152


>gi|152977310|ref|YP_001376827.1| ABC-3 protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152026062|gb|ABS23832.1| ABC-3 protein [Bacillus cytotoxicus NVH 391-98]
          Length = 288

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 151/260 (58%), Gaps = 3/260 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +F +   I 
Sbjct: 11  MQYGFLQKALLTSVMVGIIGGVIGCFIILRGMALMGDAISHAVLPGVALSYMFGMDYFIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 71  AVFTGVITAVGIGFVSQNSRIKQDMAIGIMFTSVFAIGIILITFMK-SSSDLYHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   IG + I ++   +K LL +T +  +A++ G+ P K+    +M+   M
Sbjct: 130 LAVRSSDMWMTLVIGIIIIGLVILFYKELLVSTFDPIMAQSYGL-PNKLIHYGLMVLLTM 188

Query: 181 ISV-SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           ++V S++ +GI L+ S+LI P  TA   +     M  LAT IG    ++GLY S  ++  
Sbjct: 189 VTVASLQTVGIILVVSMLITPAATAYLLTNRLWIMIYLATGIGAFSSVVGLYFSFSYNLA 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SG +I++ + FLF L+FF+ 
Sbjct: 249 SGAAIVLVATFLFGLAFFFS 268


>gi|75763114|ref|ZP_00742891.1| Manganese transport system membrane protein mntB [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218898239|ref|YP_002446650.1| metal ABC transporter, permease protein [Bacillus cereus G9842]
 gi|74489399|gb|EAO52838.1| Manganese transport system membrane protein mntB [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218540730|gb|ACK93124.1| metal ABC transporter, permease protein [Bacillus cereus G9842]
          Length = 288

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 148/256 (57%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I   +
Sbjct: 14  SFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGAVL 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++L+V
Sbjct: 74  TGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNVLSV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++   
Sbjct: 133 RSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVTVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  SG +
Sbjct: 193 SLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASGAT 252

Query: 244 IIITSLFLFILSFFYK 259
           I++ + FLF L+FF+ 
Sbjct: 253 IVLVATFLFGLAFFFS 268


>gi|297243292|ref|ZP_06927226.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis AMD]
 gi|296888699|gb|EFH27437.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis AMD]
          Length = 287

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 132/237 (55%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
            G +GC+++ + +A+ GD +AHS   G+A++ + Q  L +   +    T+L++    +N 
Sbjct: 33  CGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLLGGALAGVATALIVSIFSQNR 92

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
            L  D+ +GV   S  +L +VI+S        L SFLFG I  +  +DI ++   G + +
Sbjct: 93  RLREDSFIGVFFVSAFALGIVIISKASGYAGSLESFLFGSITGIPDSDIAVVAITGLIIL 152

Query: 140 MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLIL 199
            IL    K L+  +++ E ++A G+    +  +  ++ ++ + VS++ IG  L+ +LL+ 
Sbjct: 153 AILCMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVSVQIIGNVLVLALLVT 212

Query: 200 PTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSF 256
           P  TAR  +     M +LA +IG +  I+G+Y S  FDT +G +I++ +  LF+L++
Sbjct: 213 PAATARLLTDRLSRMMVLAPVIGCVSSIVGMYISWSFDTATGGTIVLVATALFVLAW 269


>gi|254456756|ref|ZP_05070184.1| ABC-3 [Campylobacterales bacterium GD 1]
 gi|207085548|gb|EDZ62832.1| ABC-3 [Campylobacterales bacterium GD 1]
          Length = 265

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 151/258 (58%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIF 62
           +F  RA  +G+ I +     G FI+ +R +   +T+AHSAL+GVA+ L+  L PL + + 
Sbjct: 8   DFMQRAFLAGMIIAVLASVSGTFIVLRRYSMISETLAHSALVGVAVGLVAGLNPLWMAV- 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +++ L++ ++  ++ + +L SDA+L ++   ++++A++I+S     N  L S+LFG IL+
Sbjct: 67  IVSILSAWLIEYLRAHFSLYSDAVLAILLSGSLAIAVIIVSLGGAFNNSLFSYLFGSILS 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D++ I   GFL + IL    K       + E+AK  G++ + +  + + I +++I+
Sbjct: 127 VSGADVITILVFGFLCLGILLLFAKEFYFIAYDEEVAKTSGIKVKLLNFLLVSIVAVIIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +SI+ +G  LI +L+++PTV+A ++        +++    +  +  G+  S  F  PSG 
Sbjct: 187 LSIRVVGSLLIGALMVIPTVSALQYRQGFVRTLLISLFFALFSVASGMTLSFYFSLPSGA 246

Query: 243 SIIITSLFLFILSFFYKK 260
           +I+++ L +FI+S    K
Sbjct: 247 TIVLSVLVVFIISLIVNK 264


>gi|296877196|ref|ZP_06901236.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus parasanguinis ATCC
           15912]
 gi|296431716|gb|EFH17523.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus parasanguinis ATCC
           15912]
          Length = 280

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAIGITFSSFLALGVILIGVAK-SSTDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  GIG   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDQDMWMTIGIGVAVLLVIVLLFRPLLLTSFDPVLAQSMGIRVKVYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ +  +M +L++ +G L  I+GL+     +   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANNLWSMMLLSSSLGALASILGLFIGYSLNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|283783675|ref|YP_003374429.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis 409-05]
 gi|298252866|ref|ZP_06976660.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis 5-1]
 gi|283441968|gb|ADB14434.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis 409-05]
 gi|297533230|gb|EFH72114.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis 5-1]
          Length = 287

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 131/237 (55%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
            G +GC+++ + +A+ GD +AHS   G+A++ + Q  L     +    T+L++    +N 
Sbjct: 33  CGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLFGGALAGVATALIVSIFSQNR 92

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
            L  D+ +GV   S  +L +VI+S        L SFLFG I  +  +DI ++   G + +
Sbjct: 93  RLREDSFIGVFFVSAFALGIVIISKASGYAGSLESFLFGSITGIPDSDIAVVAFTGLIIL 152

Query: 140 MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLIL 199
            IL    K L+  +++ E ++A G+    +  +  ++ ++ + VS++ IG  L+ +LL+ 
Sbjct: 153 AILCMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVSVQIIGNVLVLALLVT 212

Query: 200 PTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSF 256
           P  TAR  +     M ILA +IG +  I+G+Y S  FDT +G +I++ +  LF+L++
Sbjct: 213 PAATARLLTDRLPRMMILAPVIGCVSSIVGMYISWSFDTATGGTIVLVATALFVLAW 269


>gi|289167483|ref|YP_003445752.1| ABC transporter membrane-spanning permease-manganese transport
           [Streptococcus mitis B6]
 gi|307707023|ref|ZP_07643820.1| ABC transporter, permease protein [Streptococcus mitis SK321]
 gi|288907050|emb|CBJ21884.1| ABC transporter membrane-spanning permease-manganese transport
           [Streptococcus mitis B6]
 gi|307617549|gb|EFN96719.1| ABC transporter, permease protein [Streptococcus mitis SK321]
          Length = 282

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 136/233 (58%), Gaps = 1/233 (0%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSD 84
           CFII + ++  GD I+H+ L GVALS I  L   I   +   L ++++  I+ N  + SD
Sbjct: 34  CFIILRGMSLMGDAISHAVLPGVALSFILGLDFFIGAIVFGLLAAIIITYIKGNSIIKSD 93

Query: 85  AILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFK 144
             +G+   S ++L ++++S  K  +TDL   LFG+ILAV  TD+ +  G+G   +++++ 
Sbjct: 94  TAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAVQDTDMFITMGVGAAILLLIWI 152

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            +K LL T+ +  LAKA GM       + +++ +L+   +++ +G  LI ++LI P  TA
Sbjct: 153 FFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVTAMQSVGTILIVAMLITPAATA 212

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFF 257
             ++ S ++M  L++  G    ++GL+    F+  +G SI++T+   F++SFF
Sbjct: 213 YLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSSIVLTAASFFLISFF 265


>gi|317495792|ref|ZP_07954155.1| ABC 3 transporter [Gemella moribillum M424]
 gi|316913969|gb|EFV35452.1| ABC 3 transporter [Gemella moribillum M424]
          Length = 279

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 147/258 (56%), Gaps = 2/258 (0%)

Query: 1   MYNEFFIR-ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI 59
           +YN  F++ AL + I I +  G +GCFI+ + ++  GD I+H+ L GVA+S I  +   I
Sbjct: 9   LYNFHFLQNALITAIIIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVAVSYILGIDFFI 68

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
                  L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+
Sbjct: 69  GAIAFGLLASIIITFIKGNSIIKSDTAIGITFSSFLALGVILIGVANS-STDLFHILFGN 127

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILAV   D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L
Sbjct: 128 ILAVQDIDMYITIGVGVFVLLVIKLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTL 187

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +   +++ +G  LI ++LI P  TA  ++ S + M  L++ IG +  ++GL+    F+  
Sbjct: 188 VSVTAMQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGAVCSVLGLFIGYSFNIA 247

Query: 240 SGPSIIITSLFLFILSFF 257
           +G SI++T   +F +SFF
Sbjct: 248 AGSSIVLTLATVFAISFF 265


>gi|332976836|gb|EGK13662.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Psychrobacter sp. 1501(2011)]
          Length = 264

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 144/237 (60%), Gaps = 1/237 (0%)

Query: 24  GCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSS 83
           GC ++W+R+++F D +AH  L GVAL+ ++QLP  I I +++ +  + LL ++ +  L S
Sbjct: 27  GCLVLWRRMSFFADALAHGTLFGVALAALWQLPFAIGIALVSVMVVIGLLWLEDDR-LPS 85

Query: 84  DAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILF 143
           DAIL V++ S + L L+ L+ +  +  ++  +LFG++L V+ +D+ ++     + I  L 
Sbjct: 86  DAILAVVSVSMLCLGLLTLTHLTQMQANVLGYLFGNLLEVSWSDLPVLSLCVAVGIAFLT 145

Query: 144 KIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVT 203
            IW+P +    + +LA+  G+   + +L F+ + +   +++++ +G  LI+ LLILP +T
Sbjct: 146 YIWRPQVILATHADLAQVSGINATRQRLFFMGVLAGFCALALQAVGSLLISGLLILPALT 205

Query: 204 ARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           AR ++ SP+ M + A I+  L +  G++GS++ D  +G +I++    +F  SF   +
Sbjct: 206 ARLWAHSPKQMVVYALILAQLAVSAGVWGSVLLDIQTGLAIVLGLALVFFSSFVVSR 262


>gi|77414595|ref|ZP_00790737.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae 515]
 gi|77159356|gb|EAO70525.1| manganese ABC transporter, permease protein [Streptococcus
           agalactiae 515]
 gi|319745470|gb|EFV97774.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus agalactiae ATCC 13813]
          Length = 277

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 142/256 (55%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  + I I +  G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNAFITAIVIGIVAGAVGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L+S+++  I++N  +  D  +G+   S ++L ++++       T+L   LFG+ILAV
Sbjct: 73  FGLLSSIIITYIKENSVIKGDTAIGITFSSFLALGIILIGLANS-TTNLFQILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D  +   +G + + ++   +K LL T+ +  LAK+ GM+      + +++ +L+   
Sbjct: 132 QDSDKYMTIIVGLIVLTLITIFFKELLLTSFDPVLAKSMGMRVSFYHYLLMILLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  +  S   M  L++ +G +  ++GLY    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYVKSLRTMLFLSSALGAVASVLGLYIGYTFNIAAGSS 251

Query: 244 IIITSLFLFILSFFYK 259
           I++TS F+F+L+F + 
Sbjct: 252 IVLTSTFMFLLAFLFS 267


>gi|220907330|ref|YP_002482641.1| ABC transporter [Cyanothece sp. PCC 7425]
 gi|219863941|gb|ACL44280.1| ABC-3 protein [Cyanothece sp. PCC 7425]
          Length = 280

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 144/254 (56%), Gaps = 10/254 (3%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA+  GI   L  G LG F I +++++F D + HSALLG+++ L+  +  ++ +   
Sbjct: 18  FMQRAMLGGILTGLMGGTLGSFTILRQLSFFSDALGHSALLGISVGLLLGINPSVVLLPF 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L +L +  + +   L +DA+L +I  S++++A++ LSF+      + + LFGDILAV 
Sbjct: 78  AVLFALGVTYLLERTRLWTDALLNIIYSSSLAIAIITLSFVGRYKGGINNLLFGDILAVG 137

Query: 125 TTD-----ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
             D     +LL+  I F+ + +     +  +  T++  LA A G+     + +FI++ SL
Sbjct: 138 ELDLAFSAVLLVACILFVGLTL-----RTQMLITLHEPLAIARGVSVTTHRTLFIVLLSL 192

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           ++ +SIK IG+ L+++ +++P   AR  S +  +  + +  +G    + G+  S  F+ P
Sbjct: 193 VVGISIKAIGVLLVSAFIVIPACAARLLSHTFTHYILFSAALGAGSAVTGMVVSAAFNLP 252

Query: 240 SGPSIIITSLFLFI 253
           SGPSI+ T L +F+
Sbjct: 253 SGPSIVATQLTIFL 266


>gi|125623968|ref|YP_001032451.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|124492776|emb|CAL97731.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|300070741|gb|ADJ60141.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris NZ9000]
          Length = 279

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 142/253 (56%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I    
Sbjct: 13  HFLQNALITAVVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L+SL++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLSSLIITYIKNNSLIKGDTAIGITFSSFLALGIILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  L  G+    ++++   +K LL T+ +  +AKA GM+      + +++ +L+   
Sbjct: 132 QDIDKWLTIGVSIFVLIVIALFFKQLLITSFDPLMAKAIGMKVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M IL++ IG +  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYTNSLKKMLILSSSIGAISSVLGLFIGYTFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I+ITS  +F +SF
Sbjct: 252 IVITSAIIFAVSF 264


>gi|70725143|ref|YP_252057.1| hypothetical protein SH0142 [Staphylococcus haemolyticus JCSC1435]
 gi|68445867|dbj|BAE03451.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 278

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + +  G +G  II + ++  GD ++H+ L GVALS +F +P+ +   +
Sbjct: 12  QFLNRALITSIVVGIVCGTVGSLIILRGLSLMGDAMSHAVLPGVALSFLFNIPMFVGALV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + SL++  I  N     DA +G+   + ++  ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMIASLLIGYISNNSKTKPDAAIGISFTAFLATGVIIISLINS-TTDLHHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
                     IG + I+++  +++PL+ +T +   ++  G+    I    +++ +L+   
Sbjct: 131 TRQTFWTTIIIGVIVILLIVILYRPLMISTFDATFSRVSGLNTTMIHYFIMLLLALVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LL+ P  TA   + +  +M I+A++IGI+  IIGLY S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLVTPASTAFLITKNLYSMMIVASLIGIVSSIIGLYFSFIYNLPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I+I +  ++IL+  + K
Sbjct: 251 IVIATFSIYILTLLFSK 267


>gi|134300482|ref|YP_001113978.1| ABC-3 protein [Desulfotomaculum reducens MI-1]
 gi|134053182|gb|ABO51153.1| ABC-3 protein [Desulfotomaculum reducens MI-1]
          Length = 276

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 145/257 (56%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RAL +G  + L    +G FI  +R++   D +AH  L GVA  +I  +   +   +
Sbjct: 7   EFMQRALIAGFLVGLICPAVGLFITVRRMSMISDALAHVCLSGVAAGIITGIHPVLSASL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A    L++ +++K     S+  + +I  + ++L  ++L   K  + +  S+LFG I+A+
Sbjct: 67  FAAGGGLLIERLRKAYHTYSEISIAIILSAGVALGAILLDLGKGYSANFISYLFGSIVAI 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +T D+ +I  +GF  ++++  + K + A + + + A+  G+  + I + F +IT+L I++
Sbjct: 127 STDDLKIISLMGFSILLLIHLLNKEMFAISFDEDHARVSGIPVDAISICFTIITALTIAM 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L++SL++LP  T+ R ++S  +  +LA +     I++GL+ S   +   G S
Sbjct: 187 SIRVVGILLVSSLMVLPVATSMRLASSFRSAMLLAILFAESAILVGLFASFYINLAPGGS 246

Query: 244 IIITSLFLFILSFFYKK 260
           I++TS+ L + +  Y+ 
Sbjct: 247 IVMTSVILLVATLVYQH 263


>gi|313683625|ref|YP_004061363.1| ABC transporter [Sulfuricurvum kujiense DSM 16994]
 gi|313156485|gb|ADR35163.1| ABC-3 protein [Sulfuricurvum kujiense DSM 16994]
          Length = 265

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 150/258 (58%), Gaps = 4/258 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFM 63
           F  RA  +G+ I +     G FI+ +R +   +T+AH +L+GV++ L+F L PL + +  
Sbjct: 9   FMQRAFIAGLMIAVLASLGGSFIVLRRYSLLSETLAHVSLVGVSVGLLFGLSPLWMAV-- 66

Query: 64  IATLTSLVLLQIQKN-EALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            A+L +  L++  ++   + SD++L +    +++LA+VI+S     N  L S+LFG IL+
Sbjct: 67  AASLVASWLIEYLRSVHGMYSDSVLAIFLSGSLALAIVIVSLAGSFNASLFSYLFGSILS 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+ ++   G L + +L   +K L     + ++A+A G++   +  + + + +++I+
Sbjct: 127 VSVEDLWVMGIFGSLAMALLLAFFKELYFIAFDEDVARAGGIRVTMLNFMLVSVIAIIIA 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +SI+ +G  LI +L+++P V A RF       A+L+ +I ++ ++IGL  S  F  PSG 
Sbjct: 187 LSIRVVGTLLIGALMVIPPVAAIRFGMGFYPTALLSVVIALISVVIGLIASYFFALPSGA 246

Query: 243 SIIITSLFLFILSFFYKK 260
           +I++  L LFI++    +
Sbjct: 247 AIVLVLLGLFIVALAVNR 264


>gi|325569329|ref|ZP_08145485.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Enterococcus casseliflavus ATCC 12755]
 gi|325157329|gb|EGC69490.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Enterococcus casseliflavus ATCC 12755]
          Length = 585

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +    
Sbjct: 13  HFLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIF 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV
Sbjct: 73  FGILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   
Sbjct: 132 QDSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LL+ P  TA  ++   ++M I+A ++G L   IGL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLVTPAATAYLYTKQLKHMMIIAGVLGGLASFIGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFFY 258
           I++T+   F++ F +
Sbjct: 252 IVLTAGAFFVIGFLF 266


>gi|330901530|gb|EGH32949.1| hypothetical protein PSYJA_29948 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 142

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 91/125 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI + +
Sbjct: 3   DFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAVTV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+LA+
Sbjct: 63  GCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLLAI 122

Query: 124 NTTDI 128
           +  D+
Sbjct: 123 SPADL 127


>gi|293364930|ref|ZP_06611647.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus oralis ATCC 35037]
 gi|307703183|ref|ZP_07640129.1| manganese ABC transporter permease protein [Streptococcus oralis
           ATCC 35037]
 gi|291316380|gb|EFE56816.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus oralis ATCC 35037]
 gi|307623258|gb|EFO02249.1| manganese ABC transporter permease protein [Streptococcus oralis
           ATCC 35037]
          Length = 282

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV
Sbjct: 73  FGLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAKS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G + ++I+   +K LL T+ +  LAKA GM       + +++ +L+   
Sbjct: 132 QDMDMWITIGVGVIILLIIGIFFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S ++M  L++ +G L  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSSLGALASVVGLFIGYSFNLAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSASFFLISFF 265


>gi|159898588|ref|YP_001544835.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159891627|gb|ABX04707.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 304

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 138/253 (54%), Gaps = 2/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF+R +  G+ + L+ G LGCF++ + +A+ GD +AH+ L GV L+ +  + + +     
Sbjct: 12  FFLRGMVVGMLMGLTCGVLGCFVVLRGMAFIGDALAHAVLPGVVLAYMGGISMVLGALGA 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               +L++  I + + +  D  +G++     +L +V+LS M+    DLT FLFG+IL + 
Sbjct: 72  GLFAALLISLISRTDYIREDTAIGIVFTGAFALGIVLLSRMRGYARDLTHFLFGNILGIA 131

Query: 125 TTDILLIWGIGFLNIMILFKIW-KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            +D+LL  G+   +++    +W +PL+  T +   AKA G++  +     +++ +L I  
Sbjct: 132 PSDLLLT-GLVTASVLGAIGLWYRPLMIMTFDPTHAKAIGLRLGRWHAGLMVLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            I+ +G+ L+ +LL+ P  TAR  +     M  LA + G    I+GLY S +    SG  
Sbjct: 191 GIQAVGVVLVAALLVTPAATARLLTNRLPTMIGLAALFGSSSAILGLYASYMLSIASGGV 250

Query: 244 IIITSLFLFILSF 256
           +++ S  +F + F
Sbjct: 251 VVLASTGVFAVVF 263


>gi|150389432|ref|YP_001319481.1| ABC-3 protein [Alkaliphilus metalliredigens QYMF]
 gi|149949294|gb|ABR47822.1| ABC-3 protein [Alkaliphilus metalliredigens QYMF]
          Length = 291

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 144/256 (56%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           ++   A+ +G+ + +  G +GCFII + +A  GD I+H+ L GV ++ +      I   +
Sbjct: 16  QYLQNAMIAGVLVGVICGMMGCFIILRGMALMGDAISHAVLPGVVIAYLLGFSFFIGAVI 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++ +  I ++  +  D+ +G++  +  +L +V+++  K  +  L   LFG++LAV
Sbjct: 76  TGAMTAIGIGYITQHSKIKDDSAIGIMFTAAFALGIVMITAQKGTDVHLWHILFGNVLAV 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ +I+ IG + I  L   ++  L +T +  +A+A G+  +KI  + +++ SL+   
Sbjct: 136 SRVDLWVIFTIGVVVIGGLLLFYRQFLLSTFDPTMAQAIGLPTKKIHYLLMLMLSLVTVA 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++  +GI L+ ++LI P  TA   +     M  L+ + G++  +IG+Y S I+D  +G S
Sbjct: 196 ALNTVGIVLVVAMLITPGSTAYLLTNRLPIMLALSALFGVVSSVIGVYCSFIYDVATGGS 255

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF ++F + 
Sbjct: 256 IVLVASILFAMAFLFA 271


>gi|312876478|ref|ZP_07736461.1| ABC-3 protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796689|gb|EFR13035.1| ABC-3 protein [Caldicellulosiruptor lactoaceticus 6A]
          Length = 271

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 150/253 (59%), Gaps = 3/253 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RA  +G+ + L T   G F++ +R +  GD+++H+A++GVA SL+F    TI   +
Sbjct: 5   EFMQRAFLAGVLVALMTSLAGNFLVLKRFSQMGDSLSHTAIVGVAASLLFNFSPTIGA-I 63

Query: 64  IATLTSLVLLQIQKNEALSSDAI-LGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           I+T+   ++L+  K++    + I L +++ + + LA V+   +K  +++L SFLFG I+A
Sbjct: 64  ISTVGFAIVLEYFKSKFKRFEEISLALVSITALGLASVLFGILKS-SSNLMSFLFGSIVA 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+ +I+ +  + +  +    K L+  T +   AK  G+  + +  +  ++++ +I+
Sbjct: 123 IGNEDVWIIFAVCLVTVTFIAMFRKRLIFATFDEVSAKVSGINTKLLDFLLSIVSATIIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VSIK +G  LI+SL++ PT  A RFS + + + I++ ++ ++ +I+GL  S   D P G 
Sbjct: 183 VSIKIVGGLLISSLIVFPTAIAMRFSKNFKMLQIVSLLVSLIAVIVGLTSSYYVDIPPGG 242

Query: 243 SIIITSLFLFILS 255
           + ++T L +F ++
Sbjct: 243 ATVLTFLVIFFIA 255


>gi|89070796|ref|ZP_01158049.1| zinc ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
 gi|89043638|gb|EAR49845.1| zinc ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
          Length = 262

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 151/245 (61%), Gaps = 1/245 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F +RA  + +G+ L  G LG F++W+R+AYFGD  AH+A+LGVAL+L+F+L + + 
Sbjct: 1   MLDDFLVRAALAAVGVALPAGLLGSFVVWRRMAYFGDATAHAAILGVALALMFELSV-LW 59

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L     L   + +    ++ LGV+ H  ++  L+ ++ +     DL ++LFGD+
Sbjct: 60  GVVAVALAMAAALHALEGQGREVNSALGVLAHGGLAAGLLAVALVPGGRVDLDAYLFGDV 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V   D+++IWG G L   +L   W  LL  T+N +LA A G+   +  L+ +++ +LM
Sbjct: 120 LTVTRGDLVVIWGGGALVAALLIWRWSALLTATLNPDLAAAAGIDARRETLLLVVLMALM 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V++K +G  LIT+LLI+P   AR  + +PE MA +A +IG +  + GL  +L  DTP 
Sbjct: 180 VAVALKVVGALLITALLIIPAAAARGLTRTPEAMAGVAALIGGVAALGGLGLALRLDTPV 239

Query: 241 GPSII 245
           GPSI+
Sbjct: 240 GPSIV 244


>gi|289806094|ref|ZP_06536723.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 165

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 105/163 (64%), Gaps = 2/163 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLASGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIM-ILFKIWKPLLATTVNYELAKAEGMQ 165
              D++ I  IG + ++ ILF  W+ LL+ T++ +LA  +G++
Sbjct: 123 TPEDLISI-AIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVK 164


>gi|326577717|gb|EGE27593.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           O35E]
          Length = 267

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ I L + PLGC ++W+R+A+F DT+AH ALLG+A ++   LP  + I MI ++ 
Sbjct: 11  AWIAGVLIALLSAPLGCLVLWRRMAFFSDTLAHGALLGIAFAVWLNLPADLGIGMI-SIA 69

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            ++ L + K++ L +DA L V+  + + L L+ L+ +     ++  FLFG +L ++ +D+
Sbjct: 70  VIIALTLLKDKRLPNDATLAVLASTLLCLGLLTLTQLTQQQANVLGFLFGSLLDMDWSDL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
             +  +  + ++IL +IW+  +    +  LA+ +G+ P    L F+ + +   +V+++ +
Sbjct: 130 PRLGTLIAMGLVILKRIWQSQVKLATSEALAQIQGINPLHQHLFFMGLLAGFCAVALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LLILP + AR F+ SP  M  L+ I   + +  G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLILPALIARLFAQSPTMMVFLSIIFAQMAVTAGVWGSVWLDIQTGLSIVLML 249

Query: 249 LFLFILSFFYKK 260
              F ++F  KK
Sbjct: 250 AIGFFITFARKK 261


>gi|322377409|ref|ZP_08051900.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           M334]
 gi|321281609|gb|EFX58618.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           M334]
          Length = 282

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 136/233 (58%), Gaps = 1/233 (0%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSD 84
           CFII + ++  GD I+H+ L GVALS I  +   I   +   L ++++  I+ N  + SD
Sbjct: 34  CFIILRGMSLMGDAISHAVLPGVALSFILGVDFFIGAIVFGLLAAIIITYIKGNSIIKSD 93

Query: 85  AILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFK 144
             +G+   S ++L ++++S  K  +TDL   LFG+ILAV  TD+ +  G+G   +++++ 
Sbjct: 94  TAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAVQDTDMFITMGVGAAILLLIWI 152

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            +K LL T+ +  LAKA GM       + +++ +L+   +++ +G  LI ++LI P  TA
Sbjct: 153 FFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVTAMQSVGTILIVAMLITPAATA 212

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFF 257
             ++ S ++M  L++  G    ++GL+    F+  +G SI++T+   F++SFF
Sbjct: 213 YLYANSLKSMIFLSSTFGATASVLGLFIGYSFNVAAGSSIVLTAASFFLISFF 265


>gi|82750335|ref|YP_416076.1| cation ABC transporter [Staphylococcus aureus RF122]
 gi|82655866|emb|CAI80270.1| cation ABC transporter [Staphylococcus aureus RF122]
          Length = 278

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + +  G +G  I+ + ++  GD ++H+ L GVALS +F +P+ I   +
Sbjct: 12  QFLNRALITSIIVGMVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFIGALI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+ +  I  +     DA +G+   + ++  ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLIN-TTTDLYHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +  L    IG + ++++   ++PL+ +T +   ++  G+    +    +++ SL+   
Sbjct: 131 TNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFVMLLLSLVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LLI P  TA   S    +M I+A++I ++  I+GLY S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYSYIYNIPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  ++I++ F+ K
Sbjct: 251 IVLCTFVIYIITLFFTK 267


>gi|186684684|ref|YP_001867880.1| ABC transporter [Nostoc punctiforme PCC 73102]
 gi|186467136|gb|ACC82937.1| ABC-3 protein [Nostoc punctiforme PCC 73102]
          Length = 289

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 144/256 (56%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA+   + + +  G LG F+  +++++F   + H+AL+GVAL ++ Q+  T  +   
Sbjct: 28  FMQRAIVGAVLMGILGGMLGSFVTLRQLSFFSHAVGHAALVGVALGVLLQINPTWMLLPF 87

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             +  +++L       L SD++L ++    +++ +++ S +K    +L + LFGDILA++
Sbjct: 88  TLVFGVIVLYFIDKTDLGSDSVLSIVLSGALAIGVILTSLIKGYRGNLMAVLFGDILAID 147

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           T D++L   +     + L    +  +  T+N ++A+ +G+  +  + +F+++ SL ++V+
Sbjct: 148 TIDLILTLLVLVGGSIFLLSTLRQQILLTLNPDVAQVQGVPVQLYRYVFVVLLSLAVAVA 207

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           IK +G+ L+ + L++P  TA+  S       +++ I+G +  I G+  S IF+  SGPSI
Sbjct: 208 IKAVGVLLVNAFLVIPASTAKLMSHHFSRFLVISVIVGSISSIAGIIVSGIFNLASGPSI 267

Query: 245 IITSLFLFILSFFYKK 260
           ++    LFI  F + K
Sbjct: 268 VLVQFLLFIAVFIWFK 283


>gi|258423282|ref|ZP_05686173.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           A9635]
 gi|282915967|ref|ZP_06323732.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus D139]
 gi|283769795|ref|ZP_06342687.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus H19]
 gi|257846343|gb|EEV70366.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           A9635]
 gi|282320263|gb|EFB50608.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus D139]
 gi|283459942|gb|EFC07032.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus H19]
 gi|298693963|gb|ADI97185.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus ED133]
 gi|302332342|gb|ADL22535.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus JKD6159]
 gi|323439405|gb|EGA97127.1| cation ABC transporter [Staphylococcus aureus O11]
 gi|323442089|gb|EGA99723.1| cation ABC transporter [Staphylococcus aureus O46]
          Length = 278

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + +  G +G  I+ + ++  GD ++H+ L GVALS +F +P+ I   +
Sbjct: 12  QFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFIGALI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+ +  I  +     DA +G+   + ++  ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLIN-TTTDLYHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +  L    IG + ++++   ++PL+ +T +   ++  G+    +    +++ SL+   
Sbjct: 131 TNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFVMLLLSLVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LLI P  TA   S    +M I+A++I ++  I+GLY S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYSYIYNIPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  ++I++ F+ K
Sbjct: 251 IVLCTFVIYIITLFFTK 267


>gi|288561583|ref|YP_003428989.1| manganese ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288548215|gb|ADC52097.1| manganese ABC transporter, permease [Bacillus pseudofirmus OF4]
          Length = 292

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RAL + + + +  G +GCFII + ++  GD I+H+ L GVA+S +  + +     +
Sbjct: 14  EFLQRALLTSVLVGIVCGVIGCFIILRGMSLMGDAISHAVLPGVAISYMLGINIFYGAVV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              LT++ +  I +N  +  D  +G++  +  ++ +++++F++  +TDL   LFG++LAV
Sbjct: 74  TGLLTAIAIGYISQNSRIKDDTSIGIMFTAAFAVGIIVITFLQS-STDLYHILFGNVLAV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIW---KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
            T++   +W    + +++L  ++   K LL TT +  ++ A G+  + I  + + + ++ 
Sbjct: 133 PTSE---MWMTLIVTVIVLLSVYLFFKELLVTTFDPTMSAAYGLPNKIIHYLLMALLTMA 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  LA   G++  IIGLY S  ++  S
Sbjct: 190 TVASLQTVGIVLVVAMLITPAATAYLLTNHLGIMVFLAAGFGVVASIIGLYFSFSYNLAS 249

Query: 241 GPSIIITSLFLFILSFF 257
           GP+I++ +   F ++FF
Sbjct: 250 GPTIVVVASTFFAMAFF 266


>gi|228901674|ref|ZP_04065848.1| Manganese transport system membrane protein mntC [Bacillus
           thuringiensis IBL 4222]
 gi|228966116|ref|ZP_04127179.1| Manganese transport system membrane protein mntC [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228793601|gb|EEM41141.1| Manganese transport system membrane protein mntC [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228857954|gb|EEN02440.1| Manganese transport system membrane protein mntC [Bacillus
           thuringiensis IBL 4222]
          Length = 264

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 140/239 (58%), Gaps = 1/239 (0%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           G +GCFII + +A  GD I+H+ L GVALS +  +   I   +   +T++ +  + +N  
Sbjct: 7   GVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGAVLTGVITAVGIGFVSQNSR 66

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           +  D  +G++  S  ++ +++++FMK  ++DL   LFG++L+V ++D+ +   IG + I 
Sbjct: 67  IKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNVLSVRSSDMWMTLIIGVVIIG 125

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           ++   +K LL +T +  +A++ G+  + I    +++ +++   S++ +GI L+ ++LI P
Sbjct: 126 LVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVTVASLQTVGIILVVAMLITP 185

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
             TA   +     M  LA  IG L  ++GLY S  ++  SG +I++ + FLF L+FF+ 
Sbjct: 186 AATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASGATIVLVATFLFGLAFFFS 244


>gi|257875144|ref|ZP_05654797.1| ABC transporter, substrate binding lipoprotein [Enterococcus
           casseliflavus EC20]
 gi|257809310|gb|EEV38130.1| ABC transporter, substrate binding lipoprotein [Enterococcus
           casseliflavus EC20]
          Length = 585

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +    
Sbjct: 13  HFLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIF 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV
Sbjct: 73  FGILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   
Sbjct: 132 QDSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LL+ P  TA  ++   ++M ++A ++G     IGL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLVTPAATAYLYTKQLKHMMVIAGVLGGFASFIGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFFY 258
           I++T+   F++ F +
Sbjct: 252 IVLTAGAFFVIGFLF 266


>gi|257865528|ref|ZP_05645181.1| ABC transporter [Enterococcus casseliflavus EC30]
 gi|257871865|ref|ZP_05651518.1| ABC transporter [Enterococcus casseliflavus EC10]
 gi|257799462|gb|EEV28514.1| ABC transporter [Enterococcus casseliflavus EC30]
 gi|257806029|gb|EEV34851.1| ABC transporter [Enterococcus casseliflavus EC10]
          Length = 585

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +    
Sbjct: 13  HFLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIF 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV
Sbjct: 73  FGILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   
Sbjct: 132 QDSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LL+ P  TA  ++   ++M ++A ++G     IGL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLVTPAATAYLYTKQLKHMMVIAGVLGGFASFIGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFFY 258
           I++T+   F++ F +
Sbjct: 252 IVLTAGAFFVIGFLF 266


>gi|209528140|ref|ZP_03276614.1| ABC-3 protein [Arthrospira maxima CS-328]
 gi|209491428|gb|EDZ91809.1| ABC-3 protein [Arthrospira maxima CS-328]
          Length = 347

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 145/256 (56%), Gaps = 1/256 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ I    + +  F+ 
Sbjct: 64  FMQRSLTIAILVGLICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFILGFNIFVGAFIA 123

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAV 123
              +++++  I+ +  +  DA +G++     +L + +++ ++  N  DL  FLFG+IL V
Sbjct: 124 GVFSTVLIEIIRTHSKIKEDAAMGIVFSGFFALGITLITIIQKDNKIDLNHFLFGNILGV 183

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+     I  + ++++F I+K LL  T + + A+A G+    + L  +M+ SL I  
Sbjct: 184 TASDVRDTMIIAAIVLLVVFLIYKELLFYTFDPQGAEAAGLPVNLLNLGLMMLISLTIVA 243

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K +G+ L+ SLLI P+ TA        N+ IL  +IG+   + G+Y S  ++ PSGP+
Sbjct: 244 SLKAVGVILVLSLLITPSATAYLLVNRLHNVMILGVLIGVGSSMSGMYLSYFYNLPSGPA 303

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF+++F + 
Sbjct: 304 IVLVASGLFLMAFLFS 319


>gi|312792631|ref|YP_004025554.1| abc-3 protein [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312179771|gb|ADQ39941.1| ABC-3 protein [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 271

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 149/253 (58%), Gaps = 3/253 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RA  +G+ + L T   G F++ +R +  GD+++H+A++GVA SL+F    TI   +
Sbjct: 5   EFMQRAFLAGVLVALMTSLAGNFLVLKRFSQMGDSLSHTAIVGVAASLLFNFSPTIGA-I 63

Query: 64  IATLTSLVLLQIQKNEALSSDAI-LGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           I+T+   ++L+  K++    + I L +++ + + LA V+   +K  +++L SFLFG I+A
Sbjct: 64  ISTVGFAIVLEYFKSKFKRFEEISLALVSITALGLASVLFGILKS-SSNLMSFLFGSIVA 122

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+ +I+ +  + +  +    K L+  T +   AK  G+  + +  +  ++++ +I+
Sbjct: 123 IGNEDVWIIFAVCLVTVTFIAMFRKRLIFATFDEVSAKVSGINTKLLDFLLSIVSATIIA 182

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VSIK +G  LI+SL++ PT  A RFS + + + I++ ++ +  +I+GL  S   D P G 
Sbjct: 183 VSIKIVGGLLISSLIVFPTAIAMRFSKNFKMLQIVSLLVSLTAVIVGLTSSYYVDIPPGG 242

Query: 243 SIIITSLFLFILS 255
           + ++T L +F ++
Sbjct: 243 ATVLTFLVIFFIA 255


>gi|323489328|ref|ZP_08094558.1| MntD [Planococcus donghaensis MPA1U2]
 gi|323396969|gb|EGA89785.1| MntD [Planococcus donghaensis MPA1U2]
          Length = 285

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 144/257 (56%), Gaps = 3/257 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  +AL + I + +  G +GCFII + +A  GD I+H+ L GVA+S    +        
Sbjct: 11  DFLQKALLTSIMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYAIGINFFFGAVF 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              LT++ +  + +N  +  D  +G++  +  +L +++++ ++  +TDL   LFG++LAV
Sbjct: 71  TGVLTAIGIGFVSQNSRIKQDTAIGIMFSAAFALGVILITVLE-SSTDLYHILFGNVLAV 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ +  GIG   ++ +F  +K LL T+ +  +A+  G+ P ++   F+M    M++V
Sbjct: 130 RPSDMWITLGIGLTVLVSVFVFYKELLVTSFDETMAEVYGL-PVRLIHYFLMTLLTMVTV 188

Query: 184 -SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   +     M  ++  IG+   IIGLY S  ++  SG 
Sbjct: 189 ASLQTVGIILVVAMLITPAATAYLLTDRLSTMIFISATIGVSAAIIGLYFSFSYNLASGA 248

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF L+F + 
Sbjct: 249 TIVLAATTLFFLAFVFS 265


>gi|15923622|ref|NP_371156.1| ABC transporter permease [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926309|ref|NP_373842.1| hypothetical protein SA0588 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282323|ref|NP_645411.1| hypothetical protein MW0594 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49482860|ref|YP_040084.1| ABC transporter permease [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485504|ref|YP_042725.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651473|ref|YP_185571.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus COL]
 gi|87161330|ref|YP_493322.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194403|ref|YP_499196.1| iron (chelated) ABC transporter permease [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|148267091|ref|YP_001246034.1| ABC transporter [Staphylococcus aureus subsp. aureus JH9]
 gi|150393139|ref|YP_001315814.1| ABC transporter [Staphylococcus aureus subsp. aureus JH1]
 gi|151220814|ref|YP_001331636.1| hypothetical protein NWMN_0602 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156978960|ref|YP_001441219.1| hypothetical protein SAHV_0629 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161508894|ref|YP_001574553.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221140849|ref|ZP_03565342.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253314587|ref|ZP_04837800.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731253|ref|ZP_04865418.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253732927|ref|ZP_04867092.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005425|ref|ZP_05144026.2| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424751|ref|ZP_05601178.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427420|ref|ZP_05603819.1| cation ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430051|ref|ZP_05606435.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432753|ref|ZP_05609113.1| ABC-3 protein [Staphylococcus aureus subsp. aureus E1410]
 gi|257435657|ref|ZP_05611705.1| ABC transporter permease [Staphylococcus aureus subsp. aureus M876]
 gi|257795104|ref|ZP_05644083.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258418363|ref|ZP_05682628.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258419979|ref|ZP_05682937.1| ABC transporter permease [Staphylococcus aureus A9719]
 gi|258430853|ref|ZP_05688565.1| ABC transporter permease [Staphylococcus aureus A9299]
 gi|258441654|ref|ZP_05690926.1| ABC transporter permease [Staphylococcus aureus A8115]
 gi|258445910|ref|ZP_05694087.1| ABC transporter permease [Staphylococcus aureus A6300]
 gi|258449715|ref|ZP_05697817.1| ABC transporter, permease [Staphylococcus aureus A6224]
 gi|258452841|ref|ZP_05700835.1| ABC-3 protein [Staphylococcus aureus A5948]
 gi|258454116|ref|ZP_05702088.1| ABC transporter permease [Staphylococcus aureus A5937]
 gi|262048377|ref|ZP_06021262.1| hypothetical protein SAD30_2104 [Staphylococcus aureus D30]
 gi|262051765|ref|ZP_06023983.1| hypothetical protein SA930_1848 [Staphylococcus aureus 930918-3]
 gi|269202253|ref|YP_003281522.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282894396|ref|ZP_06302625.1| manganese/iron transport system permease [Staphylococcus aureus
           A8117]
 gi|282903224|ref|ZP_06311115.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|282905011|ref|ZP_06312869.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282907969|ref|ZP_06315803.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910276|ref|ZP_06318080.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282913469|ref|ZP_06321258.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282918422|ref|ZP_06326159.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus C427]
 gi|282921922|ref|ZP_06329620.1| manganese/iron transport system permease [Staphylococcus aureus
           A9765]
 gi|282923387|ref|ZP_06331067.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus C101]
 gi|282926494|ref|ZP_06334124.1| manganese/iron transport system permease [Staphylococcus aureus
           A10102]
 gi|283957432|ref|ZP_06374885.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|284023655|ref|ZP_06378053.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus 132]
 gi|293500516|ref|ZP_06666367.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293509461|ref|ZP_06668172.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus M809]
 gi|293524048|ref|ZP_06670735.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|294849302|ref|ZP_06790045.1| manganese/iron transport system permease [Staphylococcus aureus
           A9754]
 gi|295407411|ref|ZP_06817207.1| manganese/iron transport system permease [Staphylococcus aureus
           A8819]
 gi|295427175|ref|ZP_06819811.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296274697|ref|ZP_06857204.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297208644|ref|ZP_06925073.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297246533|ref|ZP_06930369.1| manganese/iron transport system permease [Staphylococcus aureus
           A8796]
 gi|297590476|ref|ZP_06949115.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus MN8]
 gi|300912735|ref|ZP_07130178.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381756|ref|ZP_07364404.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|17980926|gb|AAL50777.1|AF452622_3 MntB [Staphylococcus aureus]
 gi|13700523|dbj|BAB41820.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246401|dbj|BAB56794.1| similar to ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|21203760|dbj|BAB94459.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|27466719|gb|AAO12518.1| SitB [Staphylococcus aureus]
 gi|49240989|emb|CAG39659.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49243947|emb|CAG42373.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57285659|gb|AAW37753.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus COL]
 gi|87127304|gb|ABD21818.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87201961|gb|ABD29771.1| iron (chelated) ABC transporter, permease protein, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740160|gb|ABQ48458.1| ABC-3 protein [Staphylococcus aureus subsp. aureus JH9]
 gi|149945591|gb|ABR51527.1| ABC-3 protein [Staphylococcus aureus subsp. aureus JH1]
 gi|150373614|dbj|BAF66874.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721095|dbj|BAF77512.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160367703|gb|ABX28674.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724994|gb|EES93723.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253729107|gb|EES97836.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257272321|gb|EEV04444.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257275613|gb|EEV07086.1| cation ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279248|gb|EEV09849.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282168|gb|EEV12303.1| ABC-3 protein [Staphylococcus aureus subsp. aureus E1410]
 gi|257284848|gb|EEV14967.1| ABC transporter permease [Staphylococcus aureus subsp. aureus M876]
 gi|257789076|gb|EEV27416.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257839156|gb|EEV63635.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257844062|gb|EEV68453.1| ABC transporter permease [Staphylococcus aureus A9719]
 gi|257849525|gb|EEV73495.1| ABC transporter permease [Staphylococcus aureus A9299]
 gi|257852123|gb|EEV76050.1| ABC transporter permease [Staphylococcus aureus A8115]
 gi|257855486|gb|EEV78424.1| ABC transporter permease [Staphylococcus aureus A6300]
 gi|257857223|gb|EEV80122.1| ABC transporter, permease [Staphylococcus aureus A6224]
 gi|257859352|gb|EEV82206.1| ABC-3 protein [Staphylococcus aureus A5948]
 gi|257863981|gb|EEV86737.1| ABC transporter permease [Staphylococcus aureus A5937]
 gi|259160376|gb|EEW45402.1| hypothetical protein SA930_1848 [Staphylococcus aureus 930918-3]
 gi|259163465|gb|EEW48022.1| hypothetical protein SAD30_2104 [Staphylococcus aureus D30]
 gi|262074543|gb|ACY10516.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269940209|emb|CBI48586.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282314255|gb|EFB44645.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus C101]
 gi|282317556|gb|EFB47928.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus C427]
 gi|282322501|gb|EFB52823.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282325668|gb|EFB55976.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282328214|gb|EFB58493.1| iron transporter, ATP-binding component SitB [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331836|gb|EFB61347.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282591387|gb|EFB96459.1| manganese/iron transport system permease [Staphylococcus aureus
           A10102]
 gi|282593775|gb|EFB98766.1| manganese/iron transport system permease [Staphylococcus aureus
           A9765]
 gi|282596179|gb|EFC01140.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|282763109|gb|EFC03240.1| manganese/iron transport system permease [Staphylococcus aureus
           A8117]
 gi|283469928|emb|CAQ49139.1| AfeD [Staphylococcus aureus subsp. aureus ST398]
 gi|283790883|gb|EFC29698.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|285816332|gb|ADC36819.1| Manganese ABC transporter, inner membrane permease protein SitD
           [Staphylococcus aureus 04-02981]
 gi|290921011|gb|EFD98072.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|291095521|gb|EFE25782.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467558|gb|EFF10073.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus M809]
 gi|294823834|gb|EFG40260.1| manganese/iron transport system permease [Staphylococcus aureus
           A9754]
 gi|294967692|gb|EFG43725.1| manganese/iron transport system permease [Staphylococcus aureus
           A8819]
 gi|295128963|gb|EFG58593.1| manganese/iron transport system permease [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296886899|gb|EFH25803.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297176564|gb|EFH35828.1| manganese/iron transport system permease [Staphylococcus aureus
           A8796]
 gi|297576775|gb|EFH95490.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus MN8]
 gi|300886981|gb|EFK82183.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus TCH70]
 gi|302750531|gb|ADL64708.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304339707|gb|EFM05653.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|312438946|gb|ADQ78017.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829126|emb|CBX33968.1| manganese transport system membrane protein [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315128490|gb|EFT84497.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|315194002|gb|EFU24396.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus CGS00]
 gi|315197603|gb|EFU27938.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140035|gb|EFW31896.1| putative metal ion ABC transporter, permease protein
           [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320141874|gb|EFW33702.1| putative metal ion ABC transporter, permease protein
           [Staphylococcus aureus subsp. aureus MRSA177]
 gi|329313355|gb|AEB87768.1| ABC-3 protein [Staphylococcus aureus subsp. aureus T0131]
 gi|329725001|gb|EGG61499.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329729627|gb|EGG66028.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus 21193]
 gi|329729943|gb|EGG66335.1| metal ion ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus 21189]
          Length = 278

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + +  G +G  I+ + ++  GD ++H+ L GVALS +F +P+ +   +
Sbjct: 12  QFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFVGALI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+ +  I  +     DA +G+   + ++  ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLIN-TTTDLYHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +  L    IG + ++++   ++PL+ +T +   ++  G+    +    +++ SL+   
Sbjct: 131 TNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFVMLLLSLVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LLI P  TA   S    +M I+A++I ++  I+GLY S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYSYIYNIPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  ++I++ F+ K
Sbjct: 251 IVLCTFVIYIITLFFTK 267


>gi|332706691|ref|ZP_08426752.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
 gi|332354575|gb|EGJ34054.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
          Length = 295

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 145/260 (55%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++  F  R+L + + + +    +G +++ QR+A  GD I+HS L G+A++ +    + + 
Sbjct: 9   LHYGFMQRSLITAVLVGIVCAAVGSYLMVQRLALLGDAISHSVLPGLAIAFMIGADIFVG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGD 119
            F+   ++++V+  I+    +  DA +G++  +  +L + +++ M+  N  DL  FLFG+
Sbjct: 69  AFIAGVVSTVVITWIRTRSQIKEDAAMGIVFSAFFALGITLITVMQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL+V   +++    I  + + I+  ++K L+  T +   AKA G+    +    +++ +L
Sbjct: 129 ILSVTNEEVINTAIITAIVLSIILLLYKELMYYTFDPLGAKAAGLPTNLLNFGLMILIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ ++LI P  TA         M IL + +G++  I G+Y S  F+ P
Sbjct: 189 TIVASLKGVGVILVLAMLITPGATAYLLVHRLHQMMILGSALGVVASITGMYLSYFFNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+L+F + 
Sbjct: 249 SGPAIVLVAFGLFMLAFLFS 268


>gi|326571637|gb|EGE21652.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           BC7]
          Length = 267

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ I L + PLGC ++W+R+A+F DT+AH ALLG+A ++   LP  + I MI ++ 
Sbjct: 11  AWIAGVLIALLSAPLGCLVLWRRMAFFSDTLAHGALLGIAFAVWLNLPADLGIGMI-SIA 69

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            ++ L + K++ L +DA L V+  + + L L+ L+ +     ++  FLFG +L ++ +D+
Sbjct: 70  VIIALTLLKDKRLPNDATLAVLASTLLCLGLLTLTQLTQQQANVLGFLFGSLLDIDWSDL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
             +  +  + ++IL +IW+  +    +  LA+ +G+ P    L F+ + +   +V+++ +
Sbjct: 130 PRLGILIAMGLVILKRIWQSQVKLATSEALAQIQGINPLHQHLFFMGLLAGFCAVALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LLILP + AR F+ SP  M  L+ I   + +  G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLILPALIARLFAQSPTMMVFLSIIFAQMAVTAGVWGSVWLDIQTGLSIVLML 249

Query: 249 LFLFILSFFYKK 260
              F ++F  KK
Sbjct: 250 AIGFFITFACKK 261


>gi|116512155|ref|YP_809371.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactococcus lactis subsp. cremoris SK11]
 gi|116107809|gb|ABJ72949.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactococcus lactis subsp. cremoris SK11]
          Length = 279

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 139/243 (57%), Gaps = 3/243 (1%)

Query: 14  IGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLL 73
           IGIV  +G +GCFII + ++  GD I+H+ L GVA+S I  +   I       L+SL++ 
Sbjct: 25  IGIV--SGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIAFGLLSSLIIT 82

Query: 74  QIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWG 133
            I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV   D  L  G
Sbjct: 83  YIKNNSLIKGDTAIGITFSSFLALGIILIGVANS-STDLFHILFGNILAVQDIDKWLTIG 141

Query: 134 IGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           +    ++++   +K LL T+ +  +AKA GM+      + +++ +L+   +++ +G  LI
Sbjct: 142 VSIFVLIVIALFFKQLLITSFDPLMAKAIGMKVNFYHYLLMVLLTLVSVTAMQSVGTILI 201

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
            ++LI P  TA  ++ S + M IL++ IG +  ++GL+    F+  +G SI+ITS  +F 
Sbjct: 202 EAMLITPAATAYLYTNSLKKMLILSSSIGAISSVLGLFIGYTFNIAAGSSIVITSAIIFA 261

Query: 254 LSF 256
           +SF
Sbjct: 262 VSF 264


>gi|228475530|ref|ZP_04060248.1| manganese transport system membrane protein MntB [Staphylococcus
           hominis SK119]
 gi|228270312|gb|EEK11747.1| manganese transport system membrane protein MntB [Staphylococcus
           hominis SK119]
          Length = 278

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + +  G +G  II + ++  GD ++H+ L GVALS +F +P+ I   +
Sbjct: 12  QFLNRALITSIVVGVVCGTVGSLIILRGLSLMGDAMSHAVLPGVALSFLFNIPMFIGALV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + SL++  I  N     DA +G+   + ++  ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMIASLLIGYISNNSKTKPDAAIGISFTAFLATGIIIISLINS-TTDLHHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
                     IG + ++++  +++PL+ +T +   ++  G+    +    +++ +L+   
Sbjct: 131 TRQTFWTTIIIGVIVMLLIVILYRPLMISTFDATFSRVSGLNTTMLHYFVMLLLALVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LL+ P  TA   + +  +M I+A++IGI+  IIGLY S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLVTPASTAFLITKNLYSMMIVASLIGIVSSIIGLYFSFIYNLPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I+I +  ++IL+  + K
Sbjct: 251 IVIATFSIYILTLLFSK 267


>gi|284049985|ref|ZP_06380195.1| ABC-3 protein [Arthrospira platensis str. Paraca]
 gi|291568146|dbj|BAI90418.1| ABC transporter permease protein [Arthrospira platensis NIES-39]
          Length = 298

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 146/256 (57%), Gaps = 1/256 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ I    + +  F+ 
Sbjct: 15  FMQRSLTIAILVGLICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFILGFNIFVGAFVA 74

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAV 123
           A L+++++  I+ +  +  DA +G++     +L + +++ ++  N  DL  FLFG+IL V
Sbjct: 75  AVLSTVLIEIIRTHCKIKEDAAMGIVFSGFFALGITLITIIQKDNKIDLNHFLFGNILGV 134

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+     I  + + ++F I+K LL  T + + A+A G+    + L  +M+ SL I  
Sbjct: 135 TASDVRDTIIIAAIVLFVVFLIYKELLFYTFDPQGAEAAGLPVNLLNLGLMMLISLTIVA 194

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K +G+ L+ SLLI P+ TA        ++ IL  +IG+   I G+Y S  ++ PSGP+
Sbjct: 195 SLKAVGVILVLSLLITPSATAYLLVNRLHHVMILGVLIGVGSSISGMYLSYFYNLPSGPA 254

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF+++F + 
Sbjct: 255 IVLVASGLFLMAFLFS 270


>gi|296112597|ref|YP_003626535.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           RH4]
 gi|295920291|gb|ADG60642.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           RH4]
 gi|326560858|gb|EGE11223.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           7169]
 gi|326563904|gb|EGE14155.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           46P47B1]
 gi|326566912|gb|EGE17051.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           103P14B1]
 gi|326569757|gb|EGE19807.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           BC8]
 gi|326575084|gb|EGE25012.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           CO72]
 gi|326576830|gb|EGE26737.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           101P30B1]
          Length = 267

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ I L + PLGC ++W+R+A+F DT+AH ALLG+A ++   LP  + I MI ++ 
Sbjct: 11  AWIAGVLIALLSAPLGCLVLWRRMAFFSDTLAHGALLGIAFAVWLNLPADLGIGMI-SIA 69

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            ++ L + K++ L +DA L V+  + + L L+ L+ +     ++  FLFG +L ++ +D+
Sbjct: 70  VIIALTLLKDKRLPNDATLAVLASTLLCLGLLTLTQLTQQQANVLGFLFGSLLDMDWSDL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
             +  +  + ++IL +IW+  +    +  LA+ +G+ P    L F+ + +   +V+++ +
Sbjct: 130 PRLGILIAMGLVILKRIWQSQVKLATSEALAQIQGINPLHQHLFFMGLLAGFCAVALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LLILP + AR F+ SP  M  L+ I   + +  G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLILPALIARLFAQSPTMMVFLSIIFAQMAVTAGVWGSVWLDIQTGLSIVLML 249

Query: 249 LFLFILSFFYKK 260
              F ++F  KK
Sbjct: 250 AIGFFITFACKK 261


>gi|229822793|ref|ZP_04448863.1| hypothetical protein GCWU000282_00082 [Catonella morbi ATCC 51271]
 gi|229787606|gb|EEP23720.1| hypothetical protein GCWU000282_00082 [Catonella morbi ATCC 51271]
          Length = 282

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 148/256 (57%), Gaps = 5/256 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            +   AL + I I + +G +GCFII + ++  GD I+H+ L GVALS I  +   +   +
Sbjct: 15  HYMQNALVTAIVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFVGAIV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                S+++  I+ N  +  D  +G+   S ++L ++++   +  +TDL   LFG+ILAV
Sbjct: 75  FGLFASMIITFIRGNSIIKGDTAIGITFSSFLALGVILIGLARS-STDLFHILFGNILAV 133

Query: 124 NTTDI-LLIW-GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
             +D  + IW  +  L ++ILF  +K LL T+ + ++AKA GM+      + +++ +L+ 
Sbjct: 134 QDSDKWITIWVSVAVLIVIILF--FKELLITSFDPQMAKAMGMKVNFYHYLLMILLTLVS 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  LI ++LI P  TA  +  S ++M +L++ +G +  ++GL+    F+  +G
Sbjct: 192 VTAMQSVGTILIVAMLITPAATAYLYVNSLKSMILLSSTLGAVTSVLGLFLGTSFNVAAG 251

Query: 242 PSIIITSLFLFILSFF 257
            SI++TS  +F +SFF
Sbjct: 252 SSIVLTSAVIFAISFF 267


>gi|319945693|ref|ZP_08019944.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus australis ATCC 700641]
 gi|319748053|gb|EFW00296.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus australis ATCC 700641]
          Length = 280

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAIGITFSSFLALGVILIGVAK-SSTDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDQDMWVTIGVGVAVLLVIVLLFRPLLLTSFDPVLAQSMGVRVKLYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  I+GL+    F+   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLWSMMLLSSGLGALASILGLFIGYSFNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|78221714|ref|YP_383461.1| hypothetical protein Gmet_0493 [Geobacter metallireducens GS-15]
 gi|78192969|gb|ABB30736.1| ABC-3 [Geobacter metallireducens GS-15]
          Length = 272

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 150/262 (57%), Gaps = 9/262 (3%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---LTICI 61
           F +RAL +G  I      LG F++ +R++  GD +AH     VAL+L  +      T+  
Sbjct: 11  FLLRALAAGSLIAALCAVLGVFLVLRRLSLIGDGLAHVTFGSVALALFLRFQSVYATVAA 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +L +L++ +   +  DA +G+++   ++  +++ S     N DL S+LFG+IL
Sbjct: 71  IPAVLLAALGILRLAERARIYGDAAIGIVSSLGVATGILLASMAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDI---LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           +++  ++    +++ I  L +++    +  L A   + ELA+  G++ ++I  + +++T+
Sbjct: 131 SISPFELGQTAVLFVIVCLTVLL---CYHDLFAIAFDEELARTSGIRVDRINAVLVLLTA 187

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L + +++K +GI LI++LLILP VT+ + +       +LA ++G+L ++ G+  S + + 
Sbjct: 188 LTVVLAMKVVGIMLISALLILPAVTSLQIARGFRTAILLAVLLGVLSVVAGIVISFLANL 247

Query: 239 PSGPSIIITSLFLFILSFFYKK 260
           P+G +II+ +  LF++SF  +K
Sbjct: 248 PAGATIILVNFTLFLVSFGLRK 269


>gi|326566575|gb|EGE16721.1| zinc ABC transporter permease protein ZnuB [Moraxella catarrhalis
           12P80B1]
          Length = 267

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 9   ALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLT 68
           A  +G+ I L + PLGC ++W+R+A+F DT+AH ALLG+A ++   LP  + I MI ++ 
Sbjct: 11  AWIAGVLIALLSAPLGCLVLWRRMAFFSDTLAHGALLGIAFAVWLNLPADLGIGMI-SIA 69

Query: 69  SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDI 128
            ++ L + K++ L +DA L V+  + + L L+ L+ +     ++  FLFG +L ++ +D+
Sbjct: 70  VIIALTLLKDKRLPNDATLAVLASTLLCLGLLTLTQLTQQQANVLGFLFGSLLDIDWSDL 129

Query: 129 LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFI 188
             +  +  + ++IL +IW+  +    +  LA+ +G+ P    L F+ + +   +V+++ +
Sbjct: 130 PRLGILIAMGLVILKRIWQSQVKLATSEALAQIQGINPLHQYLFFMGLLAGFCAVALQAV 189

Query: 189 GITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS 248
           G  LI+ LLILP + AR F+ SP  M  L+ I   + +  G++GS+  D  +G SI++  
Sbjct: 190 GSLLISGLLILPALIARLFAQSPTMMVFLSIIFAQMAVTAGVWGSVWLDIQTGLSIVLML 249

Query: 249 LFLFILSFFYKK 260
              F ++F  KK
Sbjct: 250 AIGFFITFACKK 261


>gi|306834416|ref|ZP_07467530.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
 gi|304423402|gb|EFM26554.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
          Length = 284

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 149/262 (56%), Gaps = 11/262 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I 
Sbjct: 20  MTYHFLQNALVTAVVIGIVSGAIGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIG 79

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S ++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG++
Sbjct: 80  AVIFGILASFIITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNL 138

Query: 121 LAVNTTD---ILLIWGI--GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LAV  +D    ++I GI  GFL   I+F  +K LL T+ +  LA++ GM  +    + ++
Sbjct: 139 LAVQDSDKWVTIVISGIVIGFL---IIF--FKELLVTSFDPILAESMGMNVKFFHYLLMV 193

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           + +L+   +++ +G  LI ++LI P  TA  +  S + M +L++ IG +  IIGL+    
Sbjct: 194 LLTLVSVTAMQSVGTILIVAMLITPAATAYLYVNSLKAMVLLSSGIGAITSIIGLFLGYT 253

Query: 236 FDTPSGPSIIITSLFLFILSFF 257
           F+   G SI++TS F+F++SFF
Sbjct: 254 FNIAVGSSIVLTSAFIFLVSFF 275


>gi|282896696|ref|ZP_06304704.1| ABC transporter permease protein [Raphidiopsis brookii D9]
 gi|281198414|gb|EFA73302.1| ABC transporter permease protein [Raphidiopsis brookii D9]
          Length = 259

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 140/243 (57%), Gaps = 14/243 (5%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQ-------LPLTICIFMIATLTSLVLLQIQK 77
            F+  +++++F   + H+AL+GVAL ++         LP T+ + +I      VL  I +
Sbjct: 20  SFVTLRQLSFFSHAVGHAALVGVALGVLLNTNPHWMLLPFTLVLGVI------VLYLIDQ 73

Query: 78  NEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFL 137
            + L+SD+IL V+    +++ +++ S ++    +L + LFGDILA++ TD++LI  I   
Sbjct: 74  TD-LASDSILTVVLSGALAIGIILTSMIEEYRGNLMAVLFGDILAIDQTDLILILIILIT 132

Query: 138 NIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLL 197
           + + +    +  +  T+N ++AK +G   E  + IF+++ SL ++V+IK +G+ L+ + L
Sbjct: 133 SSIFILSTMRSQILLTLNEDVAKVQGSPVEMYRYIFVILLSLAVAVAIKAVGVLLVNAFL 192

Query: 198 ILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFF 257
           ++P  TA+  S       IL+ +IG    I+G+  S +F+  SGPS++I    LF+ +F 
Sbjct: 193 VIPATTAKLVSDHFRGFLILSVVIGCTSSIVGMIVSGLFNQASGPSVVIVQFLLFVFTFL 252

Query: 258 YKK 260
           + +
Sbjct: 253 WVR 255


>gi|317484748|ref|ZP_07943648.1| ABC 3 transporter [Bilophila wadsworthia 3_1_6]
 gi|316924000|gb|EFV45186.1| ABC 3 transporter [Bilophila wadsworthia 3_1_6]
          Length = 288

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 6/229 (2%)

Query: 31  RIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVI 90
           R+A+F D I+HSA  GVAL LIF +   + + +   L  L ++ +Q+N ALSSD I+GV 
Sbjct: 49  RMAFFSDAISHSAFAGVALGLIFSINPHVAMPVFGILVGLGIMAVQRNSALSSDTIIGVF 108

Query: 91  THSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIW--KP 148
             + ++  L ++S    V  DL  FL+GDIL +  TDI   W IG    +  F+IW    
Sbjct: 109 FSAVMAFGLAVVSRDNAVARDLQQFLYGDILTITETDIR--WLIGLFFALAAFQIWGYNR 166

Query: 149 LLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFS 208
           LL   +N  +AKA  +     + +F  + +L++  S+  +G+ L+T+LLI+P  TAR  +
Sbjct: 167 LLYIGLNSVVAKAHRINVFFWQYLFAGLLALVVMFSVWAVGVLLVTALLIVPAATARNLA 226

Query: 209 TSPENMAILATIIGILGIIIGLY--GSLIFDTPSGPSIIITSLFLFILS 255
            +   M   + ++ +   + GL         T +G ++++ S   F+LS
Sbjct: 227 RTAGGMFWWSILVSVTSAVAGLVLSAQEWAGTATGATVVLVSCGWFLLS 275


>gi|332522711|ref|ZP_08398963.1| metal ion ABC transporter, permease protein [Streptococcus porcinus
           str. Jelinkova 176]
 gi|332313975|gb|EGJ26960.1| metal ion ABC transporter, permease protein [Streptococcus porcinus
           str. Jelinkova 176]
          Length = 279

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 146/258 (56%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALVTAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGMNFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTD--ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
             +D  I +   +  L ++ILF  +K LL T+ +  LAK  G+       + +++ +L+ 
Sbjct: 132 QDSDKWITIFVSVLVLGLIILF--FKELLLTSFDPILAKTMGINVSFYHYLLMVLLTLVS 189

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  LI ++LI P  TA  ++ S + M I+++ +G L  I+GL+    F+  +G
Sbjct: 190 VTAMQSVGTILIVAMLITPAATAYLYANSLKTMLIMSSTLGALTSILGLFLGYTFNIAAG 249

Query: 242 PSIIITSLFLFILSFFYK 259
            SI++TS  +F +SFF+ 
Sbjct: 250 SSIVLTSSIIFAISFFFS 267


>gi|309798643|ref|ZP_07692912.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus infantis SK1302]
 gi|308117729|gb|EFO55136.1| ABC transporter membrane-spanning permease - manganese transport
           [Streptococcus infantis SK1302]
          Length = 282

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 136/233 (58%), Gaps = 1/233 (0%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSD 84
           CFII + ++  GD I+H+ L GVALS I  +   I   +   L ++++  I+ N  + SD
Sbjct: 34  CFIILRGMSLMGDAISHAVLPGVALSFILGVDFFIGAIVFGLLAAIIITYIKGNSIIKSD 93

Query: 85  AILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFK 144
             +G+   S ++L ++++S  K  +TDL   LFG+ILAV  TD+ +  G+G + +++++ 
Sbjct: 94  TAIGITFSSFLALGIILISVAKS-STDLFHILFGNILAVQDTDMFITMGVGAVILLLIWI 152

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            +K LL T+ +  LAKA GM       + +++ +L+   +++ +G  LI ++LI P  TA
Sbjct: 153 FFKQLLITSFDELLAKAMGMPVNFYHYLLMVLLTLVSVTAMQSVGTILIVAMLITPAATA 212

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFF 257
             ++ S ++M  L++  G    ++GL+     +  +G SI++T+   F++SFF
Sbjct: 213 YLYANSLKSMIFLSSTFGATASVLGLFIGYSLNLAAGSSIVLTAASFFLISFF 265


>gi|308235018|ref|ZP_07665755.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis ATCC 14018]
 gi|311114194|ref|YP_003985415.1| ABC transporter membrane protein [Gardnerella vaginalis ATCC 14019]
 gi|310945688|gb|ADP38392.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Gardnerella vaginalis ATCC 14019]
          Length = 290

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 129/237 (54%)

Query: 20  TGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNE 79
            G +GC+++ + +A+ GD +AHS   G+A++ + Q  L     +    T+L++    +N 
Sbjct: 33  CGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLFGGALAGVATALIVSIFSQNR 92

Query: 80  ALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNI 139
            L  D+ +GV   S  +L +V++S        L SFLFG I  +  +DI ++   G + +
Sbjct: 93  RLREDSFIGVFFVSAFALGIVVISKASGYAGSLESFLFGSITGIPDSDIAVVAITGLIIV 152

Query: 140 MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLIL 199
            +L    K L+  +++ E ++A G+    +  +  ++ ++ + VS++ IG  L+ +LLI 
Sbjct: 153 TLLMMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVSVQIIGNVLVLALLIT 212

Query: 200 PTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSF 256
           P  TAR  +     M ILA  IG    I+G+Y S   DT +G +I++ + F+F+L++
Sbjct: 213 PAATARLLTDRLGKMMILAPAIGCASSILGMYLSWSLDTATGGTIVLVATFMFVLAW 269


>gi|310826189|ref|YP_003958546.1| ABC-3 protein [Eubacterium limosum KIST612]
 gi|308737923|gb|ADO35583.1| ABC-3 protein [Eubacterium limosum KIST612]
          Length = 275

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 146/249 (58%), Gaps = 2/249 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFM 63
           F +R++  GI + L    LG  ++ +R +  GD ++H     +A+++ F L PL++ I  
Sbjct: 13  FLVRSMVVGILVSLCAALLGVSLVLKRYSMIGDGLSHVGFAALAIAMAFNLAPLSVAI-P 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  +++  LL+I +N  +  DA + +++ S +++ +V++S    +NTD+ ++LFG ILA+
Sbjct: 72  VVVVSAFFLLRISENSKIKGDAAIALLSTSALAVGVVVISLTTGMNTDVCNYLFGSILAM 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+ L   +  + +++    +  + A T +   A+A G++ E   ++  ++T++ I +
Sbjct: 132 SVSDVRLSIILSVVVLVLFVVFYNKIFAITFDENFARATGVKTELYNMLVAILTAVTIVL 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +G  LITSL+I P + + R   +  ++ I A+++ ++  +IG+  S +  TP+G S
Sbjct: 192 GMRMMGTLLITSLIIFPALYSMRLCKTFRSVLICASVMSLVCFLIGMGFSYVRATPTGAS 251

Query: 244 IIITSLFLF 252
           I+I  + +F
Sbjct: 252 IVIVHIVVF 260


>gi|121998953|ref|YP_001003740.1| ABC-3 protein [Halorhodospira halophila SL1]
 gi|121590358|gb|ABM62938.1| ABC-3 protein [Halorhodospira halophila SL1]
          Length = 306

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 134/243 (55%), Gaps = 1/243 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + I + L  G L CF++ +R A  GD I+H+ L GVA++ +   P  I  F+
Sbjct: 33  QFMQRALLTAIAVGLVCGVLSCFVVLKRWALLGDAISHAVLPGVAIAYLIGWPFFIGAFL 92

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              LTSL +  I++   L SD  +G++  +  +L +VI+S +   +T L   LFG++L V
Sbjct: 93  AGALTSLGIGFIERTTRLKSDTAIGIMFTAAFALGVVIISQVA-TSTHLMHVLFGNVLGV 151

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + + +LL  G G + ++ +   +K L A T +   A+A GM    I    I++ +L I  
Sbjct: 152 DRSALLLTLGAGVVALLAVGLGFKALFAYTFDEIHARALGMNTAVIHYGLILLLTLTIVA 211

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  LA + G+   ++GLY +  FD  SG +
Sbjct: 212 SLETVGIILVVAMLITPGATAYLLTDRLTRMIPLAGLCGVTAAVVGLYLAYYFDVASGGA 271

Query: 244 III 246
           +++
Sbjct: 272 MVL 274


>gi|308270237|emb|CBX26849.1| hypothetical protein N47_A08780 [uncultured Desulfobacterium sp.]
          Length = 288

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 140/261 (53%), Gaps = 12/261 (4%)

Query: 7   IRALF---SGIGIVL---STGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +RA+F   + +G++L       +G  ++  R+A+F D I+HSA  GVAL LIF +     
Sbjct: 20  LRAVFMQQAMVGLILLAPMAAAMGVQVVNFRMAFFSDAISHSAFAGVALGLIFSINPHWT 79

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + +   L  L ++ +Q+   LSSD I+GV   + I+  L ++S  + V  D+  FL+GDI
Sbjct: 80  MPLFGLLVGLGIMAVQRKSTLSSDTIIGVFFSAVIAFGLAVVSRDRSVARDMQRFLYGDI 139

Query: 121 LAVNTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           L ++  DIL  W I      ++F+   +  LL   +N  LAKA  +     + IF  + +
Sbjct: 140 LTISNNDIL--WLIALFIAFMVFQALSYNRLLYIGLNSSLAKAHSINVATYQYIFAALLA 197

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI--F 236
           L++  S+  +G+ L+T++LI+P   AR F+ S   M   A ++ +   I GL  S     
Sbjct: 198 LIVMFSVWAVGVFLVTAMLIVPAAAARNFARSAGAMFWWALLVSVTSAIAGLVISAQDWA 257

Query: 237 DTPSGPSIIITSLFLFILSFF 257
           +T +G +II+ +   F++S F
Sbjct: 258 NTATGATIILVACLWFMISVF 278


>gi|254412155|ref|ZP_05025930.1| ABC 3 transport family [Microcoleus chthonoplastes PCC 7420]
 gi|196181121|gb|EDX76110.1| ABC 3 transport family [Microcoleus chthonoplastes PCC 7420]
          Length = 295

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 144/257 (56%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  R+L + + + +    +G +++ QR+A  GD I+HS L G+A++ I  + + +  F+
Sbjct: 12  SFMQRSLMTAVLVGIVCASVGSYLMVQRLALLGDAISHSVLPGLAIAYIVGVDIFLGAFL 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
              ++++V+  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+IL+
Sbjct: 72  AGIVSTIVITWIRTRSQIKEDAAMGIVFSAFFALGITLITVIQKDNKIDLNHFLFGNILS 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   +++    I  + + I+  ++K L+  T +   AKA G+    +    +++ +L I 
Sbjct: 132 VTGEEVINTAIITAIVLAIVLLLYKELMYYTFDPVGAKAAGLPTNLLNFGLMILIALTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +G+ L+ ++LI P  TA    T    M +L + IG++  I G+Y S  F+ PSGP
Sbjct: 192 ASLKAVGVILVLAMLITPGATAYLLVTRLHQMMLLGSGIGVVASISGMYLSYFFNLPSGP 251

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F+L+F + 
Sbjct: 252 AIVLVTFGFFMLAFLFS 268


>gi|307154565|ref|YP_003889949.1| ABC-3 protein [Cyanothece sp. PCC 7822]
 gi|306984793|gb|ADN16674.1| ABC-3 protein [Cyanothece sp. PCC 7822]
          Length = 297

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 142/257 (55%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++ +  + + +  F+
Sbjct: 12  SFMQRSLIEAIIVGVICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFLLNINIFVGAFV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
              L+++V+  I+    L  DA +G++  S  +L + +++ ++  N  DL  FLFG+IL 
Sbjct: 72  AGLLSTIVINLIRTRSNLKEDAAMGIVFSSFFALGITLITIIQKDNKIDLNHFLFGNILG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+     IG + I+I+   +K LL  T +   A+A G+    + L  +++  L I 
Sbjct: 132 VTVADLRDTLIIGVVVILIVVVFYKELLFYTFDKLGAQAAGLPVHLLDLGLMILIGLTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +G+ L+ SLLI P  TA         + +L  +IG++  I G+Y S  ++ PSGP
Sbjct: 192 ASLKTVGVILVLSLLITPAATAYLLVKRLHQVMLLGVVIGVISSISGMYLSYFYNLPSGP 251

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LFIL+F + 
Sbjct: 252 AIVLVASGLFILAFLFS 268


>gi|322390796|ref|ZP_08064306.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus parasanguinis ATCC 903]
 gi|321142466|gb|EFX37934.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus parasanguinis ATCC 903]
          Length = 280

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 146/254 (57%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAIGITFSSFLALGVILIGVAK-SSTDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ +L+   
Sbjct: 132 QDQDMWMTIGVGVAVLLVIVLLFRPLLLTSFDPVLAQSMGVRVKIYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  ++GL+     +   G  
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLWSMMLLSSSLGALASVLGLFIGYSLNIAVGSC 251

Query: 244 IIITSLFLFILSFF 257
           I++TS   F++SFF
Sbjct: 252 IVLTSAVFFLISFF 265


>gi|306832278|ref|ZP_07465432.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|304425717|gb|EFM28835.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
          Length = 284

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 147/262 (56%), Gaps = 11/262 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I 
Sbjct: 20  MTYHFLQNALITAVVIGIVSGAIGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIG 79

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S ++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG++
Sbjct: 80  AVIFGILASFIITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNL 138

Query: 121 LAVNTTD---ILLIWGI--GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LAV  +D    ++I GI  GFL I      +K LL T+ +  LA++ GM  +    + ++
Sbjct: 139 LAVQDSDKWVTIVISGIVIGFLIIF-----FKELLVTSFDPILAESMGMDVKFFHYLLMV 193

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           + +L+   +++ +G  LI ++LI P  TA  +  S + M +L++ IG +  I+GL+    
Sbjct: 194 LLTLVSVTAMQSVGTILIVAMLITPAATAYLYVNSLKVMVLLSSGIGAITSIVGLFLGYT 253

Query: 236 FDTPSGPSIIITSLFLFILSFF 257
           F+   G SI++TS F+F++SFF
Sbjct: 254 FNIAVGSSIVLTSAFIFLVSFF 275


>gi|69244847|ref|ZP_00603071.1| ABC-3 [Enterococcus faecium DO]
 gi|257879100|ref|ZP_05658753.1| ABC-3 transporter [Enterococcus faecium 1,230,933]
 gi|257882093|ref|ZP_05661746.1| ABC-3 transporter [Enterococcus faecium 1,231,502]
 gi|257883725|ref|ZP_05663378.1| ABC-3 transporter [Enterococcus faecium 1,231,501]
 gi|257889930|ref|ZP_05669583.1| ABC-3 transporter [Enterococcus faecium 1,231,410]
 gi|258615480|ref|ZP_05713250.1| ABC transporter, permease protein [Enterococcus faecium DO]
 gi|260562721|ref|ZP_05833216.1| ABC-3 transporter [Enterococcus faecium C68]
 gi|261208117|ref|ZP_05922792.1| ABC-3 transporter [Enterococcus faecium TC 6]
 gi|289566360|ref|ZP_06446789.1| manganese transport system membrane protein mntC [Enterococcus
           faecium D344SRF]
 gi|293552713|ref|ZP_06673378.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1039]
 gi|293563550|ref|ZP_06677998.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|293567247|ref|ZP_06678602.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1071]
 gi|294614592|ref|ZP_06694497.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1636]
 gi|294617376|ref|ZP_06697012.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|314939304|ref|ZP_07846550.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|314941293|ref|ZP_07848187.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|314947824|ref|ZP_07851231.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
 gi|314950697|ref|ZP_07853775.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|314992061|ref|ZP_07857512.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|314995519|ref|ZP_07860617.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|68196201|gb|EAN10631.1| ABC-3 [Enterococcus faecium DO]
 gi|257813328|gb|EEV42086.1| ABC-3 transporter [Enterococcus faecium 1,230,933]
 gi|257817751|gb|EEV45079.1| ABC-3 transporter [Enterococcus faecium 1,231,502]
 gi|257819563|gb|EEV46711.1| ABC-3 transporter [Enterococcus faecium 1,231,501]
 gi|257826290|gb|EEV52916.1| ABC-3 transporter [Enterococcus faecium 1,231,410]
 gi|260072880|gb|EEW61240.1| ABC-3 transporter [Enterococcus faecium C68]
 gi|260077701|gb|EEW65417.1| ABC-3 transporter [Enterococcus faecium TC 6]
 gi|289161869|gb|EFD09740.1| manganese transport system membrane protein mntC [Enterococcus
           faecium D344SRF]
 gi|291590051|gb|EFF21844.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1071]
 gi|291592573|gb|EFF24177.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1636]
 gi|291596367|gb|EFF27624.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|291603137|gb|EFF33324.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1039]
 gi|291604552|gb|EFF34038.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|313590258|gb|EFR69103.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|313593382|gb|EFR72227.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|313597119|gb|EFR75964.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|313599894|gb|EFR78737.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|313641395|gb|EFS05975.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|313645804|gb|EFS10384.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
          Length = 279

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 142/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQSA-TDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+L  ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMLSAVVGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|258517251|ref|YP_003193473.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257780956|gb|ACV64850.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 285

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 155/263 (58%), Gaps = 12/263 (4%)

Query: 4   EFFIRALFSG--IGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTIC 60
           +F +RAL +G  +GI+     +G F++ +R ++  DT+AH +L GVAL L   + P  + 
Sbjct: 8   DFMVRALAAGAIVGIICPA--IGVFLVLRRYSFMADTLAHVSLAGVALGLYLGVNPFAVT 65

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +    T  +L + ++++N+ L  +AIL ++  + ++LA+V++S  +    DL  +LFG I
Sbjct: 66  VGTALT-AALSIERMRENQKLPGEAILALVMSAGLALAVVLISLSQGFGVDLMGYLFGSI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTV---NYELAKAEGMQPEKIKLIFIMIT 177
           L V   D   +WGI  L +++L  ++       +   + + A+  G+  +K+ L+FI++T
Sbjct: 125 LTVGPRD---VWGILLLGLLVLLVLFFLFKEFFLMAFDEDYARVSGLPYDKLNLVFIILT 181

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +L +++S++ +G  L+ +L+++P +T+   S S + +  L+  +GI  I+ GL  S  ++
Sbjct: 182 ALTVAISLRIVGGLLVGALMVIPVLTSLLVSRSFKQVFFLSMFLGISEILTGLVVSYYWN 241

Query: 238 TPSGPSIIITSLFLFILSFFYKK 260
            PSG ++++T+L +F  ++   K
Sbjct: 242 LPSGGAVVLTALAVFFAAYSSGK 264


>gi|89894590|ref|YP_518077.1| hypothetical protein DSY1844 [Desulfitobacterium hafniense Y51]
 gi|219669024|ref|YP_002459459.1| ABC transporter [Desulfitobacterium hafniense DCB-2]
 gi|89334038|dbj|BAE83633.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539284|gb|ACL21023.1| ABC-3 protein [Desulfitobacterium hafniense DCB-2]
          Length = 285

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 146/252 (57%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL   I + + T  +G F+I +R+A+ G+ +AH +L G+A+  +    L I   + 
Sbjct: 12  FMQRALIGTIAVAVLTAVVGTFVILRRLAFIGEGLAHGSLAGLAIGYLLGWNLYIAGNIY 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               +L +  + +   +S D  +G++  ++++L + ++S +K+ +++LT +LFG +L++ 
Sbjct: 72  TIGLALFIGALHEKAKVSLDTAIGILFSTSMALGVALISSLKFYSSNLTGYLFGSVLSIG 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           + D+++I G   + + IL   +K  +    + E+A+  G+   ++    + + ++ + V+
Sbjct: 132 SFDLMIIVGSTCVILAILAVFYKEFVYYAFDPEMAEVTGLPRARLHYAMLAMIAVTVVVA 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
            + +GI L+T+LL +P  +A +++ S + + +L+   G++  I+GLY S   +  SG SI
Sbjct: 192 SQTVGIILVTALLTIPAASAFQWTHSLKKLVLLSVFFGLISAILGLYLSYYLNVASGASI 251

Query: 245 IITSLFLFILSF 256
            +T+  +F+LSF
Sbjct: 252 ALTAAVIFLLSF 263


>gi|288906231|ref|YP_003431453.1| manganese ABC transporter (permease component) [Streptococcus
           gallolyticus UCN34]
 gi|288732957|emb|CBI14536.1| Putaitve manganese ABC transporter (permease component)
           [Streptococcus gallolyticus UCN34]
          Length = 272

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 147/262 (56%), Gaps = 11/262 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I 
Sbjct: 8   MTYHFLQNALVTAVVIGIVSGAIGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S ++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG++
Sbjct: 68  AVIFGILASFIITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNL 126

Query: 121 LAVNTTD---ILLIWGI--GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LAV  +D    ++I GI  GFL I      +K LL T+ +  LA++ GM  +    + ++
Sbjct: 127 LAVQDSDKWVTIVISGIVIGFLLIF-----FKELLVTSFDPILAESMGMNVKFFHYLLMV 181

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           + +L+   +++ +G  LI ++LI P  TA  +  S + M +L++ IG +  I+GL+    
Sbjct: 182 LLTLVSVTAMQSVGTILIVAMLITPAATAYLYVNSLKVMVLLSSGIGAITSIVGLFLGYT 241

Query: 236 FDTPSGPSIIITSLFLFILSFF 257
           F+   G SI++TS F+F++SFF
Sbjct: 242 FNIAVGSSIVLTSAFIFLVSFF 263


>gi|325979203|ref|YP_004288919.1| metal cation ABC transporter membrane protein [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
 gi|325179131|emb|CBZ49175.1| metal cation ABC transporter membrane protein [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 272

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 147/262 (56%), Gaps = 11/262 (4%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I 
Sbjct: 8   MTYHFLQNALVTAVVIGIVSGAIGCFIILRSMSLMGDAISHAVLPGVAISFILGINFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S ++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG++
Sbjct: 68  AVIFGILASFIITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNL 126

Query: 121 LAVNTTD---ILLIWGI--GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LAV  +D    ++I GI  GFL I      +K LL T+ +  LA++ GM  +    + ++
Sbjct: 127 LAVQDSDKWVTIVISGIVIGFLLIF-----FKELLVTSFDPILAESMGMNVKFFHYLLMV 181

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           + +L+   +++ +G  LI ++LI P  TA  +  S + M +L++ IG +  I+GL+    
Sbjct: 182 LLTLVSVTAMQSVGTILIVAMLITPAATAYLYVNSLKVMVLLSSGIGAITSIVGLFLGYT 241

Query: 236 FDTPSGPSIIITSLFLFILSFF 257
           F+   G SI++TS F+F++SFF
Sbjct: 242 FNIAVGSSIVLTSAFIFLVSFF 263


>gi|328947859|ref|YP_004365196.1| ABC-type transporter, integral membrane subunit [Treponema
           succinifaciens DSM 2489]
 gi|328448183|gb|AEB13899.1| ABC-type transporter, integral membrane subunit [Treponema
           succinifaciens DSM 2489]
          Length = 281

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 143/251 (56%), Gaps = 18/251 (7%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFMIATLTSLVLLQIQKNE 79
           G LG +++  R+++F D I HSAL G+A+ ++F +  +TI + + + L    ++ ++   
Sbjct: 37  GALGTYVVSNRMSFFSDAIGHSALTGIAIGVLFGIHDVTISMVLFSMLLGFSIIMVKSKG 96

Query: 80  ALSSDAILGVITHSTISLALVILS----FMKWVNTDLTSFLFGDILAVNTTDILLIW--G 133
             SSD I+GV + ++++L +V+LS    F K+       +L GDIL++   +IL ++   
Sbjct: 97  KSSSDTIIGVFSSTSVALGIVLLSAGGNFSKY-----QKYLVGDILSIQPNEILFLFFCA 151

Query: 134 IGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLI 193
           I  L + I F  +  +L  +++   AK+ G++   I+ +F ++T+ ++SV I++ G+ +I
Sbjct: 152 IALLLVWIFF--YNKMLIVSLHSSFAKSRGIKTVFIEQVFALLTAAIVSVCIRWTGLLVI 209

Query: 194 TSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITS----L 249
            S+L+LP  +AR  S +     I++ +I + G I GL  S    + SG SI++ +    L
Sbjct: 210 NSMLVLPAASARFVSRTSRRYLIVSELISLAGGIAGLCFSYYTGSASGASIVLVNSAFFL 269

Query: 250 FLFILSFFYKK 260
             FI+SF  K 
Sbjct: 270 ICFIISFLKKN 280


>gi|313891250|ref|ZP_07824868.1| metal ion ABC transporter, permease protein [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313120317|gb|EFR43438.1| metal ion ABC transporter, permease protein [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 279

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 145/256 (56%), Gaps = 5/256 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  L   I   +
Sbjct: 13  HFLQNALVTAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGLNFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASILITFIKENSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTD--ILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
             +D  I +   +  L ++ILF  +K LL T+ +  LAK  G+       + +++ +L+ 
Sbjct: 132 QDSDKWITIFVSVLVLALIILF--FKELLLTSFDPILAKTMGINVSFYHYLLMVLLTLVS 189

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  LI ++LI P  TA  ++ S + M I+++ +G L  I+GL+    F+  +G
Sbjct: 190 VTAMQSVGTILIVAMLITPAATAYLYANSLKTMLIMSSTLGALTSILGLFLGYTFNIAAG 249

Query: 242 PSIIITSLFLFILSFF 257
            SI++TS  +F +SFF
Sbjct: 250 SSIVLTSSIIFAISFF 265


>gi|315635990|ref|ZP_07891250.1| cation ABC superfamily ATP binding cassette transporter, membrane
           protein [Arcobacter butzleri JV22]
 gi|315479711|gb|EFU70384.1| cation ABC superfamily ATP binding cassette transporter, membrane
           protein [Arcobacter butzleri JV22]
          Length = 266

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 138/246 (56%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL SGI I ++ G +G  ++  ++ +    IAHS+  G+ L++   +P+ +   +
Sbjct: 8   DFIQNALISGILISIAAGIIGSLVVVNKVTFLTGGIAHSSYGGIGLAIYLGIPVLLGATI 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A +T++++  I        DAI+G++  S +++ ++ +      N DL S+LFG I+AV
Sbjct: 68  FAVITAILIAFITLKNRTRIDAIIGMMWASGMAIGIIFVDLTPGYNVDLMSYLFGSIIAV 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+ +  +    I I+   +K +LA + + E A   G+  E    + +++++L +  
Sbjct: 128 SHQDIIYMTLLDVFIIAIVVFFYKQILAVSYDSEFASLRGINVEFFYTLILILSALCVVA 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +IK +G+ L+ +LL +PT  A  F++   NM I++ I+  +  IIGL  S ++D  SG S
Sbjct: 188 AIKAVGLILVIALLTIPTYLAETFASRLSNMMIISAILATIFTIIGLVASYLYDISSGAS 247

Query: 244 IIITSL 249
           II+ ++
Sbjct: 248 IIMVAV 253


>gi|227872127|ref|ZP_03990498.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Oribacterium sinus F0268]
 gi|227842019|gb|EEJ52278.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Oribacterium sinus F0268]
          Length = 274

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 141/254 (55%), Gaps = 6/254 (2%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIF 62
           +F IRA+  G  + L +  LG  ++ +R +  GD ++H     +A++   QL P+++ I 
Sbjct: 12  DFMIRAIIVGSLVSLCSTLLGTSLVLKRYSMIGDGLSHVGFAALAIAYALQLAPMSVSI- 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            I  + +  LLQ+++N  +  DA   ++    +++ ++ +S    +NTD+ +++FG ILA
Sbjct: 71  PICVIAAFFLLQLEENSKIKGDAATALLCSGALAVGVMTISLTTGMNTDVCNYMFGSILA 130

Query: 123 VNTTDILL--IWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           ++ +D+ L  I  +  L + I F  +  + A T +   AKA G       ++  ++TS+ 
Sbjct: 131 ISPSDMRLSVILSVVVLFLYIFF--YPRIFAVTFDENFAKASGTNTRFYNMVLALLTSIT 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I + ++ +G  LI+SL++ P++TA R   +     ILA+I+ + G  +G+  S ++  P+
Sbjct: 189 IVLGMRMMGTLLISSLIVFPSITAMRVCKNFLGTIILASILSLFGFFVGMTLSFLYRIPT 248

Query: 241 GPSIIITSLFLFIL 254
           G SI++  + LF L
Sbjct: 249 GASIVVIDIVLFFL 262


>gi|261407250|ref|YP_003243491.1| ABC-3 protein [Paenibacillus sp. Y412MC10]
 gi|261283713|gb|ACX65684.1| ABC-3 protein [Paenibacillus sp. Y412MC10]
          Length = 288

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 143/258 (55%), Gaps = 2/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGP-LGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           EF  RA ++G G++   GP LG F++ +R     DT++H +L GVAL    +L   +  F
Sbjct: 7   EFMQRAFWAG-GLIGVIGPVLGVFLMLRRQVLMADTLSHVSLAGVALGSFLKLNPALSGF 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A + +LV+ Q+++     ++  + +I  S ++L++V++S  + ++   +S+LFG I+A
Sbjct: 66  AMAMIGALVIEQLRRVYRTYTEVPVAIIMTSGLALSVVLMSLNQNLSKSFSSYLFGSIVA 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ T + LI  +  + ++    + +PL     + E A A GM+   +  +F + T + ++
Sbjct: 126 VSDTQLRLIAVVAAVGMIFFVGLRRPLYNFAFDEETAAASGMRVSLLSFLFAVFTGMTVA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++  +G+ L+++L++LP   A R +T       +A  +G+ G+  GL  S   +TP G 
Sbjct: 186 AAMPVVGVLLVSALIVLPASIALRMATGFLAAMGIAVFVGLSGVFSGLAASYYLNTPPGG 245

Query: 243 SIIITSLFLFILSFFYKK 260
           +I +  L   IL+  ++K
Sbjct: 246 TIALILLGFLILAVIFQK 263


>gi|52081046|ref|YP_079837.1| transcriptional regulator [Bacillus licheniformis ATCC 14580]
 gi|52786423|ref|YP_092252.1| YceA [Bacillus licheniformis ATCC 14580]
 gi|319644996|ref|ZP_07999229.1| YceA protein [Bacillus sp. BT1B_CT2]
 gi|52004257|gb|AAU24199.1| transcriptional regulator [Bacillus licheniformis ATCC 14580]
 gi|52348925|gb|AAU41559.1| YceA [Bacillus licheniformis ATCC 14580]
 gi|317392805|gb|EFV73599.1| YceA protein [Bacillus sp. BT1B_CT2]
          Length = 286

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 140/267 (52%), Gaps = 8/267 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           + EF   A  SGI I L    LG FI+ +R++   D ++H +L G+A SL       +  
Sbjct: 7   HYEFLQNAFISGILIGLIAPLLGVFIVVRRLSLIADALSHVSLAGIAASLYAGKQFAVLA 66

Query: 62  --------FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLT 113
                      +   SL++ +++       +  + +I    I ++++ +S     NTDL 
Sbjct: 67  GVSPIYFGMAFSVAGSLIIERLRTVYKHYQELAIPIIMSGGIGISVIFISLADGFNTDLF 126

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           S+LFG + AV+  D+L+I GI    ++++F ++K L   + + E AKA G+  + I  IF
Sbjct: 127 SYLFGSVSAVSREDMLVIVGISAAVLIVVFSLFKELFLLSFDEEHAKASGISAKWIHFIF 186

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
           I+I +L+I+ S++ +G  L+++L+ LP   + R +   +    L+ + G L +I+GL  +
Sbjct: 187 ILIVALVIAASMRIVGTLLVSALMTLPVAASMRIAKGFKQAIFLSILFGELSVIVGLVLA 246

Query: 234 LIFDTPSGPSIIITSLFLFILSFFYKK 260
              D   G +I++ S+F+ IL   Y K
Sbjct: 247 YHLDLAPGGTIVMLSIFILILCISYNK 273


>gi|114320203|ref|YP_741886.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226597|gb|ABI56396.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 312

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 142/251 (56%), Gaps = 1/251 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL + + +    G L C+++ +R +  GD I+H+ L GVA++ +   P  I  F+ 
Sbjct: 38  FMQRALLTSVLVGTVCGMLSCYVVLKRWSLLGDAISHAVLPGVAVAYLLGWPFFIGAFIT 97

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             LTSL +  I+++  + SDA +G++  +  +L +VI+S +   +T L   LFG++L V 
Sbjct: 98  GALTSLGIGAIERHTRIKSDAAMGLMFTAAFALGIVIISKIA-SSTHLMHILFGNVLGVQ 156

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            + +LL    G +  ++++  ++PLL  T +   A+A G +   I    I++ +L I  S
Sbjct: 157 HSALLLTLVSGIVAFLVVWLFYRPLLLYTFDPLQAQALGFRTGAIHYGLILLLTLTIVAS 216

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L+ ++LI P  TA   +     M +L+  +G++  ++GLY S  FD  SG +I
Sbjct: 217 LETVGIILVVAMLITPGATAHLLTERLTTMMLLSIGVGVISAVVGLYLSFFFDVASGGAI 276

Query: 245 IITSLFLFILS 255
           ++ +  LF+++
Sbjct: 277 VLVATGLFLIA 287


>gi|199598885|ref|ZP_03212295.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus rhamnosus HN001]
 gi|229552774|ref|ZP_04441499.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus rhamnosus LMS2-1]
 gi|258509415|ref|YP_003172166.1| iron ABC transporter membrane protein [Lactobacillus rhamnosus GG]
 gi|258540610|ref|YP_003175109.1| iron ABC transporter membrane protein [Lactobacillus rhamnosus Lc
           705]
 gi|199590193|gb|EDY98289.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus rhamnosus HN001]
 gi|229313879|gb|EEN79852.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus rhamnosus LMS2-1]
 gi|257149342|emb|CAR88315.1| ABC transporter, iron transporter membrane protein [Lactobacillus
           rhamnosus GG]
 gi|257152286|emb|CAR91258.1| ABC transporter, iron transporter membrane protein [Lactobacillus
           rhamnosus Lc 705]
 gi|259650696|dbj|BAI42858.1| manganese ABC transporter permease component [Lactobacillus
           rhamnosus GG]
          Length = 297

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 146/258 (56%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   +
Sbjct: 15  DFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGVNVMIGASV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++  +  N  + +D  +GV+  +  +L  +++S M    T+L   LFG+ILAV
Sbjct: 75  FGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILIS-MAESATNLHHILFGNILAV 133

Query: 124 NTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           + +DI+    +  L I+ILF +  +K LL T+ +   AK  G+    I    +++ +L+ 
Sbjct: 134 SDSDIMTTAVV--LGIVILFVVLFYKELLITSFDNTFAKTYGLNTTAIHYALMLVLTLVT 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI L+ ++LI P  TA  ++   E M ++A  +G++  I GLY S  F+  SG
Sbjct: 192 VSALQTVGIILVVAMLITPAATAFLWTDRLETMLVMAASVGVISSITGLYFSFTFNWASG 251

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I++ +  LF +SF + 
Sbjct: 252 PAIVLVAAVLFAISFVFS 269


>gi|86608640|ref|YP_477402.1| manganese/zinc/iron chelate ABC transporter permease [Synechococcus
           sp. JA-2-3B'a(2-13)]
 gi|86557182|gb|ABD02139.1| manganese/zinc/iron chelate ABC transporter (MZT) family, permease
           protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 277

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   + + +    +G +++ Q +A  GD I+HS L G+A++ +  L L +  F+
Sbjct: 15  AFMQRALLVAVAVGILCAVVGSYLLVQSLALLGDAISHSLLPGLAIAYMLGLNLFVGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFM-KWVNTDLTSFLFGDILA 122
              L++L++  I+    L  DA +G++  +  +L +++++ + +    DL  FLFG++L 
Sbjct: 75  AGLLSALLIQWIRSASPLKPDAAMGIVFSAFFALGILLITLIQRRARIDLNHFLFGNLLG 134

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           VN  D+L + GI  L + ++   +K L   + +   AKA G+  E++    +++TSL + 
Sbjct: 135 VNAVDVLTVVGITLLVLGLVALFFKELTFYSFDPLGAKAAGLPTERLGWGLMVLTSLTLV 194

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +G+ L+ ++LI P  TA         + +L ++ G+   ++G+Y S   +  SGP
Sbjct: 195 ASMKAVGVLLVLAMLITPAATAYLVVPRLHQVMLLGSLFGVSASLLGMYASYYLNVASGP 254

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F L+F  +
Sbjct: 255 AIVLVASAWFSLAFLGR 271


>gi|227552351|ref|ZP_03982400.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecium TX1330]
 gi|257895076|ref|ZP_05674729.1| ABC-3 transporter [Enterococcus faecium Com12]
 gi|227178519|gb|EEI59491.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecium TX1330]
 gi|257831641|gb|EEV58062.1| ABC-3 transporter [Enterococcus faecium Com12]
          Length = 279

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 141/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQSA-TDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+   +IG++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMFSAVIGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|281491860|ref|YP_003353840.1| manganese ABC transporter permease [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375571|gb|ADA65077.1| Manganese ABC transporter, permease protein [Lactococcus lactis
           subsp. lactis KF147]
          Length = 284

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 142/253 (56%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   +   +
Sbjct: 13  HFLQNALVTAVVIGVVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFVGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L+S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLSSIIITFIKNNSIIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  L  G+  + ++++   +K LL T+ +  +A+A GM+      + +++ +L+   
Sbjct: 132 QDIDKWLTIGVSGIVLIVIILFFKELLITSFDPLMARAIGMKVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  ++ S   M IL++ +G +  ++GL+    F+   G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYTNSLRKMIILSSSLGAVSSVLGLFIGYSFNIAVGSS 251

Query: 244 IIITSLFLFILSF 256
           I+ITS  +F +SF
Sbjct: 252 IVITSAIIFAISF 264


>gi|332297739|ref|YP_004439661.1| ABC-type transporter, integral membrane subunit [Treponema
           brennaborense DSM 12168]
 gi|332180842|gb|AEE16530.1| ABC-type transporter, integral membrane subunit [Treponema
           brennaborense DSM 12168]
          Length = 279

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 136/239 (56%), Gaps = 12/239 (5%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF--QLPLTICIFMIATLTSLVLLQIQKN 78
           G LG F++  ++A+F D I HSAL G+A  ++F  + PL + + + + +    ++ ++  
Sbjct: 37  GGLGSFVVSNKMAFFSDAIGHSALTGIAFGVLFGIREPL-VSMILFSLILGFSIISVKTK 95

Query: 79  EALSSDAILGVITHSTISLALVILS----FMKWVNTDLTSFLFGDILAVNTTDILLIWGI 134
              S+D I+GV + + ++L +V+LS    F K+       +L GDIL++  ++I L+ G 
Sbjct: 96  GKSSADTIIGVFSSTAVALGIVLLSATGSFAKY-----QRYLIGDILSIKPSEIALLAGS 150

Query: 135 GFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLIT 194
           G L +++   ++  +L T ++   AK+ G++    + +F ++T+L+++VSI++ G+ +I 
Sbjct: 151 GILALLVWILLYNKMLLTNLHRTFAKSRGVRVFATEQLFALLTALIVTVSIRWTGLLVIN 210

Query: 195 SLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
           SLL+LP   AR  + S     + A +I I   + GL  S      +G +I++ +  LFI
Sbjct: 211 SLLVLPAAAARLVTRSSSRFLLTAVLISIFSSVAGLAISFYAGAAAGATIVLVNAALFI 269


>gi|257886478|ref|ZP_05666131.1| ABC-3 transporter [Enterococcus faecium 1,141,733]
 gi|257892685|ref|ZP_05672338.1| ABC-3 transporter [Enterococcus faecium 1,231,408]
 gi|257897684|ref|ZP_05677337.1| ABC-3 transporter [Enterococcus faecium Com15]
 gi|293377939|ref|ZP_06624120.1| ABC 3 transport family protein [Enterococcus faecium PC4.1]
 gi|293571398|ref|ZP_06682428.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E980]
 gi|257822532|gb|EEV49464.1| ABC-3 transporter [Enterococcus faecium 1,141,733]
 gi|257829064|gb|EEV55671.1| ABC-3 transporter [Enterococcus faecium 1,231,408]
 gi|257835596|gb|EEV60670.1| ABC-3 transporter [Enterococcus faecium Com15]
 gi|291608537|gb|EFF37829.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E980]
 gi|292643486|gb|EFF61615.1| ABC 3 transport family protein [Enterococcus faecium PC4.1]
          Length = 279

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 141/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQSA-TDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+   ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMFSAVVGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|118580553|ref|YP_901803.1| ABC-3 protein [Pelobacter propionicus DSM 2379]
 gi|118503263|gb|ABK99745.1| ABC-3 protein [Pelobacter propionicus DSM 2379]
          Length = 277

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 139/259 (53%), Gaps = 3/259 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL +G  I +    LG F++ +R++  GD +AH      A++L  +L     + + 
Sbjct: 11  FIQRALLAGTLIAVLCSVLGVFLVLRRMSLIGDGLAHVTFGSTAIALALKLYSASSLLVS 70

Query: 65  ATLTSLV---LLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +  L    +L++ +   L+ DA +G+++   I L + + S     N DL S+LFG+IL
Sbjct: 71  LPVVLLSSLGILKLTEKARLNGDAAIGIVSSLGICLGITMASVGGGYNVDLLSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           ++   ++ +  G+  L + +L   +  LLA T N ELA+  G+    I  + +++T+L +
Sbjct: 131 SITPEEVWISAGLFCLVMTLLVLYYNELLAITFNEELARVSGVATNLINAVLVLLTALSV 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            +++K +GI LI+SLLILP  +A + + S     +LA   G   ++ G+  S + + P+ 
Sbjct: 191 VLAMKLVGIMLISSLLILPAASALQLARSFRACVVLAAFQGGCSVVAGILTSFVTNLPAS 250

Query: 242 PSIIITSLFLFILSFFYKK 260
            ++++ +L  F  +F  ++
Sbjct: 251 ATVVLINLLFFSCAFLLRR 269


>gi|168206361|ref|ZP_02632366.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens E str. JGS1987]
 gi|170662174|gb|EDT14857.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens E str. JGS1987]
          Length = 269

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A  +G  I L    +G F++ +R +  GDT++HS+  GVA+ L+F     +  F+
Sbjct: 11  EFMRNAFMAGFIISLLCPCIGLFLVLKRYSMIGDTLSHSSFAGVAIGLVFGFNPLLTAFL 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             T+ +L++  ++      ++  + +I   ++ LAL+++S  K  +T + SFLFG IL V
Sbjct: 71  FTTICALLIELLRNYYKKYAELSMSIILTFSLGLALILVSSGKS-STTVNSFLFGSILTV 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD+ +I  +  L  + +F ++  L+ TT + E AK  G+  + I  IF +I    ISV
Sbjct: 130 SKTDLTIIALVSLLCFIGIFSLYDKLVYTTFDEEGAKVSGINTKLINYIFTIIVGATISV 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +I+S++++P+ TA +F        I++ IIG++ ++ GL  + +FD   G +
Sbjct: 190 SIRVMGILVISSIIVIPSATAMQFKKGFTKSLIISMIIGVIDVLSGLLLASLFDLAPGGT 249

Query: 244 IIITSLFLFILSFFYKK 260
           I +TS+ + ILS    +
Sbjct: 250 IALTSVIVLILSLILNR 266


>gi|257868857|ref|ZP_05648510.1| cation ABC transporter [Enterococcus gallinarum EG2]
 gi|257803021|gb|EEV31843.1| cation ABC transporter [Enterococcus gallinarum EG2]
          Length = 585

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 141/258 (54%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++  F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS I  +   + 
Sbjct: 10  VHYHFLQNALITAVAIGVVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYILGVNFFVG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++
Sbjct: 70  AIFFGVLASIIITYISNNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D  +   I  L I ++   ++PLL T+ +  +AKA GM  +    + +++ +L+
Sbjct: 129 LAVQEGDKWVTIAIALLVIALIMIFFRPLLITSFDPMMAKAFGMNVQVYHYLLMLLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LL+ P  TA  F+    +M ++A I+G    +IGL+    F+  +
Sbjct: 189 SVTAMQSVGTILIVALLVTPAATAYLFTKRLSHMMVIAGILGGASSVIGLFIGYSFNIAA 248

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++T+  LF+L F +
Sbjct: 249 GSSIVLTAAILFVLGFLF 266


>gi|39998075|ref|NP_954026.1| ABC transporter permease [Geobacter sulfurreducens PCA]
 gi|39985020|gb|AAR36376.1| ABC transporter, permease protein [Geobacter sulfurreducens PCA]
 gi|298507015|gb|ADI85738.1| divalent manganese/zinc ABC transporter, membrane protein
           [Geobacter sulfurreducens KN400]
          Length = 272

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 152/260 (58%), Gaps = 5/260 (1%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---LTICI 61
           F +RA+ +G  I      LG F++ +R++  GD +AH     VALSL F+LP     +  
Sbjct: 11  FLLRAMVAGSLIAALCAILGIFLVLRRLSLIGDGLAHVTFGSVALSLFFRLPSVHAALAA 70

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L++L +L++ +   +  DA +G+++   I+  +++ S     N DL S+LFG+IL
Sbjct: 71  IPCVLLSALGILRLAERARIYGDAAIGIVSSLGIATGIMLASMAGGFNVDLFSYLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIW-KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +++ ++ L+  GI FL ++I   ++ + L A T + ELA+  G++ ++I  + +++T L 
Sbjct: 131 SISPSE-LVQTGILFLVVVIAVGLFSRELFAITFDEELARTSGIRVDRINGVLVLLTGLT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + +++K +G+ LI++LLILP V + + +       ILA + G+L ++ G+  S + + P+
Sbjct: 190 VVLAMKVVGVMLISALLILPAVASLQLARGFRTAIILAVVFGVLSVVTGVVVSFLANLPT 249

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +II+ +   F L+F  ++
Sbjct: 250 GATIIMINFLAFALAFTLRR 269


>gi|157736808|ref|YP_001489491.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
 gi|157698662|gb|ABV66822.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
          Length = 266

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 138/246 (56%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL SGI I ++ G +G  ++  ++ +    IAHS+  G+ L++   +P+ +   +
Sbjct: 8   DFIQNALISGILISIAAGIIGSLVVVNKVTFLTGGIAHSSYGGIGLAIYLGIPVLLGATI 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A +T++++  I        DAI+G++  S +++ ++ +      N DL S+LFG I+AV
Sbjct: 68  FAVITAILIAFITLKNRTRIDAIIGMMWASGMAIGIIFVDLTPGYNVDLMSYLFGSIIAV 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+ +  +    I I+   +K +LA + + E A   G+  E    + +++++L +  
Sbjct: 128 SHQDIIYMTLLDVFIIAIVVFFYKQILAVSYDSEFASLRGINVEFFYTLILILSALCVVA 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +IK +G+ L+ +LL +PT  A  F++   NM I++ I+  +  IIGL  S ++D  SG S
Sbjct: 188 AIKAVGLILVIALLTIPTYLAETFASRLSNMMIISAILATIFTIIGLVVSYLYDISSGAS 247

Query: 244 IIITSL 249
           II+ ++
Sbjct: 248 IIMVAV 253


>gi|18310439|ref|NP_562373.1| ABC transporter [Clostridium perfringens str. 13]
 gi|110800400|ref|YP_696146.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens ATCC 13124]
 gi|110803351|ref|YP_698762.1| metal (zinc) transport protein (ABC transporter permease) zurM
           [Clostridium perfringens SM101]
 gi|169347204|ref|ZP_02866143.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens C str. JGS1495]
 gi|170763938|ref|ZP_02635672.2| putative zinc ABC transporter, permease protein [Clostridium
           perfringens B str. ATCC 3626]
 gi|170764252|ref|ZP_02639364.2| putative zinc ABC transporter, permease protein [Clostridium
           perfringens CPE str. F4969]
 gi|182420485|ref|ZP_02642469.2| putative zinc ABC transporter, permease protein [Clostridium
           perfringens NCTC 8239]
 gi|182624746|ref|ZP_02952527.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens D str. JGS1721]
 gi|18145119|dbj|BAB81163.1| probable ABC transporter [Clostridium perfringens str. 13]
 gi|110675047|gb|ABG84034.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens ATCC 13124]
 gi|110683852|gb|ABG87222.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens SM101]
 gi|169296600|gb|EDS78731.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens C str. JGS1495]
 gi|170711830|gb|EDT24012.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens B str. ATCC 3626]
 gi|170714743|gb|EDT26925.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens CPE str. F4969]
 gi|177910143|gb|EDT72537.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens D str. JGS1721]
 gi|182381032|gb|EDT78511.1| putative zinc ABC transporter, permease protein [Clostridium
           perfringens NCTC 8239]
          Length = 269

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A  +G  I L    +G F++ +R +  GDT++HS+  GVA+ L+F     +  F+
Sbjct: 11  EFMRNAFMAGFIISLLCPCIGLFLVLKRYSMIGDTLSHSSFAGVAIGLVFGFNPLLTAFL 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             T+ +L++  ++      ++  + +I   ++ LAL+++S  K  +T + SFLFG IL V
Sbjct: 71  FTTICALLIELLRNYYKKYAELSMSIILTFSLGLALILVSSGKS-STTVNSFLFGSILTV 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD+ +I  +  L  + +F ++  L+ TT + E AK  G+  + I  IF +I    ISV
Sbjct: 130 SKTDLTIIALVSLLCFIGIFSLYDKLVYTTFDEEGAKVSGINTKLINYIFTIIVGATISV 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +I+S++++P  TA +F        I++ IIG++ ++ GL  + +FD   G +
Sbjct: 190 SIRVMGILVISSIIVIPAATAMQFKKGFTKSLIISMIIGVIDVLSGLLLASLFDLAPGGT 249

Query: 244 IIITSLFLFILSFFYKK 260
           I +TS+ + ILS    +
Sbjct: 250 IALTSVIVLILSLILNR 266


>gi|319652731|ref|ZP_08006840.1| MntD protein [Bacillus sp. 2_A_57_CT2]
 gi|317395547|gb|EFV76276.1| MntD protein [Bacillus sp. 2_A_57_CT2]
          Length = 285

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 143/260 (55%), Gaps = 3/260 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVA+S +  +     
Sbjct: 8   MQYGFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYMLGVNFFFG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   +T++ +  + +N  +  D  +G++  +  +  ++I++ +K  +TDL   LFG++
Sbjct: 68  AVISGVITAIAIGFVSQNSRIKHDTSIGIMFTAAFASGIIIITMLK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+ +  GI    +  ++  +K LL T+ +  +  A G+ P +    F+M    M
Sbjct: 127 LAVRLSDMWITLGISLFVLGAVYLFYKELLVTSFDETMGAAYGL-PVRFIHYFLMTLLTM 185

Query: 181 ISV-SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           ++V S++ +GI L+ ++LI P   A   +     M  LA+ IG++  I+GLY S  ++  
Sbjct: 186 VTVASLQTVGIVLVVAMLITPAAAAYLLTERLWMMIFLASGIGVISSIVGLYFSFTYNLA 245

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SG +I+I+S  +FIL F + 
Sbjct: 246 SGATIVISSTAIFILVFLFS 265


>gi|228476887|ref|ZP_04061532.1| manganese transport system membrane protein MntB [Streptococcus
           salivarius SK126]
 gi|228251461|gb|EEK10606.1| manganese transport system membrane protein MntB [Streptococcus
           salivarius SK126]
          Length = 279

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 142/254 (55%), Gaps = 1/254 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I +  G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITALVIGIVGGAVGCFIILRGMSLMGDAISHAVLPGVAISFILGINFFIGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S ++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASTMITYIKSNSIIKSDTAIGITFSSFLALGIILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +   +  L +  +   ++PLL T+ +  LAK+ G++      + ++I +L+   
Sbjct: 132 QDMDMWITIIVSLLVLATITIFFRPLLLTSFDPILAKSMGVKVTFYHYLLMVILTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +LLI P  TA  +  S + M +L++ +G L  ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVALLITPAATAYLYVHSLKTMILLSSGLGALASVLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSFF 257
           I++TS  LF++SFF
Sbjct: 252 IVLTSALLFLISFF 265


>gi|67920707|ref|ZP_00514226.1| ABC-3 [Crocosphaera watsonii WH 8501]
 gi|67856824|gb|EAM52064.1| ABC-3 [Crocosphaera watsonii WH 8501]
          Length = 314

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 131/244 (53%), Gaps = 1/244 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL  G+ + +    +G ++I QR++  GD IAHS L G+ ++L   LPL++   +
Sbjct: 34  EFMRNALTMGVLLGVLCAVVGSYMIVQRMSMMGDMIAHSVLAGLPVALFLGLPLSLGALV 93

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
              ++++VL  I+    L  DA++ +I  S +++   +++ +   N  D+   LFGDIL 
Sbjct: 94  AGVVSAVVLAGIESQSKLKMDAVMALILASFLAIGTTLVTVLPGANRIDVIHVLFGDILG 153

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++L +G+  + ++ ++  +K LL  T +   A+A G+Q     L  +   SL I 
Sbjct: 154 VTRGDLMLTFGVALIILISVWLFYKELLFYTFDPIGAQASGLQVRWYYLGIVTAISLTIV 213

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++L+ P +TA         M IL   +G    I G+Y S   D PSG 
Sbjct: 214 ASLQTVGVLLVIAMLVAPGMTAYLLVKELHQMMILGGFLGAFASIAGMYMSFYLDIPSGS 273

Query: 243 SIII 246
           +I++
Sbjct: 274 AIVL 277


>gi|15673299|ref|NP_267473.1| manganese ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|12724296|gb|AAK05415.1|AE006363_10 manganese ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|326406853|gb|ADZ63924.1| manganese/iron transport system permease protein [Lactococcus
           lactis subsp. lactis CV56]
          Length = 281

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 142/253 (56%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   +L + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   +   +
Sbjct: 13  HFLQNSLVTAVVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFVGAII 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L+S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLSSIIITFIKNNSIIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  L  G+  + ++++   +K LL T+ +  +A+A GM+      + +++ +L+   
Sbjct: 132 QDIDKWLTMGVSGIVLIVIILFFKELLITSFDPLMARAIGMKVNFYHYLLMVLLTLVSVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S   M IL++ +G +  ++GL+    F+   G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYTNSLRKMIILSSSLGAVSSVLGLFIGYSFNIAVGSS 251

Query: 244 IIITSLFLFILSF 256
           I+ITS  +F +SF
Sbjct: 252 IVITSAIIFAISF 264


>gi|320335080|ref|YP_004171791.1| ABC transporter integral membrane subunit [Deinococcus maricopensis
           DSM 21211]
 gi|319756369|gb|ADV68126.1| ABC-type transporter, integral membrane subunit [Deinococcus
           maricopensis DSM 21211]
          Length = 279

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 143/260 (55%), Gaps = 6/260 (2%)

Query: 4   EFFIRALFSGIGIVLST---GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           EFF RAL   IG+VL +     +G +++ + ++Y GD ++H+   G+  + +    L I 
Sbjct: 16  EFFTRAL---IGVVLVSVLCAMVGAYVVLRGLSYIGDAMSHAVFPGIVGAYLLHANLLIG 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + LTSL +  + +   L  D+ +G++     +L + +LS     + DL SFL G+ 
Sbjct: 73  AILASILTSLGIGYVTQRSGLRQDSAIGIVFVGMFALGVTLLSRADGGSRDLASFLVGNP 132

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V+  D+ L   +  +  ++L  + K LL  + +   A+A G+   ++  + +++  L+
Sbjct: 133 LGVSGADLTLAAVVTGVVALVLLGVQKELLLVSFDPTEARAIGLPVRRLNNLLLILIGLV 192

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + ++I+ +G TL  S+LI  + +AR  +TS + M +LA ++G +G   GLY S   D   
Sbjct: 193 VVLTIQLVGTTLSVSMLITSSASARLLTTSLKRMMVLAAVLGSVGGAAGLYASYYLDLAP 252

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +I++T+  +F+LS  +++
Sbjct: 253 GATIVLTNTAVFLLSLMFRR 272


>gi|282898846|ref|ZP_06306833.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
 gi|281196373|gb|EFA71283.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
          Length = 269

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 138/253 (54%), Gaps = 1/253 (0%)

Query: 8   RALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATL 67
           R+L   + I L    +G +++ QR+A  GD I+HS L G+A++ I    + +  F+ A +
Sbjct: 3   RSLIVAVLIGLLCAVVGTYLMVQRLALLGDAISHSVLPGLAIAFIIGANIFVGAFIAAMV 62

Query: 68  TSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAVNTT 126
           +++ +  I+    +  DA +G++     +L + +++ ++  N  DL  FLFG+IL V   
Sbjct: 63  STVAIAVIKNRSPIKEDAAMGIVFSGFFALGVTLITGIQKANKIDLNHFLFGNILGVTPN 122

Query: 127 DILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIK 186
           ++     +  + ++I+F ++K LL  T +   A+  G+   ++ +  +++ SL I  S+K
Sbjct: 123 EVRDTAILAAVALIIVFLLYKELLFYTFDPIGAQVAGLPVNQLNISLMLVISLTIVASMK 182

Query: 187 FIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
            +G+ L+ S+LI P  TA         + IL   I I+  I+G+Y S  ++ PSGP+I++
Sbjct: 183 AVGVILVLSMLITPGATAYLLVNRLHQVMILGAAIAIISSILGIYLSYFYNLPSGPAIVL 242

Query: 247 TSLFLFILSFFYK 259
                F+L+F + 
Sbjct: 243 VVCTAFVLAFLFS 255


>gi|329116555|ref|ZP_08245272.1| metal ion ABC transporter, permease protein [Streptococcus
           parauberis NCFD 2020]
 gi|326906960|gb|EGE53874.1| metal ion ABC transporter, permease protein [Streptococcus
           parauberis NCFD 2020]
          Length = 276

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 143/252 (56%), Gaps = 5/252 (1%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
           FI AL   IGIV  +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +  
Sbjct: 20  FITALI--IGIV--SGVVGCFIILRSMSLMGDAISHAVLPGVAISYILGINFFIGAIVFG 75

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
            L+SL +  I++N  +  D  +G+   S ++L ++++   +   T+L S LFG+ILAV  
Sbjct: 76  LLSSLFITYIKENSIIKGDTAIGITFSSFLALGVILIGIAQS-TTNLFSILFGNILAVQD 134

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
           +D  +  G+  L ++ +   +K L  T+ +  LA+  G+       + +++ +L+   ++
Sbjct: 135 SDKWITIGVSCLVLLTIVLFFKELQLTSFDPVLAQTMGINVCAYHYLLMVLLTLVAVTAM 194

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G  LI +LLI P  TA  +  S + M +L+  +G +  ++GL+    F+  +G +I+
Sbjct: 195 QSVGTILIVALLITPAATAYLYVNSLKEMLLLSATLGAVSSVLGLFIGYTFNIAAGSTIV 254

Query: 246 ITSLFLFILSFF 257
           +T+ FLF +SFF
Sbjct: 255 LTAAFLFAISFF 266


>gi|257882433|ref|ZP_05662086.1| cation ABC transporter [Enterococcus faecium 1,231,502]
 gi|257818091|gb|EEV45419.1| cation ABC transporter [Enterococcus faecium 1,231,502]
          Length = 272

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 140/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++ +   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 132 QDIDKWITIGVSVLVLVTVVLFFKELLITSFDPLMAKAMGMNVSFYHYLLMILLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGACSSLLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 252 IVLTAAFLFVISF 264


>gi|297584624|ref|YP_003700404.1| ABC-3 protein [Bacillus selenitireducens MLS10]
 gi|297143081|gb|ADH99838.1| ABC-3 protein [Bacillus selenitireducens MLS10]
          Length = 291

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 137/244 (56%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           +  +   A+ + I + +  G +G FII + +A  GD I+H+ L GV ++ +      +  
Sbjct: 13  HYPYLQHAMVAAILVGIICGMIGSFIIMRGMALMGDAISHAVLPGVVVAYMLGASFFVGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                LT+L++  I +N  +  D+ +G++  +  +L +V+++ M     DL   LFG++L
Sbjct: 73  VFTGVLTALLIGFISQNSRIKEDSSIGIMFTAMFALGIVMITGMSGTGVDLWHILFGNVL 132

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  D+ +  GIG   ++++   ++PLL TT +  +AKA G+  + I  + +++ SL+ 
Sbjct: 133 AVSRQDVWISLGIGIFVLVLILLFYRPLLLTTFDPVMAKAAGLPVKGIHYLLMLLLSLVT 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P  TA   +     M  L+++ G++  + GLY S+I+D  SG
Sbjct: 193 VASLQTVGIILVVAMLITPASTAYLLTDRFSLMIALSSVFGVIAAVSGLYFSVIYDVSSG 252

Query: 242 PSII 245
            SI+
Sbjct: 253 ASIV 256


>gi|315605530|ref|ZP_07880567.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312797|gb|EFU60877.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 306

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 132/257 (51%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L +   +
Sbjct: 36  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVLGGAL 95

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 96  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 155

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   +P++A T++ E A+A G+      L   +  +L + +
Sbjct: 156 PASDVPVVLVGALFVLLMLFLAHRPIVAVTLDRESARAAGVHVLAADLSLYVAVALAVVI 215

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 216 SVQTIGNVLVLALLVTPAATARLLCDRLATMMILSPTLGAAGGLVGLYLSWALDVPTGAT 275

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+L++ +  
Sbjct: 276 IVLVLTACFVLAWVFAP 292


>gi|86607150|ref|YP_475913.1| manganese/zinc/iron chelate ABC transporter permease [Synechococcus
           sp. JA-3-3Ab]
 gi|86555692|gb|ABD00650.1| manganese/zinc/iron chelate ABC transporter (MZT) family, permease
           protein [Synechococcus sp. JA-3-3Ab]
          Length = 278

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 147/258 (56%), Gaps = 6/258 (2%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL  GI   ++ G LG F I++++A+F D + HSALLG+ L ++  L  T  + + 
Sbjct: 16  FMQRALLGGILTGVTGGLLGSFAIFRQLAFFSDALGHSALLGIVLGVVLGLNPTAVLMVF 75

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             + +L +  I +   LS+DA+L +I  S+++LA++ LS +     +L   L GDIL ++
Sbjct: 76  GVVFALGVTFILERTQLSADAVLNIIYSSSLALAIIGLSLIPGYRGNLNQLLLGDILGIS 135

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLAT---TVNYELAKAEGMQPEKIKLIFIMITSLMI 181
                 +W  G L ++ L  I   L A    T++  LA+A G++    +L F+++ +L++
Sbjct: 136 PPA---LWMSGLLLLLALGYIGLTLTAQMLLTLDESLARARGVEVGWQRLAFVVLLALVV 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++SI+ +G+ L+++ +++P  TAR   +      +LA   G L  ++G+  S  F+ PSG
Sbjct: 193 ALSIRSVGVLLVSAFVVIPASTARLLGSRFTTYVLLAMGFGGLSAVLGILLSAAFNLPSG 252

Query: 242 PSIIITSLFLFILSFFYK 259
           PSI+ T L  F+L+   K
Sbjct: 253 PSIVATQLLFFLLAMAAK 270


>gi|312899242|ref|ZP_07758579.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
 gi|311293597|gb|EFQ72153.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
          Length = 292

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 140/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 25  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 84

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 85  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 143

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++ +   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 144 QDIDKWITIGVSVLVLVTVVLFFKELLITSFDPLMAKAMGMNVSFYHYLLMILLTLVAVT 203

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 204 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGACSSLLGLFIGYSFNIAAGSS 263

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 264 IVLTAAFLFVISF 276


>gi|257880418|ref|ZP_05660071.1| cation ABC transporter [Enterococcus faecium 1,230,933]
 gi|257891747|ref|ZP_05671400.1| cation ABC transporter [Enterococcus faecium 1,231,410]
 gi|257894493|ref|ZP_05674146.1| cation ABC transporter [Enterococcus faecium 1,231,408]
 gi|260559382|ref|ZP_05831563.1| cation ABC transporter [Enterococcus faecium C68]
 gi|293564024|ref|ZP_06678430.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|294620402|ref|ZP_06699711.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|294623817|ref|ZP_06702645.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|314937455|ref|ZP_07844790.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|314942626|ref|ZP_07849457.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|314949273|ref|ZP_07852618.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
 gi|314952464|ref|ZP_07855468.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|314993651|ref|ZP_07859002.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|314998211|ref|ZP_07863084.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|257814646|gb|EEV43404.1| cation ABC transporter [Enterococcus faecium 1,230,933]
 gi|257828107|gb|EEV54733.1| cation ABC transporter [Enterococcus faecium 1,231,410]
 gi|257830872|gb|EEV57479.1| cation ABC transporter [Enterococcus faecium 1,231,408]
 gi|260074481|gb|EEW62802.1| cation ABC transporter [Enterococcus faecium C68]
 gi|291593315|gb|EFF24880.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|291596771|gb|EFF27994.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|291603942|gb|EFF33470.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|313587775|gb|EFR66620.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|313591914|gb|EFR70759.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|313595446|gb|EFR74291.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|313598636|gb|EFR77481.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|313643189|gb|EFS07769.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|313644346|gb|EFS08926.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
          Length = 280

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 140/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++ +   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 132 QDIDKWITIGVSVLVLVTVVLFFKELLITSFDPLMAKAMGMNVSFYHYLLMILLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGACSSLLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 252 IVLTAAFLFVISF 264


>gi|328951888|ref|YP_004369222.1| ABC-type transporter, integral membrane subunit [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452212|gb|AEB08041.1| ABC-type transporter, integral membrane subunit [Desulfobacca
           acetoxidans DSM 11109]
          Length = 271

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 138/259 (53%), Gaps = 6/259 (2%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL +G+ + L  G L  FI+ +R+A+ G  I+HSA  GVAL  + Q+       + 
Sbjct: 9   FMHNALLAGLLVSLVCGMLSVFIVLRRMAFVGAGISHSAFGGVALGFLLQVDPFWTGLIF 68

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L + ++  +Q    +  D  +G+   + ++L +V L   +  N D+   LFG+IL+V 
Sbjct: 69  AILVAFLIEWVQSRGKIEEDTAIGIFFAAAMALGVVFLHLSRTYNVDVFGVLFGNILSVG 128

Query: 125 TTDILLIWGIGFLNIMILFKIW---KPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            T +  + G+     ++LF IW   K L+  + + E+A   G   + ++ +F+   +L+I
Sbjct: 129 RTQLHQVAGVA---AVVLFFIWFFFKELVFISFDEEMAWVCGAPVKALRYLFLAALALVI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             SI  +GI L+++LL++P   AR  +T   +M +++T   I   + GL  S + D PSG
Sbjct: 186 IASIYLVGIVLVSALLVIPAAVARNLTTQIRSMILVSTGTAIGSTLGGLGFSYLIDLPSG 245

Query: 242 PSIIITSLFLFILSFFYKK 260
            +I+I    LF+L+  + +
Sbjct: 246 ATIVILLAGLFLLTTAWSR 264


>gi|282900129|ref|ZP_06308086.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
 gi|281195011|gb|EFA69951.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
          Length = 259

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 149/260 (57%), Gaps = 14/260 (5%)

Query: 8   RALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-------LPLTIC 60
           RA+   + +    G LG F   +++++F   + H+AL+GVAL ++         LP T+ 
Sbjct: 3   RAMIGAVLMGTLGGLLGSFATLRQLSFFSHAVGHAALVGVALGVLLNTNPHWMLLPFTL- 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           IF       +++L I     L+SD++L ++   ++++ +++ + ++    +L + LFGDI
Sbjct: 62  IF------GVIVLYIIDQTDLASDSVLSIVLSGSLAIGVILTTMIQGYRGNLMAVLFGDI 115

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++ TD++L   I  ++ + +    +  +  T+N ++AK +G+  E  +  F+++ SL 
Sbjct: 116 LAIDHTDLILTLIILLISSIFILSTMRSQILLTLNPDVAKVQGVPVELYRYSFVILLSLA 175

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ L+ + L++P+ TA+  S       IL+ +IG +  IIG+  S +F+  S
Sbjct: 176 VAVAIKAVGVLLVNAFLVIPSATAKLMSEHFSRFLILSVVIGCMSSIIGMTASGLFNQAS 235

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP+I+I    LF+ +F + +
Sbjct: 236 GPTIVIVQFLLFVFTFSWVR 255


>gi|303243385|ref|ZP_07329761.1| ABC-3 protein [Acetivibrio cellulolyticus CD2]
 gi|302589074|gb|EFL58946.1| ABC-3 protein [Acetivibrio cellulolyticus CD2]
          Length = 271

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 143/253 (56%), Gaps = 2/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFM 63
           F IRAL  GI + L    LG  ++ +R +  GD ++H     +A+++   L PL + I +
Sbjct: 13  FIIRALVVGILVSLCASLLGVSLVLKRYSMIGDGLSHVGFGTLAIAMSLNLAPLQVSIPL 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L + +LL++ +N  +  DA + +I+ S++++ ++ +S    +N D+ +++FG IL +
Sbjct: 73  V-ILAAFLLLRLSENSKIKGDAAIALISSSSLAIGVITISLTTGMNADVCNYMFGSILTM 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ L   +  + +++    +  + A T +   AKA G +     ++   +T+L+I V
Sbjct: 132 SKGDLYLSVTVSVVVLILYVLFYNKIFAVTFDESFAKATGTKTGLYNMLIAFLTALIIVV 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +G  LI+SL+I P++T+ R   S +++ I +TI+ +    IGL  S  F TP+G S
Sbjct: 192 GMRMMGALLISSLIIFPSLTSMRVFKSFKSVVISSTILSVTCFFIGLVASFQFSTPAGAS 251

Query: 244 IIITSLFLFILSF 256
           +++ +L  F + F
Sbjct: 252 VVVVNLGAFCMFF 264


>gi|148651998|ref|YP_001279091.1| ABC-3 protein [Psychrobacter sp. PRwf-1]
 gi|148571082|gb|ABQ93141.1| ABC-3 protein [Psychrobacter sp. PRwf-1]
          Length = 264

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 142/222 (63%), Gaps = 1/222 (0%)

Query: 24  GCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSS 83
           GC ++W+R+++F D +AH  L GVAL+ ++ LP  I I +++ L  + LL ++    L +
Sbjct: 27  GCLVLWRRMSFFADALAHGTLFGVALAALWHLPFGIGIALVSVLVVVGLLWLEDVR-LPN 85

Query: 84  DAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILF 143
           DA+L V++ + + L L+ L+ +  + +++ S+LFG++L V+ TD+ L+     + I++L 
Sbjct: 86  DALLAVVSVTLLCLGLLTLTQLTQMQSNVLSYLFGNLLEVSWTDLPLLSACVGVGIVVLA 145

Query: 144 KIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVT 203
            IW+P +    + +LA+  G++  + +L F+ + +   +++++ +G  LI+ LLILP +T
Sbjct: 146 VIWRPQVILATHPDLAQVAGIKATRQRLFFMGVLAGFCALALQAVGSLLISGLLILPALT 205

Query: 204 ARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           AR F+ SP+ M I+A I+  L +  G++GS++ D  +G +I+
Sbjct: 206 ARLFAHSPKQMVIIAVILAQLAVTGGVWGSVLLDIQTGLAIV 247


>gi|227329523|ref|ZP_03833547.1| high-affinity zinc transporter membrane component [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 158

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 106/156 (67%)

Query: 105 MKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGM 164
           M  V  DL ++LFGD+L+V T D+ +I     + + I+   W+ LL+ T++ ELA  +G+
Sbjct: 1   MNNVRVDLMAYLFGDLLSVTTEDLWVIAAGVIVVVAIMCWQWRALLSMTISPELAHVDGV 60

Query: 165 QPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGIL 224
           + ++ KL+ ++ T+L I +++KF+G  +ITSLLI+P  +ARRF+ +PE MA +A I+G++
Sbjct: 61  KLQRTKLLLMLTTALTIGIAMKFVGALIITSLLIIPAASARRFARTPEQMASIAIIVGMI 120

Query: 225 GIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            +  GL  S  ++TP+GPS+++ +  LFI+S   ++
Sbjct: 121 AVTGGLAFSAGYNTPAGPSVVLCASLLFIVSLIKRQ 156


>gi|191639351|ref|YP_001988517.1| Hydrophobic membrane protein [Lactobacillus casei BL23]
 gi|190713653|emb|CAQ67659.1| Hydrophobic membrane protein [Lactobacillus casei BL23]
 gi|327383439|gb|AEA54915.1| ABC-3 protein [Lactobacillus casei LC2W]
 gi|327386627|gb|AEA58101.1| ABC-3 protein [Lactobacillus casei BD-II]
          Length = 298

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 144/258 (55%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   +
Sbjct: 15  DFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGASV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++  +  N  + +D  +GV+  +  +L  +++S M    T+L   LFG+ILAV
Sbjct: 75  FGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILIS-MAESATNLHHILFGNILAV 133

Query: 124 NTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           + +DI+    +  L I+ILF +  +K LL T+ +   AK  G+    I    +++ +L+ 
Sbjct: 134 SDSDIVTTAVV--LGIVILFVVLFYKELLITSFDNTFAKKYGLNTTMIHYALMLVLTLVT 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI L+ ++LI P  TA  ++   E M I +  +G+   I GLY S  F+  SG
Sbjct: 192 VSALQTVGIILVVAMLITPAATAFLWTDRLETMLITSASVGVFSAITGLYFSFTFNWASG 251

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I++ +  LF +SF + 
Sbjct: 252 PAIVLVAAVLFAISFVFS 269


>gi|256378785|ref|YP_003102445.1| ABC transporter [Actinosynnema mirum DSM 43827]
 gi|255923088|gb|ACU38599.1| ABC-3 protein [Actinosynnema mirum DSM 43827]
          Length = 287

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 135/256 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F+ RAL   +   +  G +G  ++ + +A+ GD +AHS   GVA++ +  + L +   +
Sbjct: 14  DFWRRALLVALLSGVVCGVIGSHVVLRGMAFIGDAVAHSVFPGVAIAFVLGVDLVLGGAV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T+L++    +N  L  D+++G+       L +VILS        L SFLFG IL +
Sbjct: 74  AGVITALLVAVFAQNRRLKEDSVIGIFFAGAFGLGIVILSTAPGYGGSLESFLFGSILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D++ +  IG L ++    +   L A  ++ E A+A G     + L   ++ +L I +
Sbjct: 134 SDSDVVAVAVIGALLLLCAAVLNGRLTAVALDREQARAVGFPVFWLDLALYVMVTLAIVI 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ +LL+ P   AR  +     M +LA +IG  G ++GLY S  FD  +G  
Sbjct: 194 SLQAVGNVLVLALLVTPAAAARLLTDRLGAMVVLAPVIGAGGSLLGLYLSYAFDLAAGGL 253

Query: 244 IIITSLFLFILSFFYK 259
           I++    +F+L +F+ 
Sbjct: 254 IVLALTGIFLLCWFFA 269


>gi|330860797|emb|CBX71084.1| high-affinity zinc uptake system membrane protein znuB [Yersinia
           enterocolitica W22703]
          Length = 150

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 86/128 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  MTMLLALILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLI 131
             +DI LI
Sbjct: 123 TLSDIWLI 130


>gi|293190871|ref|ZP_06609033.1| anchored repeat-type ABC transporter, permease subunit [Actinomyces
           odontolyticus F0309]
 gi|292820770|gb|EFF79732.1| anchored repeat-type ABC transporter, permease subunit [Actinomyces
           odontolyticus F0309]
          Length = 304

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 131/257 (50%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L     +
Sbjct: 34  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVFGGAL 93

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 94  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 153

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   +P++A T++ E A+A G+      L   +  +L + +
Sbjct: 154 PASDVPVVLAGALFVLLMLFLAHRPIVAVTLDRESARAAGVHVLLADLSLYVAVALAVVI 213

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 214 SVQTIGNVLVLALLVTPAATARLLCDRLGTMMILSPALGASGGLVGLYLSWALDVPTGAT 273

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+L++ +  
Sbjct: 274 IVLVLTACFVLAWVFAP 290


>gi|116495866|ref|YP_807600.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei ATCC 334]
 gi|227533581|ref|ZP_03963630.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|301067422|ref|YP_003789445.1| Mn2+/Zn2+ ABC transporter permease [Lactobacillus casei str. Zhang]
 gi|18369745|emb|CAC81444.1| hydrophobic membrane protein [Lactobacillus casei]
 gi|116106016|gb|ABJ71158.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei ATCC 334]
 gi|227188785|gb|EEI68852.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|300439829|gb|ADK19595.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei str. Zhang]
          Length = 298

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 144/258 (55%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   +
Sbjct: 15  DFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGASV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++  +  N  + +D  +GV+  +  +L  +++S M    T+L   LFG+ILAV
Sbjct: 75  FGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILIS-MAESATNLHHILFGNILAV 133

Query: 124 NTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           + +DI+    +  L I+ILF +  +K LL T+ +   AK  G+    I    +++ +L+ 
Sbjct: 134 SDSDIVTTAVV--LGIVILFVVLFYKELLITSFDNTFAKTYGLNTTMIHYALMLVLTLVT 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI L+ ++LI P  TA  ++   E M I +  +G+   I GLY S  F+  SG
Sbjct: 192 VSALQTVGIILVVAMLITPAATAFLWTDRLETMLITSASVGVFSAITGLYFSFTFNWASG 251

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I++ +  LF +SF + 
Sbjct: 252 PAIVLVAAVLFAISFVFS 269


>gi|159899363|ref|YP_001545610.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892402|gb|ABX05482.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 281

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 132/235 (56%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           G LG +I+ + ++Y G  ++H+   G  +S +      +   +     ++++ Q  +   
Sbjct: 28  GLLGVYIVLRGMSYIGHGLSHAIFGGAVVSFVLAWNFYLGAGLWGFAAAVLINQTARRTK 87

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           +++DA +GVIT ++ ++ + ++S  +       + LFG+IL V + D+  I G+  +  +
Sbjct: 88  INADAAIGVITTASFAVGVALISRYRNFTRSFDAALFGNILGVTSDDLWAIGGVCIMVGL 147

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           ++F  +K LL  T N ++A+  G++   +  +F ++ +  + VS+K +G+TLI + L++P
Sbjct: 148 VVFFSYKQLLFMTFNNDVAQVYGVRTNWLDTLFSLMLAATLIVSMKILGVTLIAAALVIP 207

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
            +TAR  + S   M  L+T+IG L   IG+Y S  FD  SG +I++T    F+L+
Sbjct: 208 PITARLLTDSFHRMLGLSTLIGGLTGCIGMYLSYFFDLASGATIVLTQTSCFVLA 262


>gi|116618060|ref|YP_818431.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116096907|gb|ABJ62058.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 280

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 147/259 (56%), Gaps = 6/259 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           YN F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + L +  
Sbjct: 14  YN-FLQTALVTSILVGIMSGIIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINLLLGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +L++  +     L +D  +G++  +  +L  +++S  +   T+L   LFG++L
Sbjct: 73  SAFGILAALLIGVVTMKSKLKNDTAIGIVFSAFFALGFILISLAESA-TNLHHILFGNVL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           AV+ +D  LI     L+I++LF +  +K LL T+ +   AKA G++ + +    +++ +L
Sbjct: 132 AVSDSD--LITTAIVLSIVLLFVVTFYKELLITSFDNTFAKAYGLKTQIMHYALMLVLTL 189

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           +   +++ +GI LI ++LI P  TA   +    +M I+A I  ++  I+GLY S  F+  
Sbjct: 190 VTVTALQTVGIILIVAMLITPAATAYLLTNRMSHMMIVAAIFSVISSIVGLYLSFTFNWA 249

Query: 240 SGPSIIITSLFLFILSFFY 258
           SGP+I++T+   F L+F +
Sbjct: 250 SGPAIVLTAAIFFTLAFIF 268


>gi|164686650|ref|ZP_02210678.1| hypothetical protein CLOBAR_00243 [Clostridium bartlettii DSM
           16795]
 gi|164604379|gb|EDQ97844.1| hypothetical protein CLOBAR_00243 [Clostridium bartlettii DSM
           16795]
          Length = 263

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 147/257 (57%), Gaps = 2/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTI 59
           M   F +RA+  G  + L +  LG  ++ +R +  GD ++H A   + +++   + PL I
Sbjct: 1   MSYTFIVRAMIVGGLVALCSALLGVSLVLKRYSMIGDGLSHVAFAALTIAVAMNVAPLYI 60

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
               I T+ +++LL++ +N  +  D+ + +I+  +I++ +V+ +  K +NTD+ S++FG 
Sbjct: 61  ST-PIVTVAAIILLRLSENSKIKGDSAIALISTVSIAIGVVVTALTKGMNTDVYSYMFGS 119

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           ILA++ +D+ +   +  + I++    +  + A T +   AKA G + +   +I  ++T++
Sbjct: 120 ILAMSESDVYMSIALSVVVIILFVFFYNKIFAVTFDESFAKATGTKADVYNMIIAVLTAI 179

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I V ++ +G  LI+SL+I P + + R   + +++ I + I+ ++  ++G+  S ++  P
Sbjct: 180 TIVVGMRIMGTMLISSLIIFPALISMRNFKTFKSVIICSAIVSVVCFLLGIILSYLYSIP 239

Query: 240 SGPSIIITSLFLFILSF 256
           +G SI++ +    ILS+
Sbjct: 240 TGASIVLVNTVALILSY 256


>gi|330685903|gb|EGG97532.1| putative manganese transport system membrane protein MntB
           [Staphylococcus epidermidis VCU121]
          Length = 277

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 147/254 (57%), Gaps = 5/254 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL + + + +  G +G  I+ + ++  GD ++H+ L GVALS +F +P+ +   +
Sbjct: 12  QFLNRALITSMIVGVVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFVGALI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I        DA +G+   + ++L ++++S +    TDL   LFG++LA+
Sbjct: 72  TGMIASMLIGFITSKSKTKPDAAIGISFTAFLALGVILISIINS-TTDLYHILFGNLLAI 130

Query: 124 NTTDI--LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
             T     +I G+  L+++I+F  ++PL+ +T +   ++  G+  + I    +++ +L+ 
Sbjct: 131 THTTFWTTVIIGLFVLSLIIIF--YRPLMISTFDNTFSRMNGLNTKLIHYFVMLLLALVT 188

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             SI+ +GI L+ +LL+ P  TA     +   M  +A++IG++  IIGLY S I++ PSG
Sbjct: 189 VASIQTVGIILVVALLVTPASTAFLICKNLYGMMAVASLIGVISSIIGLYFSYIYNVPSG 248

Query: 242 PSIIITSLFLFILS 255
            +I++ +  +++++
Sbjct: 249 AAIVLCTFAIYVVT 262


>gi|229548537|ref|ZP_04437262.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|293382676|ref|ZP_06628602.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|293386732|ref|ZP_06631304.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|307269169|ref|ZP_07550525.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|307277655|ref|ZP_07558744.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
 gi|312905682|ref|ZP_07764705.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|312950992|ref|ZP_07769901.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|312978614|ref|ZP_07790349.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|229306317|gb|EEN72313.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|291079931|gb|EFE17295.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|291083846|gb|EFE20809.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|306505680|gb|EFM74861.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
 gi|306514491|gb|EFM83050.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|310628263|gb|EFQ11546.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|310631032|gb|EFQ14315.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|311288553|gb|EFQ67109.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|315032533|gb|EFT44465.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0017]
 gi|315036656|gb|EFT48588.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0027]
 gi|315157401|gb|EFU01418.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0043]
 gi|315163183|gb|EFU07200.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0645]
 gi|315577983|gb|EFU90174.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0630]
          Length = 292

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 141/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 25  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 84

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 85  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 143

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 144 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVT 203

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 204 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 263

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 264 IVLTAAFLFVISF 276


>gi|256854536|ref|ZP_05559900.1| cation ABC transporter [Enterococcus faecalis T8]
 gi|256710096|gb|EEU25140.1| cation ABC transporter [Enterococcus faecalis T8]
          Length = 280

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 141/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITSVVIGVVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 132 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 252 IVLTAAFLFVISF 264


>gi|229546423|ref|ZP_04435148.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|307290103|ref|ZP_07570026.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
 gi|229308440|gb|EEN74427.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|306498822|gb|EFM68317.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
          Length = 292

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 141/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 25  HFLQNALITSVVIGVVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 84

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 85  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 143

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 144 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVT 203

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 204 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 263

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 264 IVLTAAFLFVISF 276


>gi|108803984|ref|YP_643921.1| hypothetical protein Rxyl_1143 [Rubrobacter xylanophilus DSM 9941]
 gi|108765227|gb|ABG04109.1| ABC-3 [Rubrobacter xylanophilus DSM 9941]
          Length = 287

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 135/248 (54%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R L + + + +  G LG F++ + +A+ GD +AH++  GVAL+ +  L +    F+ 
Sbjct: 13  FMQRGLLASVLVAVVCGALGSFVVLKGLAFIGDALAHASFGGVALAFVLGLNVYAGAFVF 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A  T+L +  + ++  + SD  +GV+   T +L + ++S ++   TDL  +LFGD+L++ 
Sbjct: 73  ALATALGIGALSQHGKVRSDTAIGVLFSGTFALGIAVISGVESYTTDLFGYLFGDVLSIT 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+  I   G   + +L   ++ LL    +  +A A G+    ++ + + +  + I  +
Sbjct: 133 ARDLAAISLAGAAVLALLGLFYRQLLFVAFDPAVAAASGVPARALEYLLLALLGMTIVAA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L+ +LL+ P+ TA  F     +M + + ++G L  ++G+Y S   +  SG SI
Sbjct: 193 LQAVGIVLVVALLVTPSATAHLFCRRFHHMILASMVLGSLSALLGIYLSYYLNVASGASI 252

Query: 245 IITSLFLF 252
           I+ +  LF
Sbjct: 253 ILVATALF 260


>gi|256957532|ref|ZP_05561703.1| manganese transport system membrane protein [Enterococcus faecalis
           DS5]
 gi|256959731|ref|ZP_05563902.1| manganese transporter membrane protein [Enterococcus faecalis
           Merz96]
 gi|256964615|ref|ZP_05568786.1| manganese transporter membrane protein [Enterococcus faecalis
           HIP11704]
 gi|257089038|ref|ZP_05583399.1| ABC cation transporter permease [Enterococcus faecalis CH188]
 gi|257420871|ref|ZP_05597861.1| ABC cation transporter [Enterococcus faecalis X98]
 gi|256948028|gb|EEU64660.1| manganese transport system membrane protein [Enterococcus faecalis
           DS5]
 gi|256950227|gb|EEU66859.1| manganese transporter membrane protein [Enterococcus faecalis
           Merz96]
 gi|256955111|gb|EEU71743.1| manganese transporter membrane protein [Enterococcus faecalis
           HIP11704]
 gi|256997850|gb|EEU84370.1| ABC cation transporter permease [Enterococcus faecalis CH188]
 gi|257162695|gb|EEU92655.1| ABC cation transporter [Enterococcus faecalis X98]
 gi|323479778|gb|ADX79217.1| manganese transport system membrane spanning domain protein
           [Enterococcus faecalis 62]
          Length = 280

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 141/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 132 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I++T+ FLF++SF
Sbjct: 252 IVLTAAFLFVISF 264


>gi|313836812|gb|EFS74526.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL037PA2]
 gi|314929779|gb|EFS93610.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL044PA1]
 gi|314972208|gb|EFT16305.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL037PA3]
 gi|328907636|gb|EGG27400.1| ABC transporter ATP-binding protein [Propionibacterium sp. P08]
          Length = 285

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 135/252 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL       +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAAVCSIVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGAIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             +T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLVTAILVAIVSQNRRLKEDSVIGILFAGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L ++    + K L+   ++ E A+A  M    + L+  ++ ++ + +S
Sbjct: 138 NDDIVIVCVTGALVLLTERALHKELVTVGLDRETARATHMPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG L  ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGRMMVLAPVIGGLSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSF 256
           ++ +  +F+L +
Sbjct: 258 VLVATAVFLLCW 269


>gi|282896386|ref|ZP_06304407.1| ABC-3 [Raphidiopsis brookii D9]
 gi|281198674|gb|EFA73554.1| ABC-3 [Raphidiopsis brookii D9]
          Length = 268

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 138/253 (54%), Gaps = 1/253 (0%)

Query: 8   RALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATL 67
           R+L + + I L    +G +++ QR+A  GD I+HS L G+A++ +    + +  F+ A +
Sbjct: 3   RSLITAVLIGLLCAVIGTYLMVQRLALLGDAISHSVLPGLAIAFMIGANIFVGAFIAAMV 62

Query: 68  TSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAVNTT 126
           +++ +  I+    +  DA +G++     +L + +++ ++  N  DL  FLFG+IL V   
Sbjct: 63  STVAIAVIKNRSPIKEDAAMGIVFSGFFALGITLITVIQKTNKIDLNHFLFGNILGVTPN 122

Query: 127 DILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIK 186
           ++     +  + ++I+F ++K LL  T +   ++  G+   ++ +  +++ SL I  S+K
Sbjct: 123 EVRDTAILTAVALIIVFLLYKELLFYTFDPVGSRVAGLPVNQLNISLMLLISLTIVASMK 182

Query: 187 FIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
            +G+ L+ S+LI P  TA         + IL   I I+  I+G+Y S  ++ PSGP+I++
Sbjct: 183 AVGVILVLSMLITPGATAYLLVNRLHQVMILGAAIAIISSIVGIYLSYFYNLPSGPAIVL 242

Query: 247 TSLFLFILSFFYK 259
                F+ +F + 
Sbjct: 243 VVCTAFVFAFLFS 255


>gi|172054946|ref|YP_001806273.1| ABC transporter permease protein [Cyanothece sp. ATCC 51142]
 gi|171701227|gb|ACB54207.1| ABC transporter permease protein [Cyanothece sp. ATCC 51142]
          Length = 271

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 128/242 (52%), Gaps = 26/242 (10%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F+I +R++ FGDT+ HSA+LGV L+ +  LP T  +        L ++ +     L SD 
Sbjct: 35  FLILRRLSLFGDTVGHSAMLGVVLAALLNLPATWTLMGFTVAFGLGVIYLIDRTDLGSDT 94

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTD---------ILLIWGIGF 136
           +L +    +I+L  +  S++K    +L S LFGDILA++ TD         + L W I  
Sbjct: 95  VLCISLSGSIALGTIGFSYLKGYRGNLLSILFGDILAISNTDLILLLLLLAVTLAWIIIS 154

Query: 137 LNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSL 196
           L   IL          T+N +LA  +G+     +  FI++ ++MI+++I+ +GI L+   
Sbjct: 155 LPEQILL---------TLNSDLAVVKGVPVRSHRYFFIVLLAIMIALTIRAVGILLVNGF 205

Query: 197 LILPTVTAR----RFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
           L++P  TAR    +F       A +  + G++G++I    S   D PSGPSI++  LF F
Sbjct: 206 LVIPAATARLICQQFVPFLATAAGMGALSGVMGMVI----SGAIDLPSGPSIVLVQLFGF 261

Query: 253 IL 254
           ++
Sbjct: 262 LI 263


>gi|51473801|ref|YP_067558.1| zinc/manganese ABC transporter permease protein [Rickettsia typhi
           str. Wilmington]
 gi|51460113|gb|AAU04076.1| zinc/manganese ABC transporter permease protein [Rickettsia typhi
           str. Wilmington]
          Length = 253

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 135/242 (55%), Gaps = 9/242 (3%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
            PLGC  +W+R  YFGD +AHS+ L  ++S+I   PL     ++A L S  +   + N  
Sbjct: 16  APLGCIALWKRYIYFGDGLAHSSFLAASISIIAHFPLIYSGIIVAILFSFFVFFFKNNS- 74

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTD--ILLIWGIGFLN 138
              +A++ +I+   +++AL+I  F    N ++   LFGDIL+V+  D  IL++  I  ++
Sbjct: 75  -EKNAVINLISSFMLAVALIINYFTSLQN-NIVHLLFGDILSVSFNDLIILVVVFITIIS 132

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
            ++ F  +  +L T +N ++A  +G+    I+LIF+++ SL +  +IK +G+ ++T++L+
Sbjct: 133 FIVYF--YNQILLTIINRDIAVIQGLNVNIIELIFLLLLSLSVFAAIKIVGVLMVTAILL 190

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFY 258
           +P + AR  + SP  M I++  I +       + S  FD P  P  I+    ++  S FY
Sbjct: 191 IPAMIARFVAYSPSQMIIISIFISLFINFCAAFSSFYFDLPLTPLFIVLGTLIY--SLFY 248

Query: 259 KK 260
            K
Sbjct: 249 LK 250


>gi|86606334|ref|YP_475097.1| manganese/zinc/iron chelate ABC transporter permease [Synechococcus
           sp. JA-3-3Ab]
 gi|86554876|gb|ABC99834.1| manganese/zinc/iron chelate ABC transporter (MZT) family, permease
           protein [Synechococcus sp. JA-3-3Ab]
          Length = 277

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 140/257 (54%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   + I +    +G +++ Q +A  GD ++HS L G+A++ +  L L +  F+
Sbjct: 15  AFMQRALLVAVAIGMLCAVVGSYLLVQSLALLGDALSHSLLPGLAIAYMLGLNLFVGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFM-KWVNTDLTSFLFGDILA 122
              L++L++  I+    L  DA +G++  +  +L +++++ + +    DL  FLFG++L 
Sbjct: 75  AGLLSALLIQWIRSATPLKPDAAMGIVFSAFFALGILLITLIQRRARIDLNHFLFGNLLG 134

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+L + GI  L + ++   +K L   + +   AKA G+  E +    + +TSL + 
Sbjct: 135 VSAADVLTVVGITALVLGLVALFFKELTFYSFDPLGAKAAGLPTEGLGWGLMALTSLTLV 194

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +G+ L+ ++LI P  TA       + + +L ++ G+   ++G+Y S   +  SGP
Sbjct: 195 ASMKAVGVLLVLAMLITPAATAYLLVPRLQQVMLLGSLFGVSASLLGMYASYYLNVASGP 254

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F L+F  K
Sbjct: 255 AIVLVASTWFGLAFLAK 271


>gi|255993992|ref|ZP_05427127.1| ABC transporter, permease protein [Eubacterium saphenum ATCC 49989]
 gi|255993660|gb|EEU03749.1| ABC transporter, permease protein [Eubacterium saphenum ATCC 49989]
          Length = 272

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 142/257 (55%), Gaps = 2/257 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-QLPLTICIFM 63
           F +RA+  G    +    LG  ++ +R +  GD ++H     +A++L+  Q PL I I  
Sbjct: 13  FMVRAIVVGSLTSICASLLGVNLVLKRYSMIGDGLSHVGFGALAVALVAGQSPLPIAI-A 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S  LL++ +N  L  DA + +++ S+++  ++++S    +NTD+ +F+FG ILA+
Sbjct: 72  ACVLASFFLLRLSENSKLKGDAAIALVSASSLAAGVMMISVTSGINTDVCNFMFGTILAM 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N+ D  L   +    I+I    +      T + E AKA G +    K +  ++ ++ + V
Sbjct: 132 NSEDANLSIWLIIAVIIIYVFFYHNFFLLTFDEEFAKAAGRRVSLYKGVLSILVAITVVV 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +G  +I+SLLI P ++A + +++   + I++ +I +    +G+Y + + + P+G +
Sbjct: 192 GMRMMGALMISSLLIFPAISAIQLASTYRRVTIISVLISLFCFFVGMYVAYVAEIPAGAT 251

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +L +FI+S   +K
Sbjct: 252 IVLVNLCVFIISALIRK 268


>gi|311030786|ref|ZP_07708876.1| cation ABC transporter, permease protein [Bacillus sp. m3-13]
          Length = 278

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 136/273 (49%), Gaps = 18/273 (6%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  EF   A ++GI I      LG F++ +R++   D ++H  L G+A SL+ +    + 
Sbjct: 6   MQFEFLRNAFYTGILIGFLAPLLGVFVVVRRLSLIADALSHVTLAGIAASLLVEKRFGL- 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITH-----------STISLALVILSFMKWVN 109
             M+        +      AL  + + GV  H           S I L ++ +S     N
Sbjct: 65  --MVGVSPIYFGMAFSVTGALFIEKLRGVYKHYQELAIPIILSSGIGLGVIFISLADGFN 122

Query: 110 TDLTSFLFGDILAVNTTDI--LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPE 167
           TDL +FLFG + AV +TD   + I  IG L  +ILF  +K     + + E AK  G+   
Sbjct: 123 TDLFNFLFGSVSAVTSTDFWTVFIVTIGVLLTIILF--YKEFFILSFDEEHAKVSGVNAR 180

Query: 168 KIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGII 227
              LIFI++ +L+I+ S++ +GI L++SL+ LP   + R S   +   +LA + G + +I
Sbjct: 181 VFHLIFIIMVALVIAASMRIVGILLVSSLMTLPVAASMRLSRGFKQTIVLAIVFGEIAVI 240

Query: 228 IGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
            GL  S  FD   G +I+I S+ + I++  + K
Sbjct: 241 GGLISSFYFDLAPGGTIVILSVLILIVTILWNK 273


>gi|259047509|ref|ZP_05737910.1| metal ion ABC superfamily ATP binding cassette transporter,
           permease protein [Granulicatella adiacens ATCC 49175]
 gi|259035700|gb|EEW36955.1| metal ion ABC superfamily ATP binding cassette transporter,
           permease protein [Granulicatella adiacens ATCC 49175]
          Length = 277

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 136/253 (53%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  S + I    G LGCFII + ++  GD I+H+ L GVALS I  +   I   +
Sbjct: 12  HFLQNAFVSAVVIGAVAGILGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGALV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S ++  + +N  +  D  +G+   S ++L ++++   K  +TDL   LFG+ILAV
Sbjct: 72  FGLLASFLIAFVNQNSTIKGDTAIGITFSSFLALGVILIGVAKS-STDLFHILFGNILAV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+L+   +  + ++++   +K L  T+ +   A++ GM  +    + + + +L+   
Sbjct: 131 QDIDLLITLVVSVIVVVVILAYFKELQVTSFDPVFAQSTGMNVQFYHYLLMFLLALVSIT 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  +I +LLI P  TA  +S   + M ILA I G L  I+GL+    F+   G +
Sbjct: 191 AMQSVGTVMIVALLITPAATAYLYSNRLKIMLILAAIFGSLSSILGLFIGYTFNIAIGST 250

Query: 244 IIITSLFLFILSF 256
           I++T+  LF++SF
Sbjct: 251 IVLTAAALFVVSF 263


>gi|322372669|ref|ZP_08047205.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           C150]
 gi|321277711|gb|EFX54780.1| metal ion ABC transporter, permease protein [Streptococcus sp.
           C150]
          Length = 298

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 132/233 (56%), Gaps = 1/233 (0%)

Query: 25  CFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSD 84
           CFII + ++  GD I+H+ L GVA+S I  +   I   +   L S ++  I+ N  + SD
Sbjct: 53  CFIILRGMSLMGDAISHAVLPGVAISFILGINFFIGAIVFGLLASTIITYIKSNSIIKSD 112

Query: 85  AILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFK 144
             +G+   S ++L ++++      +TDL   LFG+ILAV   D+ +   +  L +  +  
Sbjct: 113 TAIGITFSSFLALGIILIGIANS-STDLFHILFGNILAVQDLDMWITIAVALLVLTTITI 171

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
            ++PLL T+ +  LAK+ G++      + ++I +L+   +++ +G  LI +LLI P  TA
Sbjct: 172 FFRPLLLTSFDPILAKSIGVKVTFYHYLLMVILTLVAVTAMQSVGTILIVALLITPAATA 231

Query: 205 RRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFF 257
             ++ S + M +L++  G L  ++GL+    F+  +G SI++TS  LF++SFF
Sbjct: 232 YLYANSLKTMILLSSGFGALASVLGLFIGYSFNIAAGSSIVLTSALLFLISFF 284


>gi|251797066|ref|YP_003011797.1| ABC transporter [Paenibacillus sp. JDR-2]
 gi|247544692|gb|ACT01711.1| ABC-3 protein [Paenibacillus sp. JDR-2]
          Length = 294

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 134/244 (54%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +F  RA F+G  I L    LG +++ +R A   D ++H +L GVA      +  ++ 
Sbjct: 2   LHYDFMQRAFFAGGIIALIASALGVYLLLRRQALMADMLSHVSLAGVAAGTYLGINPSLS 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F++A + ++ +  ++K     S+  + +I    +SL++++++  K VN   +S+LFG +
Sbjct: 62  GFIVAVIGAIAVEYVRKAYKTYSELSVAIIMVGGLSLSVILMTMNKTVNKSFSSYLFGSV 121

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +AVN T+++++     +  +  F + +PL   + + E A+  G+  + I   F ++T ++
Sbjct: 122 VAVNRTELMIMLAAALIGALFFFLLRRPLYIVSFDEESARTSGIPVQWISFGFSIVTGMI 181

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++ ++  +G+ L+++L+ILP   + R S+S     +++  IG+ G   GL  S    TP 
Sbjct: 182 VAAAMPIVGVLLVSALIILPAALSVRISSSFTAAILISMGIGLTGTFTGLTASYELSTPP 241

Query: 241 GPSI 244
           G +I
Sbjct: 242 GGTI 245


>gi|52081847|ref|YP_080638.1| manganese ABC transporter [Bacillus licheniformis ATCC 14580]
 gi|52787236|ref|YP_093065.1| MntD [Bacillus licheniformis ATCC 14580]
 gi|319647765|ref|ZP_08001983.1| MntD protein [Bacillus sp. BT1B_CT2]
 gi|52005058|gb|AAU25000.1| manganese ABC transporter [Bacillus licheniformis ATCC 14580]
 gi|52349738|gb|AAU42372.1| MntD [Bacillus licheniformis ATCC 14580]
 gi|317390106|gb|EFV70915.1| MntD protein [Bacillus sp. BT1B_CT2]
          Length = 286

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 145/257 (56%), Gaps = 3/257 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  ++LF+ I + +  G +GCFII + +A  GD I+H+ L GVA+S +  +     
Sbjct: 8   MEYSFLQKSLFTSIMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYMLGVNFFFG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+L +  + +N  + +D+ +G++  +  ++ +++++ +K  ++DL   LFG++
Sbjct: 68  AVFTGILTALGIGYVSQNSRIKNDSAIGIVFTAFFAVGIILITLVK-SSSDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   IG + +  +F  +K LL T+ +  +A   G+ P ++   F+M    M
Sbjct: 127 LAVRSSDMWITLVIGVIILTAVFLFYKELLITSFDPTMAAVYGL-PNRLIHYFLMTLLTM 185

Query: 181 ISV-SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
           ++V S++ +GI L+ ++LI P  TA   +     M  L+  +G L  +IGL  S  ++  
Sbjct: 186 VTVASLQTVGIILVVAMLITPAATAYLLTDRLWVMIYLSAFLGALSAVIGLGLSYTYNLS 245

Query: 240 SGPSIIITSLFLFILSF 256
           SG +I++ +  LF LSF
Sbjct: 246 SGAAIVLVATILFGLSF 262


>gi|189424894|ref|YP_001952071.1| ABC transporter [Geobacter lovleyi SZ]
 gi|189421153|gb|ACD95551.1| ABC-3 protein [Geobacter lovleyi SZ]
          Length = 277

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 140/260 (53%), Gaps = 3/260 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL---PLTIC 60
            F  RAL +G  I +    LG F++ +R++  GD +AH     VAL+L   L    + + 
Sbjct: 10  SFMQRALLAGTLIGVLCAVLGVFLVLRRLSLIGDGLAHITFGSVALALFAGLQGAAMLLV 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +  L SL +L++     L  DA +G+++   +SL +++    +    DL S+LFG I
Sbjct: 70  SLPVVLLASLGILKLAGKARLGGDAAIGIVSSVGVSLGVLLAVLGRGYGVDLFSYLFGSI 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  ++L+  G+    + +L+  +  L+A T N ELA   G++   +  +   +T+L 
Sbjct: 130 LAISRAELLVAGGLFITVLALLWLYYNDLVALTFNEELAAVSGIRVRFLNGLLAALTALT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + +++K +G+ LI++LLILP   A + +       IL+ +  +L ++ G+  S + + PS
Sbjct: 190 VVLAMKLVGVMLISALLILPASAALQVARGFRMTVILSVLFSLLSVVGGIVLSFLLNLPS 249

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +II+ +  +F   + +++
Sbjct: 250 GATIILLAFVIFCAGYLFRQ 269


>gi|330901775|gb|EGH33194.1| hypothetical protein PSYJA_31321 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 129

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 87/122 (71%)

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
           ++++  +W+PLLA TV+ E A+ EG+    +++  +++ +++I+V++K +G+ LITSLLI
Sbjct: 5   LVLIVALWRPLLAMTVHEERARVEGLPVATLRMTLMLLIAVVIAVAMKIVGVLLITSLLI 64

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFY 258
           +P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+GPSI++++  LF+LSF  
Sbjct: 65  IPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAGPSIVVSAAALFLLSFVL 124

Query: 259 KK 260
            +
Sbjct: 125 PR 126


>gi|258513689|ref|YP_003189911.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257777394|gb|ACV61288.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 283

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 148/253 (58%), Gaps = 16/253 (6%)

Query: 17  VLSTGPL----GCFIIWQRIAYFGDTIAHSALLGVALSLI--FQLPLTICIFMIATLTSL 70
           VL  GP+    G  ++  R+A+F DTI HSAL G+A+ +I  +Q PL I  F  +   ++
Sbjct: 30  VLLVGPMFAIIGTMVVSNRMAFFSDTIGHSALTGIAIGVILGYQDPLWIMTFF-SIFLAI 88

Query: 71  VLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILL 130
           V+  ++   ++S+D I+GV++ + +SL +VILS     N   + FL GD+L++   ++LL
Sbjct: 89  VVSILKSVSSVSTDTIIGVVSATMVSLGIVILSRGGGFN-KFSRFLIGDLLSITPREVLL 147

Query: 131 I----WGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIK 186
           +     G+    I++ F ++   L  ++N+ LA + G+    I+++F + T+++I++SI+
Sbjct: 148 LALTLGGV----ILLWFIMFNKFLMVSINHSLALSRGIPIRLIEILFCIATAVIITISIQ 203

Query: 187 FIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
           ++G+ +I SLLILP   AR  + +     I+A +I I+  I GL  S    T +G +I++
Sbjct: 204 WVGVLIINSLLILPAAAARNIAENMRQYHIIAILISIISGIAGLISSYYLSTATGATIVL 263

Query: 247 TSLFLFILSFFYK 259
            +   +I +F  K
Sbjct: 264 FAAMFYIGTFLQK 276


>gi|260579289|ref|ZP_05847172.1| Mn2+/Zn2+ ABC superfamily ATP binding cassette transporter,
           permease protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602588|gb|EEW15882.1| Mn2+/Zn2+ ABC superfamily ATP binding cassette transporter,
           permease protein [Corynebacterium jeikeium ATCC 43734]
          Length = 292

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 135/254 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   L  G +G  ++ + +A+ GD +AH+   G+A++   Q  +     +
Sbjct: 17  AFLPKALLVAVLSALVCGVIGTHVVLRGMAFIGDAVAHAVFPGLAIAFALQFSVIAGGAV 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++    +   +  D I+G+   +  +L LV++S ++     L SFLFG I  V
Sbjct: 77  AGAVVALLIALFSQRRRVKEDTIIGIFFAAAFALGLVVISKVQGYTASLNSFLFGSITGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +DI+    +G + I+ +  + K ++A +V+ E A A G++   I ++  +  +  + +
Sbjct: 137 SNSDIIFSAVVGAVVILAVAALHKEIVAVSVDRETAAAMGIRVLLIDVVLYLAVTAAVVM 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ +LLI P   AR ++     M  L+ +IG++G  +G+Y S   D P+G +
Sbjct: 197 SVRTVGNILVLALLITPAAAARLWTDRLVVMMSLSAVIGMVGSFLGVYVSWAIDVPTGAT 256

Query: 244 IIITSLFLFILSFF 257
           I++    +F+ SFF
Sbjct: 257 IVLVLTVVFLFSFF 270


>gi|222150344|ref|YP_002559497.1| ABC transporter permease protein homolog [Macrococcus caseolyticus
           JCSC5402]
 gi|222119466|dbj|BAH16801.1| ABC transporter permease protein homolog [Macrococcus caseolyticus
           JCSC5402]
          Length = 275

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL +   + ++ G +GC II + ++  GD ++H+ L GVALS +  +P+ I     
Sbjct: 12  FLSRALITAAIVGIAAGVVGCLIILRGLSLMGDAMSHAVLPGVALSFLLHIPMFIGALFT 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             LTSL +  I        DA +G+      S+ +V++S M+   T+L   LFGDIL V 
Sbjct: 72  GLLTSLFIGAITDRSKTKKDAAIGIAFTLFFSIGVVMISMME-TTTNLYHILFGDILTVT 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
              +     +    ++++   ++ L  TT +   ++  G+ P       +++ +L+  VS
Sbjct: 131 KEAMYTTLFVSLAVLIVIIVCYRQLKLTTFDPIFSRMNGINPAFWHYTVMILLALITVVS 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IGI L+ ++LI P  +A   S S  NM +L+   G+   + G+Y S I + PSG  I
Sbjct: 191 LQTIGIILVVAMLITPASSAYLISKSLHNMMLLSATFGLFSAVTGIYISYILNVPSGACI 250

Query: 245 IITSLFLFILSFFYKK 260
           +I +  ++++ F + +
Sbjct: 251 VIIATIIYLVIFTFDQ 266


>gi|126658725|ref|ZP_01729870.1| ABC transporter permease protein [Cyanothece sp. CCY0110]
 gi|126619987|gb|EAZ90711.1| ABC transporter permease protein [Cyanothece sp. CCY0110]
          Length = 257

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 132/233 (56%), Gaps = 10/233 (4%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F+I +R++ FGDT+ HSA+LGV L+ + +LP T  +        L ++ +     L SD 
Sbjct: 21  FLILRRLSLFGDTVGHSAMLGVVLAALLELPATWTLMGFTVAFGLGVIYLIDRTDLGSDT 80

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM-ILFK 144
           +L +    +I+L  +  S++K    +L S LFGDILA++ TD++L+  I  + I  IL  
Sbjct: 81  VLCISLSGSIALGTIGFSYLKGYRGNLLSILFGDILAISNTDLILLLLILAVTIAWILIS 140

Query: 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTA 204
           + + +L  T+N +LA  +G+     +  FI++ ++ I+++I+ +GI L+   L++P  TA
Sbjct: 141 LPEQIL-LTLNSDLALVKGVPVRSHRYFFIVLLAITIALTIRAVGILLVNGFLVIPAATA 199

Query: 205 R----RFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFI 253
           R    +F       A +    G++G++I    S   D PSGPSI++  LF F+
Sbjct: 200 RLICQQFVPFLATAAGMGAFSGVMGMVI----SGAIDLPSGPSIVLVQLFGFL 248


>gi|224475766|ref|YP_002633372.1| putative ABC transporter permease [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420373|emb|CAL27187.1| putative ABC transporter, permease component [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 278

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL   I + +  G +G  I+ + ++  GD ++H+ L GVALS +F++P+ +   +
Sbjct: 12  QFLSRALIISIFVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFKIPMFVGALV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L SL +  I        DA +G+   + +++ ++I+S +    TDL   LFG++LA+
Sbjct: 72  TGMLASLFIGFISDKSKTKQDAAIGISFTAFLAVGVIIISLIN-STTDLYHILFGNLLAI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             T       I  + ++++   ++PL+ +T +   ++  G+    I    +++ SL+   
Sbjct: 131 THTAYWSTIIISIIVLLLIIIFYRPLMISTFDPTFSRMSGLNTTFIHYFVMLLLSLVTVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI L+ +LLI P   A   +    +M I A++I ++  I+G+Y S I++ PSG +
Sbjct: 191 SIQTVGIILVVALLITPASAAFLITKKLWSMMIAASVISVISAIVGMYFSYIYNIPSGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  ++I +F Y K
Sbjct: 251 IVLCAFAIYIGTFIYSK 267


>gi|325295084|ref|YP_004281598.1| ABC transporter [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065532|gb|ADY73539.1| ABC-3 protein [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 268

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 135/252 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F I+A+FS +   L    +G +II +++++ G  ++H A  G+A         T+   +
Sbjct: 13  DFGIKAVFSAVLSGLICSAIGTYIILRKMSFIGAGLSHVAFAGIAFGFFIGSSPTLWALV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               + +V+  +   + +  D  LG++  +++ LA++ LS      ++  S+LFG  L V
Sbjct: 73  FTLTSGVVIWYLSIKKKIHYDTTLGILFAASMGLAVMFLSLSNNYGSEALSYLFGSPLIV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+LL+  I FL  +     W+ +   T + ++AKA G   E +  +  ++ S  +++
Sbjct: 133 SNFDVLLLILIAFLTFLFYMFFWREIYLITFSEDIAKASGYNVELVTFLAFLVMSFAVTL 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SIK +G  L+ SLL++P  +A + + +  +   L+   G    I+G++ S IFD PSG +
Sbjct: 193 SIKAVGALLVFSLLVMPAASAFKLTKNYNSFFFLSVFFGFASSILGVFLSFIFDMPSGAA 252

Query: 244 IIITSLFLFILS 255
           I ++S F+F+ S
Sbjct: 253 ITLSSFFIFLTS 264


>gi|298490207|ref|YP_003720384.1| ABC-3 protein ['Nostoc azollae' 0708]
 gi|298232125|gb|ADI63261.1| ABC-3 protein ['Nostoc azollae' 0708]
          Length = 280

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 139/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ +    +    F+ 
Sbjct: 13  FMQRSLIIAILVGLLCAVVGSYLMVQRLALLGDAISHSVLPGLAIAFMIGANIFAGAFIA 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILAV 123
             L+++ +  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+IL+V
Sbjct: 73  GILSTMAIAFIKTRSPIKEDAAMGIVFSAFFALGVTLITVIQKSNKIDLNHFLFGNILSV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              ++     I  + ++++  ++K LL  T +   A+A G+   ++    +++ +L I  
Sbjct: 133 TVDEVRDTSIIATIVLIVVVALYKELLFYTFDPLGAQAAGLPVNRLNFGLMLLIALTIVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K +G+ L+ SLLI P  TA         + IL  +IG++  I G+Y S  ++ PSGP+
Sbjct: 193 SMKAVGVILVLSLLITPGATAYLLVKRLHEVMILGAVIGVISSISGMYLSYFYNLPSGPA 252

Query: 244 IIITSLFLFILSFFY 258
           I++    LFIL+  +
Sbjct: 253 IVLVVSGLFILALLF 267


>gi|294623552|ref|ZP_06702398.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|291597034|gb|EFF28239.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
          Length = 293

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 136/246 (55%), Gaps = 1/246 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQSA-TDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+L  ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMLSAVVGVFFSYSYNWPS 248

Query: 241 GPSIII 246
           G +I++
Sbjct: 249 GATIVL 254


>gi|301054685|ref|YP_003792896.1| ABC transporter permease [Bacillus anthracis CI]
 gi|300376854|gb|ADK05758.1| ABC transporter, permease protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 288

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 140/245 (57%), Gaps = 1/245 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I   +
Sbjct: 14  SFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGAVL 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++L+V
Sbjct: 74  TGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNVLSV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++   
Sbjct: 133 RSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVTVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  SG +
Sbjct: 193 SLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASGAT 252

Query: 244 IIITS 248
           I++ +
Sbjct: 253 IVLVA 257


>gi|222081878|ref|YP_002541243.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
 gi|221726557|gb|ACM29646.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
          Length = 286

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 133/259 (51%), Gaps = 6/259 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ AL   +   LS     CF++ +  +  GD ++HS + GVA + +  LP +I 
Sbjct: 14  MLNAMWVSALVGAVCAFLS-----CFLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L I+S +K    ++ + + G+I
Sbjct: 69  AFFSGGLAAAAMLFLNQRTKLKEDAIIGLIFSSFFGLGLFIVS-LKPAAVNIQTIVLGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+   D L +  IGF+++ IL   WK L+ T  +   A++ G+ P  +K++F  + S  
Sbjct: 128 LAITPEDTLQLAIIGFVSLAILLVKWKDLMVTFFDETHARSIGLNPTALKILFFTLLSAS 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  +++ P  TA   +     + I+A  IG +   +G Y S   D  +
Sbjct: 188 TVAALQTVGAFLVICMVVTPGATAYLLTDRFPRLLIIAVAIGAVTSFVGAYASYFLDGAT 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G  II+    +F+++FF+ 
Sbjct: 248 GGIIIVLQTLIFLVAFFFA 266


>gi|26247466|ref|NP_753506.1| SitC protein [Escherichia coli CFT073]
 gi|91210364|ref|YP_540350.1| SitC protein [Escherichia coli UTI89]
 gi|117623374|ref|YP_852287.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitC [Escherichia
           coli APEC O1]
 gi|218558080|ref|YP_002390993.1| iron transport protein, inner membrane component [Escherichia coli
           S88]
 gi|218700267|ref|YP_002407896.1| iron transporter inner membrane component [Escherichia coli IAI39]
 gi|227886439|ref|ZP_04004244.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Escherichia coli 83972]
 gi|300940480|ref|ZP_07155058.1| ABC 3 transport family protein [Escherichia coli MS 21-1]
 gi|300972062|ref|ZP_07171820.1| ABC 3 transport family protein [Escherichia coli MS 45-1]
 gi|300996125|ref|ZP_07181405.1| ABC 3 transport family protein [Escherichia coli MS 200-1]
 gi|301046476|ref|ZP_07193630.1| ABC 3 transport family protein [Escherichia coli MS 185-1]
 gi|26107867|gb|AAN80066.1|AE016759_340 SitC protein [Escherichia coli CFT073]
 gi|85376558|gb|ABC70485.1| SitC [Escherichia coli]
 gi|86604473|emb|CAJ21352.1| iron transport protein, inner-membrane component SitC [Escherichia
           coli]
 gi|91071938|gb|ABE06819.1| SitC protein [Escherichia coli UTI89]
 gi|115512498|gb|ABJ00573.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitC [Escherichia
           coli APEC O1]
 gi|218364849|emb|CAR02541.1| iron transport protein, inner membrane component [Escherichia coli
           S88]
 gi|218370253|emb|CAR18051.1| iron transport protein, inner membrane component [Escherichia coli
           IAI39]
 gi|227836643|gb|EEJ47109.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Escherichia coli 83972]
 gi|294490093|gb|ADE88849.1| iron chelate ABC transporter, permease protein [Escherichia coli
           IHE3034]
 gi|300301547|gb|EFJ57932.1| ABC 3 transport family protein [Escherichia coli MS 185-1]
 gi|300304588|gb|EFJ59108.1| ABC 3 transport family protein [Escherichia coli MS 200-1]
 gi|300411036|gb|EFJ94574.1| ABC 3 transport family protein [Escherichia coli MS 45-1]
 gi|300454728|gb|EFK18221.1| ABC 3 transport family protein [Escherichia coli MS 21-1]
 gi|307553200|gb|ADN45975.1| iron/manganese transport system membrane protein SitC [Escherichia
           coli ABU 83972]
 gi|307627328|gb|ADN71632.1| iron transport protein, inner membrane component [Escherichia coli
           UM146]
 gi|315290811|gb|EFU50183.1| ABC 3 transport family protein [Escherichia coli MS 153-1]
 gi|323953996|gb|EGB49795.1| ABC 3 transporter [Escherichia coli H263]
          Length = 285

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 138/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 13  MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 68  AFFSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++KLIF  + S+ 
Sbjct: 127 LAIDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKLIFFTLLSVS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFVF 264


>gi|30263123|ref|NP_845500.1| ABC transporter, permease protein [Bacillus anthracis str. Ames]
 gi|47528482|ref|YP_019831.1| ABC transporter permease [Bacillus anthracis str. 'Ames Ancestor']
 gi|49185970|ref|YP_029222.1| ABC transporter permease [Bacillus anthracis str. Sterne]
 gi|118478477|ref|YP_895628.1| manganese ABC transporter permease [Bacillus thuringiensis str. Al
           Hakam]
 gi|165868909|ref|ZP_02213569.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0488]
 gi|167632685|ref|ZP_02391012.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0442]
 gi|167637488|ref|ZP_02395768.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0193]
 gi|170685081|ref|ZP_02876306.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0465]
 gi|170704973|ref|ZP_02895438.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0389]
 gi|177650078|ref|ZP_02933079.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0174]
 gi|190564596|ref|ZP_03017517.1| metal ABC transporter, permease protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|196038170|ref|ZP_03105480.1| metal ABC transporter, permease protein [Bacillus cereus
           NVH0597-99]
 gi|196042575|ref|ZP_03109814.1| metal ABC transporter, permease protein [Bacillus cereus 03BB108]
 gi|225865120|ref|YP_002750498.1| metal ABC transporter, permease protein [Bacillus cereus 03BB102]
 gi|227814015|ref|YP_002814024.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           CDC 684]
 gi|229603718|ref|YP_002867391.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0248]
 gi|254685721|ref|ZP_05149580.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723131|ref|ZP_05184919.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A1055]
 gi|254738192|ref|ZP_05195895.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742638|ref|ZP_05200323.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           Kruger B]
 gi|254752506|ref|ZP_05204542.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           Vollum]
 gi|254761022|ref|ZP_05213046.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           Australia 94]
 gi|300118854|ref|ZP_07056568.1| metal ABC transporter, permease protein [Bacillus cereus SJ1]
 gi|30257757|gb|AAP26986.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           Ames]
 gi|47503630|gb|AAT32306.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49179897|gb|AAT55273.1| ABC transporter, permease protein [Bacillus anthracis str. Sterne]
 gi|118417702|gb|ABK86121.1| manganese ABC transporter, permease [Bacillus thuringiensis str. Al
           Hakam]
 gi|164715635|gb|EDR21152.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0488]
 gi|167514995|gb|EDR90361.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0193]
 gi|167532983|gb|EDR95619.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0442]
 gi|170129828|gb|EDS98690.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0389]
 gi|170671341|gb|EDT22079.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0465]
 gi|172084030|gb|EDT69089.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0174]
 gi|190563913|gb|EDV17877.1| metal ABC transporter, permease protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|196026059|gb|EDX64727.1| metal ABC transporter, permease protein [Bacillus cereus 03BB108]
 gi|196031440|gb|EDX70037.1| metal ABC transporter, permease protein [Bacillus cereus
           NVH0597-99]
 gi|225790269|gb|ACO30486.1| metal ABC transporter, permease protein [Bacillus cereus 03BB102]
 gi|227003535|gb|ACP13278.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           CDC 684]
 gi|229268126|gb|ACQ49763.1| metal ABC transporter, permease protein [Bacillus anthracis str.
           A0248]
 gi|298723752|gb|EFI64480.1| metal ABC transporter, permease protein [Bacillus cereus SJ1]
          Length = 288

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 140/245 (57%), Gaps = 1/245 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I   +
Sbjct: 14  SFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGAVL 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++L+V
Sbjct: 74  TGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNVLSV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++   
Sbjct: 133 RSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVTVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  SG +
Sbjct: 193 SLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASGAT 252

Query: 244 IIITS 248
           I++ +
Sbjct: 253 IVLVA 257


>gi|241206143|ref|YP_002977239.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860033|gb|ACS57700.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 286

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 136/259 (52%), Gaps = 6/259 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ AL  G+   LS     C+++ +  +  GD ++H+ + GVA + +  LP +I 
Sbjct: 14  MLNAMWVSALVGGVCAFLS-----CYLMLKGWSLIGDALSHAIVPGVAGAYMLGLPFSIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +K +  ++ + + G+I
Sbjct: 69  AFFSGGLAAAAMLFLNQRTKLKEDAIIGLIFSSFFGLGLFMVS-LKPMAVNIQTIVLGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+   D L +  IGF+++ +L   WK L+ T  +   A++ G+ P  +K+IF  + S  
Sbjct: 128 LAITPEDTLQLAIIGFVSLAVLLVKWKDLMVTFFDESHARSIGLNPTVLKVIFFTLLSAS 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  +++ P  TA   +     + ++A IIG +   +G Y S   D  +
Sbjct: 188 TVAALQTVGAFLVICMVVTPGATAYLLTDRFPRLLVIAVIIGSMTSFVGAYASYFLDGAT 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G  I++    +F+++FF+ 
Sbjct: 248 GGIIVVLQTAIFLIAFFFA 266


>gi|67921114|ref|ZP_00514633.1| ABC-3 [Crocosphaera watsonii WH 8501]
 gi|67857231|gb|EAM52471.1| ABC-3 [Crocosphaera watsonii WH 8501]
          Length = 271

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 127/229 (55%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F+I +R++ FGDT+ HSA+LGV L+ + +LP T  +        L ++ +     L SD 
Sbjct: 35  FLILRRLSLFGDTVGHSAMLGVVLAALLELPTTWTLIGFTVAFGLGVIYLIDKTDLGSDT 94

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKI 145
           +L +    +I+L  +  S++K    +L S LFGDILA++ TD++L+  +  + +  +   
Sbjct: 95  VLCISLSGSIALGTIGFSYLKGYRGNLLSILFGDILAISNTDLILLLLLLAITVAWIIMS 154

Query: 146 WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTAR 205
               +  T+N +LA  +G+     +  FI++ ++ I+++I+ +GI L+ + L++P  T+R
Sbjct: 155 LPEQILLTLNRDLALVKGVPVSSNRYFFIVLLAITIALTIRAVGILLVNAFLVIPAATSR 214

Query: 206 RFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFIL 254
                     + A  IG    ++G+  S   D PSGPSI++  LF F++
Sbjct: 215 LICQQFVPFLVTAAAIGATSGVMGMVISGALDLPSGPSIVLVQLFGFLI 263


>gi|146310771|ref|YP_001175845.1| ABC-3 protein [Enterobacter sp. 638]
 gi|145317647|gb|ABP59794.1| ABC-3 protein [Enterobacter sp. 638]
          Length = 285

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 139/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 13  MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+   L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 68  AFLSGGLAAASMLFLNQRSRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+   DIL +  IG ++I++L   WK L+ T  +   A+A G++PE++K++F  + ++ 
Sbjct: 127 LAIAPEDILQLTIIGVVSILVLLFKWKDLMVTFFDENHARAIGLRPERLKILFFTLLAVS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + ++A  IG L   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSLTSFLGAWASYYLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFVF 264


>gi|260585106|ref|ZP_05852847.1| metal ion ABC transporter permease [Granulicatella elegans ATCC
           700633]
 gi|260157194|gb|EEW92269.1| metal ion ABC transporter permease [Granulicatella elegans ATCC
           700633]
          Length = 276

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 132/256 (51%), Gaps = 1/256 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL S + I    G +GCFII + ++  GD I+H+ L GVALS I  +     
Sbjct: 9   MNYHFVQNALISSVLIGAVAGMIGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFFG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 L S ++  I +N  + SD  +G+   S ++L ++++   K  +TDL   LFG+I
Sbjct: 69  ALAFGLLASFIIAFINRNSVVKSDTAIGITFSSFLALGIILIGVAKS-STDLFHILFGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+L+   +G    + +   +K L  T+ +   A++ G+       + + + +L+
Sbjct: 128 LAVQDFDLLITAIVGIFVFVTIISYFKELQVTSFDPVFARSAGLNVSFYHYLLMFLLALV 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  +I +LLI P  TA  +S S + M  L+ + G L  I+GL     F+   
Sbjct: 188 SITAMQSVGTVMIVALLITPAATAYLYSKSLKTMLALSAMFGSLSSIVGLVIGYTFNIAV 247

Query: 241 GPSIIITSLFLFILSF 256
           G +I++T+   F++SF
Sbjct: 248 GSTIVLTAAAFFVISF 263


>gi|239636755|ref|ZP_04677757.1| manganese transport system membrane protein MntB [Staphylococcus
           warneri L37603]
 gi|239598110|gb|EEQ80605.1| manganese transport system membrane protein MntB [Staphylococcus
           warneri L37603]
          Length = 277

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 145/254 (57%), Gaps = 5/254 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL   + + +  G +G  I+ + ++  GD ++H+ L GVALS +F +P+ I   +
Sbjct: 12  QFLNRALIISMIVGVVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFLFGIPMFIGALI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + S+++  I        DA +G+   + ++L ++++S +    TDL   LFG++LA+
Sbjct: 72  TGMIASMLIGFITSKSKTKPDAAIGISFTAFLALGVILISVINS-TTDLYHILFGNLLAI 130

Query: 124 NTTDI--LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
             T     +I G+  L+++I+F  ++PL+ +T +   ++  G+  + I    +++ +L+ 
Sbjct: 131 THTTFWTTVIIGLFVLSLIIIF--YRPLMISTFDNTFSRMNGLNTKLIHYFVMLLLALVT 188

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             SI+ +GI L+ +LL+ P  TA     +   M  +A+ IG++  IIGLY S I++ PSG
Sbjct: 189 VASIQTVGIILVVALLVTPASTAFLICKNLYGMMAVASFIGVISSIIGLYFSYIYNVPSG 248

Query: 242 PSIIITSLFLFILS 255
            +I++ +  +++++
Sbjct: 249 AAIVLCTFAIYVIT 262


>gi|239630272|ref|ZP_04673303.1| ABC-type Mn2//Zn2/ transport system protein [Lactobacillus
           paracasei subsp. paracasei 8700:2]
 gi|239527884|gb|EEQ66885.1| ABC-type Mn2//Zn2/ transport system protein [Lactobacillus
           paracasei subsp. paracasei 8700:2]
          Length = 294

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 143/258 (55%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   +
Sbjct: 11  DFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGASV 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++  +  N  + +D  +GV+  +  +L  +++S M    T+L   LFG+ILAV
Sbjct: 71  FGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILIS-MAESATNLHHILFGNILAV 129

Query: 124 NTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           + +DI+    +  L I+ILF +  +K LL T+ +   AK  G+    I    +++ +L+ 
Sbjct: 130 SDSDIVTTAVV--LGIVILFVVLFYKELLITSFDNTFAKTYGLNTTMIHYALMLVLTLVT 187

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI L+ ++LI P  TA  ++   E   I +  +G+   I GLY S  F+  SG
Sbjct: 188 VSALQTVGIILVVAMLITPAATAFLWTDRLETTLITSASVGVFSAITGLYFSFTFNWASG 247

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I++ +  LF +SF + 
Sbjct: 248 PAIVLVAAVLFAISFVFS 265


>gi|330509070|ref|YP_004385498.1| cation ABC-3 transporter family protein [Methanosaeta concilii
           GP-6]
 gi|328929878|gb|AEB69680.1| cation ABC-3 trasnport family protein [Methanosaeta concilii GP-6]
          Length = 268

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 140/259 (54%), Gaps = 4/259 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL +G+   +  G +G ++I  +I +  D IAH+A  G+ L   + L     IF 
Sbjct: 12  DFMRVALAAGLASAVLCGIIGIYVILNKIVFISDGIAHAAFGGIGLG--YFLGFDPLIFG 69

Query: 64  I--ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           +  A LT++ +  +     +S D  +GV   + ++L +++L+  K    DL  +LFG+IL
Sbjct: 70  VGSAVLTAVGIGMVSGRARVSEDTAIGVFMATGMALGVMLLTLSKGYARDLYGYLFGNIL 129

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV   D+LLI G+    +++++ ++K  L  + +    +A G+  + ++L+ + + +  +
Sbjct: 130 AVTINDVLLISGLTLAIMLLIYILYKEFLIMSFDPVYGEAIGLPVKSLRLLLLAMVAFSV 189

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            V IK +GI ++ +LL +P   +R+      ++   + ++G + + +GL  S + D PSG
Sbjct: 190 VVLIKIVGIIMVIALLTIPGAISRQHLRGLPSIMAGSAVLGSIFVTVGLIVSYMLDVPSG 249

Query: 242 PSIIITSLFLFILSFFYKK 260
            +II+T+   F LS  Y +
Sbjct: 250 ATIILTAAIFFFLSTLYSR 268


>gi|294141799|ref|YP_003557777.1| iron (chelated) ABC transporter permease protein [Shewanella
           violacea DSS12]
 gi|293328268|dbj|BAJ02999.1| iron (chelated) ABC transporter, permease protein [Shewanella
           violacea DSS12]
          Length = 305

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 126/245 (51%), Gaps = 3/245 (1%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           + + T  L CF++ +  +  GD I+HS L GV L+ +  +P  I  F      +L    I
Sbjct: 31  VAIPTSVLSCFLVLKGWSLMGDAISHSVLPGVILAYVLSIPYAIGAFAAGMFCALATGFI 90

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           + N  L  D ++GV+  S   L LV+++ ++     L   LFGD+L V+ TD+L   GI 
Sbjct: 91  KDNSRLKEDTVMGVVFSSMFGLGLVLMTKVE-TGVHLDHILFGDVLGVSWTDVLEAGGIA 149

Query: 136 FLNI-MILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLIT 194
            L I  ILFK  + LL    +++ AKA G+    +    + I SL I  ++K +G+ L+ 
Sbjct: 150 LLVISFILFK-GRDLLVFVFDHQHAKAIGLPVNLLHYGLLSILSLTIVGALKAVGMILVV 208

Query: 195 SLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFIL 254
           ++LI P   A   +   ++M ++A  I  L   +G+Y S   D+   P+II+    +FI 
Sbjct: 209 AMLIAPGAIAFLLTRKFQSMMLIALFISTLTSFLGVYLSFFIDSAPAPTIIMLMTLIFIC 268

Query: 255 SFFYK 259
            FFY 
Sbjct: 269 VFFYS 273


>gi|116253626|ref|YP_769464.1| iron ABC transporter [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258274|emb|CAK09376.1| putative Fur regulated salmonella iron ABC transporter component
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 286

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 136/259 (52%), Gaps = 6/259 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ AL  G+   LS     C+++ +  +  GD ++H+ + GVA + +  LP +I 
Sbjct: 14  MLNAMWVSALVGGVCAFLS-----CYLMLKGWSLIGDALSHAIVPGVAGAYMLGLPFSIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S ++ +  ++ + + G+I
Sbjct: 69  AFFSGGLAAAAMLFLNQRTKLKEDAIIGLIFSSFFGLGLFMVS-LQPMAVNIQTIVLGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+   D L +  IGF+++ +L   WK L+ T  +   A++ G+ P  +K+IF  + S  
Sbjct: 128 LAITPEDTLQLAIIGFVSLAVLLVKWKDLMVTFFDESHARSIGLNPTALKVIFFTLLSAS 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  +++ P  TA   +     + ++A IIG +   +G Y S   D  +
Sbjct: 188 TVAALQTVGAFLVICMVVTPGATAYLLTDRFPRLLVIAVIIGSMTSFVGAYASYFLDGAT 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G  I++    +F+++FF+ 
Sbjct: 248 GGIIVVLQTAIFLVAFFFA 266


>gi|218441643|ref|YP_002379972.1| ABC transporter [Cyanothece sp. PCC 7424]
 gi|218174371|gb|ACK73104.1| ABC-3 protein [Cyanothece sp. PCC 7424]
          Length = 285

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 134/256 (52%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL  GI + L    +G ++I QR+A  GD IAH  L G+++S    + + I  F 
Sbjct: 12  EFMRNALGIGILVGLLCPVVGSYLIVQRMALLGDVIAHCVLPGLSISFFLGIDILIGAFT 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L + ++  I+    +  D+ + +   S  +L + ++S +K    DL SFLFGDIL V
Sbjct: 72  SGILGAFLIAWIRSQSRIKVDSAMALTFSSFFALGITLMSVLKN-KLDLDSFLFGDILGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            +TDI     I  L ++ +   +K LL    +   A+A G+    I   F+++ +L I  
Sbjct: 131 TSTDIYRTLIITVLILLTIKLFYKELLFYVFDRNGAQAIGLPINTIYTGFMVVITLTIIA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ SLL+ P + A         M IL + IG++  + G+Y S  ++ PSGP 
Sbjct: 191 SMQAVGVILVISLLVGPALAAYLLVKELHQMMILGSAIGMISSVTGVYISYYYNLPSGPM 250

Query: 244 IIITSLFLFILSFFYK 259
           I++ S  LF+++  + 
Sbjct: 251 IVLMSSSLFLMALLFS 266


>gi|302388659|ref|YP_003824480.1| ABC-3 protein [Thermosediminibacter oceani DSM 16646]
 gi|302199287|gb|ADL06857.1| ABC-3 protein [Thermosediminibacter oceani DSM 16646]
          Length = 274

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 134/243 (55%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F +RA  +G+   + T  +G F++ +R++  GD+++H++L GVA  ++F         +
Sbjct: 7   SFMVRAFIAGVIAAVLTSTIGVFVVLRRMSIVGDSLSHASLAGVAAGMLFGFYPFYGALL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            + L +L++  ++      ++  + V+  + +  A+V++S  K  N DL S+LFG ++AV
Sbjct: 67  FSVLAALLIEVMRATFKSYAEVAMAVVMSAGMGTAVVLISLGKSFNADLFSYLFGSLMAV 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI +I  +G      +  + + L A T + + A+  G+    + + F +IT+L +++
Sbjct: 127 TPGDIKVISVLGLFVTASIILLRRELFAVTFDEDTARLSGVPVRAVNIYFSVITALTVAL 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+++L+++P   + + + S  +   ++ I+ I  +++GLY S   D   G +
Sbjct: 187 SVRVVGTLLVSALIVIPAAVSLQLARSFRSAFFISNIVAIFSVVVGLYISFYLDLAPGGT 246

Query: 244 III 246
           I++
Sbjct: 247 IVL 249


>gi|310641834|ref|YP_003946592.1| abc transporter permease [Paenibacillus polymyxa SC2]
 gi|309246784|gb|ADO56351.1| ABC transporter permease [Paenibacillus polymyxa SC2]
          Length = 280

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 140/260 (53%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +F  RA  +G  I L    LG +++ +R A   D ++H +L GVA      +  TI 
Sbjct: 2   LHYDFMQRAFCAGGVIALLASVLGVYLMLRRQALMADMLSHVSLAGVAAGAYLGISPTIT 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F++A + ++++  ++++    S+  + +I    +S A+++++  + +N   +++LFG +
Sbjct: 62  GFIVAVIGAIIVEYVRRSYKTYSEISVAIIMVGGLSTAVILMNLNQSINKGFSAYLFGSV 121

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +AVN T+++L+  +  +  +  F   +PL   T + E AK  G+  + I   F ++T ++
Sbjct: 122 VAVNQTELMLMIVVAVIGGIFFFVFRRPLYQITFDEETAKTNGLPVKSISFAFSILTGMI 181

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++ ++  +G+ L++SL++LP   A R + S      ++ I  ++G+ +GL  S    TP 
Sbjct: 182 VAAAMPIVGVLLVSSLIVLPAALAIRIAPSFAAAIWISMITALIGVFMGLTASYELSTPP 241

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +I +  L   I+    +K
Sbjct: 242 GGTIAMVLLLFLIVGASIQK 261


>gi|167045312|gb|ABZ09970.1| putative ABC 3 transport family protein [uncultured marine
           crenarchaeote HF4000_APKG9P22]
          Length = 277

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 8   RALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-PLTICIFMIAT 66
            AL SGI I L    +G F++ ++ + FGD +AHSA  GVA  L   + PL I    +A 
Sbjct: 13  HALISGIAISLLCSVVGLFLVLRKFSLFGDALAHSAFGGVAFGLFIGIYPLWIAC-AVAI 71

Query: 67  LTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGDILAVNT 125
           L++L L +I++   +S DAI+ ++  + +   ++++S  +     D+  FLFG  + V+T
Sbjct: 72  LSALGLTKIRQKFDISGDAIVAILLSTGLGAGVILVSLTEDFEFHDIEEFLFGSAI-VDT 130

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            +++ I  +  + + ILF  +K +L +T + E AKA G+  EK+  + I +  + + +S+
Sbjct: 131 QNVVAILAMAGIILTILFFTYKKILYSTFSEEQAKASGIPVEKMSYLLIAMAGVTVVISM 190

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ LI++L +LP V+A  ++ S +   IL+    +   + G+  S  F+      I+
Sbjct: 191 QLVGVLLISALFVLPNVSAMLYARSFKQTVILSMSFAVFATVSGIIMSYQFEIAQAGCIV 250

Query: 246 ITSLFLFILSFFYK 259
           + +  +FI S   K
Sbjct: 251 LVAAAIFIGSLVAK 264


>gi|113478279|ref|YP_724340.1| hypothetical protein Tery_4953 [Trichodesmium erythraeum IMS101]
 gi|110169327|gb|ABG53867.1| ABC-3 [Trichodesmium erythraeum IMS101]
          Length = 272

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 132/240 (55%), Gaps = 10/240 (4%)

Query: 26  FIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDA 85
           F+I ++++ FG+ + H+A L V +  + QLP  + +     L  L +  + +   L  D 
Sbjct: 35  FVILRQLSLFGNALGHTAFLAVVIGALLQLPTMMVLIGFLLLFGLGINYLIQKTNLGGDT 94

Query: 86  ILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTD-----ILLIWGIGFLNIM 140
           IL ++  S+++L  +  +F+     +L S LFGDILA++  D     ILL+  + +L + 
Sbjct: 95  ILSIVIASSVALGTIGFNFVPGYRGNLLSILFGDILAISNLDLAFVVILLVVSLSWLGVT 154

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           +  +I       T+N ELA+ +G+  E+ + IFI+I SL I+++I+ +GI L+ + L++P
Sbjct: 155 LQKQIL-----LTLNPELAQVQGIPVERYQYIFIIILSLAIALTIRAVGILLVNAFLVIP 209

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
             TA+           ++ +IG +  +IG+  S   + PSGPSI++  L  F++  F  K
Sbjct: 210 AATAKLICHQFVPFLGVSALIGSMSGVIGMVLSGTLNLPSGPSIVLVQLLTFLVVVFSGK 269


>gi|24112750|ref|NP_707260.1| Iron transport protein [Shigella flexneri 2a str. 301]
 gi|30063296|ref|NP_837467.1| Iron transport protein [Shigella flexneri 2a str. 2457T]
 gi|74312255|ref|YP_310674.1| iron transport protein inner membrane component [Shigella sonnei
           Ss046]
 gi|82544179|ref|YP_408126.1| iron transport protein, inner membrane component [Shigella boydii
           Sb227]
 gi|82776738|ref|YP_403087.1| iron transport protein, inner membrane component [Shigella
           dysenteriae Sd197]
 gi|187732346|ref|YP_001880200.1| iron/manganese transport system inner membrane protein SitC
           [Shigella boydii CDC 3083-94]
 gi|194431911|ref|ZP_03064201.1| iron/manganese transport system inner membrane protein SitC
           [Shigella dysenteriae 1012]
 gi|221218516|ref|YP_002527474.1| ABC transport system, inner membrane component SitC [Escherichia
           coli]
 gi|300922993|ref|ZP_07139064.1| ABC 3 transport family protein [Escherichia coli MS 182-1]
 gi|301020544|ref|ZP_07184626.1| ABC 3 transport family protein [Escherichia coli MS 69-1]
 gi|307138022|ref|ZP_07497378.1| ABC transport system, inner membrane component SitC [Escherichia
           coli H736]
 gi|309788922|ref|ZP_07683517.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 1617]
 gi|331641945|ref|ZP_08343080.1| iron transport protein, inner membrane component [Escherichia coli
           H736]
 gi|24051674|gb|AAN42967.1| Iron transport protein [Shigella flexneri 2a str. 301]
 gi|29367045|gb|AAM95576.1| inner membrane permease [Shigella flexneri]
 gi|30041548|gb|AAP17276.1| Iron transport protein [Shigella flexneri 2a str. 2457T]
 gi|73855732|gb|AAZ88439.1| iron transport protein inner membrane component [Shigella sonnei
           Ss046]
 gi|81240886|gb|ABB61596.1| iron transport protein, inner membrane component [Shigella
           dysenteriae Sd197]
 gi|81245590|gb|ABB66298.1| iron transport protein, inner membrane component [Shigella boydii
           Sb227]
 gi|187429338|gb|ACD08612.1| iron/manganese transport system inner membrane protein SitC
           [Shigella boydii CDC 3083-94]
 gi|194419819|gb|EDX35898.1| iron/manganese transport system inner membrane protein SitC
           [Shigella dysenteriae 1012]
 gi|215252844|gb|ACJ63503.1| ABC transport system, inner membrane component SitC [Escherichia
           coli]
 gi|281600783|gb|ADA73767.1| Inner membrane permease [Shigella flexneri 2002017]
 gi|300398650|gb|EFJ82188.1| ABC 3 transport family protein [Escherichia coli MS 69-1]
 gi|300420722|gb|EFK04033.1| ABC 3 transport family protein [Escherichia coli MS 182-1]
 gi|308923193|gb|EFP68705.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 1617]
 gi|313649310|gb|EFS13743.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri 2a str. 2457T]
 gi|315300063|gb|EFU59301.1| ABC 3 transport family protein [Escherichia coli MS 16-3]
 gi|320178014|gb|EFW52996.1| Manganese ABC transporter, inner membrane permease protein SitC
           [Shigella boydii ATCC 9905]
 gi|320187633|gb|EFW62313.1| Manganese ABC transporter, inner membrane permease protein SitC
           [Shigella flexneri CDC 796-83]
 gi|323172837|gb|EFZ58469.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli LT-68]
 gi|323942223|gb|EGB38395.1| ABC 3 transporter [Escherichia coli E482]
 gi|331038743|gb|EGI10963.1| iron transport protein, inner membrane component [Escherichia coli
           H736]
 gi|332091181|gb|EGI96270.1| chelated iron transport system membrane protein yfeC [Shigella
           boydii 5216-82]
 gi|332098346|gb|EGJ03319.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 155-74]
 gi|332757083|gb|EGJ87424.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri 2747-71]
 gi|332757727|gb|EGJ88057.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-671]
 gi|333003124|gb|EGK22674.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri VA-6]
 gi|333003585|gb|EGK23124.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-218]
 gi|333004548|gb|EGK24073.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-272]
 gi|333018096|gb|EGK37400.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-227]
 gi|333018466|gb|EGK37763.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-304]
          Length = 285

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 138/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 13  MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 68  AFFSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+ 
Sbjct: 127 LAIDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLIIAVTIGSVTSFLGAWVSYFLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFVF 264


>gi|284921277|emb|CBG34343.1| iron ABC transporter, permease protein [Escherichia coli 042]
          Length = 285

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 138/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 13  MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 68  AFFSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+ 
Sbjct: 127 LAIDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDHFPRLLIIAVTIGSVTSFLGAWVSYFLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFVF 264


>gi|301019436|ref|ZP_07183610.1| ABC 3 transport family protein [Escherichia coli MS 196-1]
 gi|299882226|gb|EFI90437.1| ABC 3 transport family protein [Escherichia coli MS 196-1]
 gi|332095019|gb|EGJ00055.1| chelated iron transport system membrane protein yfeC [Shigella
           boydii 3594-74]
          Length = 273

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 138/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 1   MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 55

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 56  AFFSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 114

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+ 
Sbjct: 115 LAIDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVS 174

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +
Sbjct: 175 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLIIAVTIGSVTSFLGAWVSYFLDGAT 234

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 235 GGIIVVAQTLLFLLAFVF 252


>gi|188590342|ref|YP_001920133.1| hydrophobic membrane protein ZurM [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188500623|gb|ACD53759.1| putative metal ion ABC transporter, permease protein [Clostridium
           botulinum E3 str. Alaska E43]
          Length = 264

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  +GI + +    +G FI+ +R +  GDT++HS+  GVA+ L+      I  F+
Sbjct: 5   SFMQNAFMAGIIVAILCPFIGLFIVLRRNSMIGDTLSHSSFAGVAIGLVIGTNPIITAFL 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             +L ++++  ++      S+ ++ ++   ++ +A++++S  K V   + SFLFG IL V
Sbjct: 65  FTSLCAIIIEFLRDYYKKYSELVMSIVLTLSLGIAIILVSSGKAV-AKVDSFLFGSILTV 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DILLI  IG + I++L  I+  L+  T +   AK  G+  + I  IF ++    IS+
Sbjct: 124 TRSDILLIALIGTVCIILLLIIYNKLIYVTFDENGAKTVGINVKLINYIFTLLVGATISL 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +++S++++P  TA +         I + I G++ +I+GL  S   ++  G +
Sbjct: 184 SIQIMGILVVSSIMVVPVATAMQLKKGFNKTLIFSIIFGLIDVILGLVLSYYLNSAPGGT 243

Query: 244 IIITSLFLFILSFFY 258
           I +TS+ + +L+  +
Sbjct: 244 IALTSVIMLVLTLIF 258


>gi|15604470|ref|NP_220988.1| hypothetical protein RP621 [Rickettsia prowazekii str. Madrid E]
 gi|3861164|emb|CAA15064.1| unknown [Rickettsia prowazekii]
 gi|292572246|gb|ADE30161.1| Zinc/manganese ABC transporter permease protein [Rickettsia
           prowazekii Rp22]
          Length = 253

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 129/228 (56%), Gaps = 7/228 (3%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
            PLGC  +W+R  YFGD +AHS+ L  ++S+I   PL     ++A L S  +   + N  
Sbjct: 16  APLGCIALWKRYIYFGDGLAHSSFLAASISIIAHFPLIYSGIIVAILFSFFVFFFKNNS- 74

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTD--ILLIWGIGFLN 138
              +A++ +I+   +++AL+I  F    N ++   LFGDIL+V+  D  IL++  I  ++
Sbjct: 75  -EKNAVINLISSFMLAVALIINYFTSLQN-NIVHLLFGDILSVSFNDLIILVVVLITIIS 132

Query: 139 IMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLI 198
            ++ F  +  +L   +N ++A  +G++   I+LIF+++ SL +  +IK +G+ ++T++L+
Sbjct: 133 FVVYF--YNQILLIIINRDIAVIQGLKVNIIELIFLLLLSLSVFAAIKIVGVLMVTAILL 190

Query: 199 LPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
           +P + AR  S SP  M I++  I +       + S  FD P  P  II
Sbjct: 191 IPAMIARFVSYSPSQMIIISIFISLFINFCAAFSSFYFDLPLTPLFII 238


>gi|110641372|ref|YP_669102.1| iron transport protein, inner membrane component [Escherichia coli
           536]
 gi|191170912|ref|ZP_03032463.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli F11]
 gi|218689100|ref|YP_002397312.1| iron transporter inner membrane component [Escherichia coli ED1a]
 gi|218704668|ref|YP_002412187.1| iron transport protein, inner membrane component [Escherichia coli
           UMN026]
 gi|293404688|ref|ZP_06648680.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli FVEC1412]
 gi|298380329|ref|ZP_06989928.1| manganese/iron transport system permease [Escherichia coli
           FVEC1302]
 gi|300896832|ref|ZP_07115328.1| ABC 3 transport family protein [Escherichia coli MS 198-1]
 gi|306813952|ref|ZP_07448125.1| iron transport protein, inner membrane component [Escherichia coli
           NC101]
 gi|331646459|ref|ZP_08347562.1| SitC protein [Escherichia coli M605]
 gi|110342964|gb|ABG69201.1| iron transport protein, inner membrane component [Escherichia coli
           536]
 gi|190908644|gb|EDV68232.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli F11]
 gi|218426664|emb|CAR07495.1| iron transport protein, inner membrane component [Escherichia coli
           ED1a]
 gi|218431765|emb|CAR12648.1| iron transport protein, inner membrane component [Escherichia coli
           UMN026]
 gi|222032947|emb|CAP75687.1| SitC protein [Escherichia coli LF82]
 gi|291426896|gb|EFE99922.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli FVEC1412]
 gi|298277771|gb|EFI19285.1| manganese/iron transport system permease [Escherichia coli
           FVEC1302]
 gi|300359340|gb|EFJ75210.1| ABC 3 transport family protein [Escherichia coli MS 198-1]
 gi|305852589|gb|EFM53037.1| iron transport protein, inner membrane component [Escherichia coli
           NC101]
 gi|324009558|gb|EGB78777.1| ABC 3 transport family protein [Escherichia coli MS 57-2]
 gi|324015725|gb|EGB84944.1| ABC 3 transport family protein [Escherichia coli MS 60-1]
 gi|330911015|gb|EGH39525.1| manganese ABC transporter, inner membrane permease protein SitC
           [Escherichia coli AA86]
 gi|331045211|gb|EGI17338.1| SitC protein [Escherichia coli M605]
          Length = 285

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 138/258 (53%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ A+  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP ++ 
Sbjct: 13  MLNAMWVSAMVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F    L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+I
Sbjct: 68  AFFSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++KL+F  + S+ 
Sbjct: 127 LAIDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKLLFFTLLSVS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFVF 264


>gi|1171962|sp|P42362|P29K_STRPN RecName: Full=29 kDa membrane protein in psaA 5'region; AltName:
           Full=ORF1
 gi|393268|gb|AAA16797.1| 29-kiloDalton protein [Streptococcus pneumoniae]
          Length = 278

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 141/260 (54%), Gaps = 15/260 (5%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I    
Sbjct: 13  HFLQNALITAIAIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAIA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVIT------HSTISLALVILSFMKWVNTDLTSFLF 117
              L S+++  I+ N  + SD  +G ++      HS           +   +TDL   LF
Sbjct: 73  FGLLASILITYIKSNSIIKSDTAMGYLSLPRPRSHS---------DRVAKSSTDLFHILF 123

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G+ILAV   D+ +  G+G   ++++  +++PLL T+ +  LA++ G++ +    + +++ 
Sbjct: 124 GNILAVQDQDMWVTIGVGVAVLLVIVLLFRPLLLTSFDPVLAQSMGVRVKLYHYLLMVLL 183

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
           +L+   +++ +G  LI ++LI P  TA  ++ S  +M +L++ +G L  I+GL+    F+
Sbjct: 184 TLVSVTAMQSVGTILIAAMLITPAATAYLYANSLWSMMLLSSGLGALASILGLFIGYSFN 243

Query: 238 TPSGPSIIITSLFLFILSFF 257
              G  I++TS   F++SFF
Sbjct: 244 IAVGSCIVLTSAIFFLISFF 263


>gi|317049470|ref|YP_004117118.1| ABC-3 protein [Pantoea sp. At-9b]
 gi|316951087|gb|ADU70562.1| ABC-3 protein [Pantoea sp. At-9b]
          Length = 290

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 135/258 (52%), Gaps = 6/258 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M N  ++ AL  G+   LS     C+++ +  +  GD ++HS + GVA + +  LP  + 
Sbjct: 13  MLNAMWVSALVGGLCAFLS-----CYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+   L +  +L + +   L  DAI+G+I  S   L L ++S +     ++ + + G+I
Sbjct: 68  AFLSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTAVNIQTIVLGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+   DIL +  IG ++I +LF  WK LL T  +   A+A G+ P+++KL+F  + +L 
Sbjct: 127 LAIAPADILQLTLIGAVSISVLFFKWKDLLVTFFDENHARAIGLHPQRLKLLFFTLLALS 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  L+  L++ P  TA   +     +  +A  IG +   +G + S   D  +
Sbjct: 187 TVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLAIAVTIGSVTSFLGAWASYYLDGAT 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G  I++    LF+L+F +
Sbjct: 247 GGIIVVAQTLLFLLAFIF 264


>gi|187934961|ref|YP_001884973.1| high-affinity Zinc uptake system membrane protein ZnuB [Clostridium
           botulinum B str. Eklund 17B]
 gi|187723114|gb|ACD24335.1| putative metal ion ABC transporter, permease protein [Clostridium
           botulinum B str. Eklund 17B]
          Length = 264

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  +GI + +    +G FI+ +R +  GDT++HS+  GVA+ L+      I  F+
Sbjct: 5   SFMQNAFMAGIIVAILCPFIGLFIVLRRNSMIGDTLSHSSFAGVAIGLVIGTNPIITAFL 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             +L ++++  ++      S+ ++ ++   ++ +A++++S  K V   + SFLFG IL V
Sbjct: 65  FTSLCAIIIEFLRDYYKKYSELVMSIVLTLSLGIAIILVSSGKAV-AKVDSFLFGSILTV 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DILLI  IG + I++L  I+  L+  T +   AK  G+  + I  IF ++    IS+
Sbjct: 124 TKSDILLIALIGTVCIILLLIIYNKLIYVTFDESGAKTVGINVKLINYIFTLLVGATISL 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +++S++++P  TA +         I + I G++ +I+GL  S   ++  G +
Sbjct: 184 SIQIMGILVVSSIMVVPVATAMQLKKGFNKTLIFSIIFGLIDVILGLVLSYYLNSAPGGT 243

Query: 244 IIITSLFLFILSFFY 258
           I +TS+ + +L+  +
Sbjct: 244 IALTSVIMLVLTLIF 258


>gi|317128345|ref|YP_004094627.1| ABC transporter [Bacillus cellulosilyticus DSM 2522]
 gi|315473293|gb|ADU29896.1| ABC-3 protein [Bacillus cellulosilyticus DSM 2522]
          Length = 278

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 141/260 (54%), Gaps = 8/260 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF--QLPL---- 57
           +F   +L++G+ I      +G F++ +R+A   D ++H  L G+A SL+     P     
Sbjct: 9   DFLTYSLYTGLMIGFIAPLIGVFLVVRRLALISDALSHITLSGIAFSLLLGRHFPTFASL 68

Query: 58  -TICIFMIATLTSLVLLQIQKN-EALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
             + + M  +++  +L++  +N      + ++ +I  S I + +V +S     N DL ++
Sbjct: 69  NPLYMGMAFSVSGAILMERLRNVYRYYQELVIPIILSSGIGIGVVFISLANGFNNDLFTY 128

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFG ++A+  TD+ LI+ I  + I++    +K L   + + E A   G+  + +   FI+
Sbjct: 129 LFGSVVAIRKTDLQLIFAITVIVIILFILFYKELFYLSFDEEQAVVSGIPKKALHFFFIV 188

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           I +L+IS S++ +GI L++SL+ LP   A R++   + M I A + G + ++IGL+ S  
Sbjct: 189 IVALVISSSMRIVGILLVSSLMTLPVAAAMRWARGFKQMFIYAILFGEVSVLIGLFTSFH 248

Query: 236 FDTPSGPSIIITSLFLFILS 255
           FD   G  I++ ++ + +LS
Sbjct: 249 FDLAPGGVIVMINVCILLLS 268


>gi|317154365|ref|YP_004122413.1| ABC-3 protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944616|gb|ADU63667.1| ABC-3 protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 266

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 137/264 (51%), Gaps = 14/264 (5%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPL------ 57
           EF   AL +G+   L  G +G  ++  RI +    IAH++  GV L+  F LP+      
Sbjct: 7   EFMRNALMAGLLASLICGIIGTLVVVNRIVFISGGIAHASYGGVGLAFFFGLPVLPVTTG 66

Query: 58  -TICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFL 116
            T+C    A L +LV L+ ++     +D ++GV   + ++L +++L      N DL S+L
Sbjct: 67  FTLCA---ALLMALVTLRARER----ADTVIGVTWAAGMALGVILLDLSPGYNVDLMSYL 119

Query: 117 FGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMI 176
           FG ILAV  +D+ ++ G+  L   ++   ++  L  + + E A++ G+  + +  + I +
Sbjct: 120 FGSILAVPRSDLWIMAGLACLVTGLVLAFYRGFLVMSFDEEFARSRGVPVDMLYCLLISM 179

Query: 177 TSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF 236
             L + + I+ +G+ L+ +LL +P   A R + S   M +L+ ++  L  ++GL  S + 
Sbjct: 180 VGLSVVMIIRVVGLILVIALLTIPPFIAERRTRSLGAMMVLSALLSALFTVVGLAVSYLA 239

Query: 237 DTPSGPSIIITSLFLFILSFFYKK 260
           D  SG SII  +   F LSF   +
Sbjct: 240 DITSGASIIAVASVGFFLSFLLPQ 263


>gi|251778725|ref|ZP_04821645.1| putative metal ion ABC transporter, permease protein [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
 gi|243083040|gb|EES48930.1| putative metal ion ABC transporter, permease protein [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
          Length = 264

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A  +GI + +    +G FI+ +R +  GDT++HS+  GVA+ L+      I  F+
Sbjct: 5   SFMQNAFMAGIIVAILCPFIGLFIVLRRNSMIGDTLSHSSFAGVAIGLVIGTNPIITAFL 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             +L ++++  ++      S+ ++ ++   ++ +A++++S  K V   + SFLFG IL V
Sbjct: 65  FTSLCAIIIEFLRDYYKKYSELVMSIVLTLSLGIAIILVSSGKAV-AKVDSFLFGSILTV 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DILLI  IG + I++L  I+  L+  T +   AK  G+  + I  IF ++    IS+
Sbjct: 124 TRSDILLIALIGTVCIILLLIIYNKLIYVTFDESGAKTVGINVKLINYIFTLLVGATISL 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +++S++++P  TA +         I + I G++ +I+GL  S   ++  G +
Sbjct: 184 SIQIMGILVVSSIMVVPVATAMQLKKGFNKTLIFSIIFGLIDVILGLVLSYYLNSAPGGT 243

Query: 244 IIITSLFLFILSFFY 258
           I +TS+ + +L+  +
Sbjct: 244 IALTSVIMLVLTLIF 258


>gi|29375188|ref|NP_814341.1| cation ABC transporter, permease protein [Enterococcus faecalis
           V583]
 gi|255973658|ref|ZP_05424244.1| manganese transport system membrane protein [Enterococcus faecalis
           T2]
 gi|257085938|ref|ZP_05580299.1| manganese transport system membrane protein [Enterococcus faecalis
           D6]
 gi|21693350|gb|AAM75297.1|AF454824_94 EF0094 [Enterococcus faecalis]
 gi|29342647|gb|AAO80412.1| cation ABC transporter, permease protein [Enterococcus faecalis
           V583]
 gi|255966530|gb|EET97152.1| manganese transport system membrane protein [Enterococcus faecalis
           T2]
 gi|256993968|gb|EEU81270.1| manganese transport system membrane protein [Enterococcus faecalis
           D6]
          Length = 280

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 140/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 13  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 73  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 132 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAMGMNVNFYHYLLMVLLTLVAVT 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 192 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 251

Query: 244 IIITSLFLFILSF 256
           I++T+  LF++SF
Sbjct: 252 IVLTAASLFVISF 264


>gi|312135870|ref|YP_004003208.1| abc-3 protein [Caldicellulosiruptor owensensis OL]
 gi|311775921|gb|ADQ05408.1| ABC-3 protein [Caldicellulosiruptor owensensis OL]
          Length = 271

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 137/254 (53%), Gaps = 5/254 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RA  +G+ + + T   G F++ +R +  GD+++H+A++GVA SL+F    TI    
Sbjct: 5   EFMQRAFLAGVLVSIMTSLAGNFLVLKRFSQMGDSLSHTAIVGVAASLLFNFSPTIGAIF 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L +   +       +  L +++ + + LA V+   +K  +++L SFLFG I+ +
Sbjct: 65  STVAFALAIEYFKSRFKRFEEVSLALVSITALGLASVLFGILKS-SSNLMSFLFGSIVTI 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+L+I  +  + +  +    K L+  T +   AK  G+  + +  +  ++++ +I+V
Sbjct: 124 GNEDVLIILAVCLVTVTFIAMFRKKLILATFDEVSAKVSGINTKLLDFLLSIVSATIIAV 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SIK +G  LI+SL++ PT  A RFS + + + + +  + ++ II GL  S   D P G +
Sbjct: 184 SIKIVGGLLISSLIVFPTAIAMRFSKNFKMLQVGSLSVSLIAIISGLTSSYYIDIPPGGA 243

Query: 244 IIITSLFLFILSFF 257
            ++    +F+L FF
Sbjct: 244 TVL----IFVLIFF 253


>gi|308068901|ref|YP_003870506.1| manganese/zinc ABC transporter permease [Paenibacillus polymyxa
           E681]
 gi|305858180|gb|ADM69968.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Paenibacillus polymyxa E681]
          Length = 281

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 140/260 (53%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           ++ +F  RA  +G  I L    LG +++ +R A   D ++H +L GVA      +  TI 
Sbjct: 4   LHYDFMQRAFCAGGVIALLASVLGVYLMLRRQALMADMLSHVSLAGVAAGAYLGINPTIT 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F++A + ++++  ++++    S+  + +I    +S A+++++  + +N   +++LFG +
Sbjct: 64  GFIVAVIGAIIVEYVRRSYKTYSEISVAIIMVGGLSTAVILMNLNQSINKGFSAYLFGSV 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +AVN T+++L+  +  +  +  F   +PL   T + E AK  G+  + I   F ++T ++
Sbjct: 124 VAVNQTELMLMIVVAVIGGIFFFVFRRPLYQITFDEETAKTNGLPVKSISFAFSILTGMI 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++ ++  +G+ L++SL++LP   A R + S      ++ +  ++G+ +GL  S    TP 
Sbjct: 184 VAAAMPIVGVLLVSSLIVLPAALAIRIAPSFAAAIWISMVTALIGVFMGLTASYELSTPP 243

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +I +  L   I+    +K
Sbjct: 244 GGTIAMVLLLFLIVGAGIQK 263


>gi|227517532|ref|ZP_03947581.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227554654|ref|ZP_03984701.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|307274242|ref|ZP_07555447.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|307278332|ref|ZP_07559411.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|227075004|gb|EEI12967.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227176227|gb|EEI57199.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|306505083|gb|EFM74274.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|306509067|gb|EFM78132.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|315025640|gb|EFT37572.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2137]
 gi|315168480|gb|EFU12497.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1341]
          Length = 292

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 140/253 (55%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   +
Sbjct: 25  HFLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIV 84

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV
Sbjct: 85  FGLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVANS-STDLFHILFGNILAV 143

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   
Sbjct: 144 QDIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAMGMNVNFYHYLLMVLLTLVAVT 203

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G S
Sbjct: 204 AMQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSS 263

Query: 244 IIITSLFLFILSF 256
           I++T+  LF++SF
Sbjct: 264 IVLTAASLFVISF 276


>gi|33867009|ref|NP_898568.1| ABC transporter [Synechococcus sp. WH 8102]
 gi|33639610|emb|CAE08994.1| ABC transporter component, possibly Zn transport [Synechococcus sp.
           WH 8102]
          Length = 276

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 151/264 (57%), Gaps = 7/264 (2%)

Query: 1   MYNEFFI-RALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI 59
           +++E FI RAL  G       G +G F + +++A+F D + HSALLG+ L ++  +  T 
Sbjct: 10  LFDEPFIHRALIGGFLTGSLGGLIGYFAVLRQLAFFSDALGHSALLGITLGILLNVNPTF 69

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGD 119
            +   A + + ++  + ++ +L +DA+L ++  S+++ A++ LS +   +  +   LFGD
Sbjct: 70  VLIPFAIIFAFLVNNLVESSSLPTDALLNIVYSSSLAAAVLALSKINSYSGSIKQLLFGD 129

Query: 120 ILAVNTTDI---LLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMI 176
           IL +  +DI   L+++ + F  I ++F +   +L  T+N +LA + G+     KL FI++
Sbjct: 130 ILGITASDIYITLILFIVSF--IYLVFSLRSHVL-LTLNEDLAGSIGINTRFHKLAFIIL 186

Query: 177 TSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF 236
             +++SVSIK +G+ LI++ +++P    R  S    +  + + ++G L  + GL  S  F
Sbjct: 187 LGIVVSVSIKSVGVLLISAFVVIPACAGRLISRKFSSYIVFSMVLGGLCALFGLILSGFF 246

Query: 237 DTPSGPSIIITSLFLFILSFFYKK 260
           + PSGPSI+I   F F+ S  + +
Sbjct: 247 NLPSGPSIVILQFFAFLFSLIFSR 270


>gi|50842982|ref|YP_056209.1| ABC transporter ATP-binding protein [Propionibacterium acnes
           KPA171202]
 gi|50840584|gb|AAT83251.1| ABC transporter ATP-binding protein [Propionibacterium acnes
           KPA171202]
 gi|313813369|gb|EFS51083.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL025PA1]
          Length = 312

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 133/250 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   +
Sbjct: 17  SFLPKALLVAVVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSI 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  +
Sbjct: 77  AGLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGI 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +
Sbjct: 137 TDDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVI 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +
Sbjct: 197 SVQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGT 256

Query: 244 IIITSLFLFI 253
           I++ +  +F+
Sbjct: 257 IVLVATAVFL 266


>gi|296111109|ref|YP_003621490.1| manganese ABC transporter, permease protein [Leuconostoc kimchii
           IMSNU 11154]
 gi|295832640|gb|ADG40521.1| manganese ABC transporter, permease protein [Leuconostoc kimchii
           IMSNU 11154]
          Length = 281

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 145/261 (55%), Gaps = 5/261 (1%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + + 
Sbjct: 12  MQYNFLQTALITSILVGIMSGIIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINILLG 71

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L +L++  +     L +D  +G++  +  +L  +++S  +   T+L   LFG++
Sbjct: 72  ASVFGILAALLIGLVTLKSKLKNDTAIGIVFSAFFALGFILISLAESA-TNLHHILFGNV 130

Query: 121 LAVNTTDILLIWGIGFLNIMILFKI--WKPLLATTVNYELAKAEGMQPEKIKLIFIMITS 178
           LAV+  D  LI     L I+++F +  +K LL T+ +   AKA G++ + +    +++ +
Sbjct: 131 LAVSDND--LITTAIVLAIVLIFVVVFYKELLITSFDNTFAKAYGLKTQLMHYALMLVLT 188

Query: 179 LMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDT 238
           L+   +++ +GI LI ++LI P  TA   +    +M I+A I  ++  +IGLY S  F+ 
Sbjct: 189 LVTVTALQTVGIILIVAMLITPAATAYLLTNRLSHMMIVAAIFSVISSVIGLYMSYTFNW 248

Query: 239 PSGPSIIITSLFLFILSFFYK 259
            SGP+I++T+   F L+F + 
Sbjct: 249 ASGPAIVLTAAVFFSLAFLFS 269


>gi|154508220|ref|ZP_02043862.1| hypothetical protein ACTODO_00714 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797854|gb|EDN80274.1| hypothetical protein ACTODO_00714 [Actinomyces odontolyticus ATCC
           17982]
          Length = 304

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 131/257 (50%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L +   +
Sbjct: 34  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVLGGAL 93

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 94  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 153

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   + ++A T++ E A+A G+      L   +  +L + +
Sbjct: 154 PASDVPVVLAGALFVLLMLFLAHRAIVAVTLDRESARAAGVHVLLADLSLYVAVALAVVI 213

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 214 SVQTIGNVLVLALLVTPAATARLLCDRLGTMLILSPALGASGGLVGLYLSWALDVPTGAT 273

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+L++ +  
Sbjct: 274 IVLVLTACFVLAWVFAP 290


>gi|323490083|ref|ZP_08095304.1| metal transport system membrane protein [Planococcus donghaensis
           MPA1U2]
 gi|323396379|gb|EGA89204.1| metal transport system membrane protein [Planococcus donghaensis
           MPA1U2]
          Length = 284

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 143/265 (53%), Gaps = 8/265 (3%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSL-----IFQLPLT 58
           EF   A  +G+ I +    LG FI+ +R++   D ++H  L G+A SL     +  L L 
Sbjct: 9   EFLQNAFAAGLIIGVIAPLLGVFIVVRRLSLIADALSHVTLAGIAGSLYLSQSVASLALL 68

Query: 59  ICIFM---IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSF 115
             +F+    +   S+++ +++       +  + +I  + I    + +S  +  ++DL  +
Sbjct: 69  NPLFLGIAASVGGSMLIERLRSLYKHYQELAIPIILSAGIGFGAIFISLAEGFSSDLFGY 128

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           LFG + AV+  D+ ++ G+  + +  +F  +K L   + + E A+A G+  + I  +F++
Sbjct: 129 LFGSVSAVSREDLFIVVGVAVIVLAFVFIFFKELFVLSFDDEYARASGLPAKWIHFMFMI 188

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           +T+L+I+ S++ +GI L++SL+ +P  TA R + S +    L+ + G + +I GL  +  
Sbjct: 189 VTALVIAGSMRIVGILLVSSLMTIPVATAMRVTKSFKQTIFLSIVFGEISVITGLVSAFY 248

Query: 236 FDTPSGPSIIITSLFLFILSFFYKK 260
            D   G +I++TS+FL +L   YKK
Sbjct: 249 LDLAPGGTIVVTSIFLLLLVLAYKK 273


>gi|257082165|ref|ZP_05576526.1| ABC transporter, permease [Enterococcus faecalis E1Sol]
 gi|256990195|gb|EEU77497.1| ABC transporter, permease [Enterococcus faecalis E1Sol]
          Length = 289

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 133/244 (54%), Gaps = 1/244 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + + + L +G +G FII + ++  GD I+H+ L GVA+S IF         +
Sbjct: 13  QFLQNALLTSVIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYIFGFNYIFGASI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LAV
Sbjct: 73  FGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAKS-STDLYHILFGNVLAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+   
Sbjct: 132 ADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAVS 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG +
Sbjct: 192 SLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGAT 251

Query: 244 IIIT 247
           I++T
Sbjct: 252 IVLT 255


>gi|300869162|ref|ZP_07113758.1| permease protein of ABC transporter [Oscillatoria sp. PCC 6506]
 gi|300332811|emb|CBN58956.1| permease protein of ABC transporter [Oscillatoria sp. PCC 6506]
          Length = 280

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 133/243 (54%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A+ +GI + +    +G ++I Q++    + IAHS L G+ ++ +F + ++I  F+
Sbjct: 12  EFMRNAIATGILLGILCAVVGSYLIVQQMGMIVEMIAHSVLPGLPIAFVFGISISIGAFI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              ++++++  IQ    L  DA++ +I  + ++L++ ++S +K    DL  FLFG+IL+V
Sbjct: 72  SGVISAVIMAWIQSQSRLKIDAVMALILSTFLALSVALISLLKTTKLDLQGFLFGNILSV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+   + I  + ++++   +K LL  T +   A+A G+    I    I   +L I  
Sbjct: 132 SPADVQHTFAITVIVLILVKLFYKELLFYTFDRMGAQASGLPVNLIYFGMIAAITLTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ S+LI P +TA         M +L  I+G    +IG+Y S   + PSGP 
Sbjct: 192 SLQTVGALLVISMLIGPGITAYLLVKELHLMMVLGAILGSFASVIGMYFSYHLNVPSGPG 251

Query: 244 III 246
           I++
Sbjct: 252 IVL 254


>gi|254519470|ref|ZP_05131526.1| ABC-3 protein [Clostridium sp. 7_2_43FAA]
 gi|226913219|gb|EEH98420.1| ABC-3 protein [Clostridium sp. 7_2_43FAA]
          Length = 265

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 143/251 (56%), Gaps = 1/251 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   A  +G  I +    +G F++ +R +  GDT++HS+  GVA+ L+  +   I  F+
Sbjct: 5   DFMQNAFMAGFIISILCPFIGLFLVLRRYSMIGDTLSHSSFAGVAIGLVLGVNPLITAFL 64

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             TL ++++  +++     ++ ++ ++   ++ +A++++S  K  +  + SFLFG IL V
Sbjct: 65  FTTLCAIIIELLREYYKKYAELVMSLVLTFSLGIAIILISSGK-ASAKVNSFLFGSILTV 123

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +T DI +I  +G + ++ L  ++  L+  T + E AK  G++ + I  IF ++    IS+
Sbjct: 124 STQDIFMILIVGIICLIALIFLYNKLIYITFDEEGAKTAGIKVKLINYIFTILVGATISM 183

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +GI +I+S++I+P  TA +     +   + +   G+  I++GL+ S   ++  G +
Sbjct: 184 SIRIMGILVISSIMIVPVATAMQLKKGFKTTLLYSIFFGMFDILMGLFLSYYINSAPGGT 243

Query: 244 IIITSLFLFIL 254
           I ITS+F  I+
Sbjct: 244 IAITSVFTLII 254


>gi|241895128|ref|ZP_04782424.1| manganese ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
 gi|241871624|gb|EER75375.1| manganese ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
          Length = 2