BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter,
permease protein [Candidatus Liberibacter asiaticus str. psy62]
         (260 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|172039974|ref|YP_001799688.1| putative ABC transport system, permease protein [Corynebacterium
           urealyticum DSM 7109]
 gi|171851278|emb|CAQ04254.1| putative ABC transport system, permease protein [Corynebacterium
           urealyticum DSM 7109]
          Length = 732

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 135/255 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL   +   +  G +G  +  + +A+ GD +AH+   G+A++   Q+ + +   + 
Sbjct: 22  FLPNALMIAVLGAVICGVVGTHVTLRGMAFLGDAVAHAVFPGLAIAFALQVSVLLGGAVA 81

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             + +L++    +   +  D ++G+   ++ +L LVI++ ++     LTSFLFG I  V 
Sbjct: 82  GVVIALLIAVFSQRRRVKEDTVIGIFFAASFALGLVIIAQIEGYTASLTSFLFGSITGVA 141

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI ++   G + + +L+     L+A +++ E A+A G+    + ++  +  ++ + +S
Sbjct: 142 RSDIYIVVLGGAVIMAVLWLFHSRLVAVSLDRETARAMGLNVLALDMLLYVCVTMAVVMS 201

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+ +LLI P  TAR  +     M  ++ +IG +G ++G+Y S   D P+G +I
Sbjct: 202 VRTVGNILVLALLITPAATARLLTERVVTMMWVSALIGAVGAVLGVYISWAADVPTGATI 261

Query: 245 IITSLFLFILSFFYK 259
           ++    +FI SF   
Sbjct: 262 VLVLTAMFIFSFLVS 276


>gi|300932748|ref|ZP_07148004.1| putative ABC transport system, permease protein [Corynebacterium
           resistens DSM 45100]
          Length = 724

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 134/253 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +G  ++ + +A+ GD +AH+   G+A++   Q  + +   +
Sbjct: 17  AFLPKALLVAVLSAVVCGVVGAHVVLRGMAFIGDAVAHAVFPGLAIAFALQASVVLGGAV 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++++    +   +  D I+G+   +  +  LV++S ++     LTSFLFG I  V
Sbjct: 77  AGIVVAVLIAVFSQRRRIKEDTIIGIFFAAAFAAGLVVISKVQGYTASLTSFLFGSITGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T DI+L+  +G + I +L    K L+A +++ E A A+ ++     L+  +  +  + +
Sbjct: 137 ATEDIVLVAVVGTVVIALLLVFHKELVAVSLDRETAAAQNIRVFAFDLLLYLAVTAAVVM 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ +LL+ P  TAR  +     M  L+ +IG +  ++G+Y S  FD P+G  
Sbjct: 197 SVRTVGNILVLALLVTPAATARLLTDRLPIMMALSAVIGAVASVLGVYLSWAFDVPTGAM 256

Query: 244 IIITSLFLFILSF 256
           I++    LF+++F
Sbjct: 257 IVLVVTALFLIAF 269


>gi|325569329|ref|ZP_08145485.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Enterococcus casseliflavus ATCC 12755]
 gi|325157329|gb|EGC69490.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Enterococcus casseliflavus ATCC 12755]
          Length = 585

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +     
Sbjct: 14  FLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIFF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV 
Sbjct: 74  GILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   +
Sbjct: 133 DSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LL+ P  TA  ++   ++M I+A ++G L   IGL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLVTPAATAYLYTKQLKHMMIIAGVLGGLASFIGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+   F++ F + 
Sbjct: 253 VLTAGAFFVIGFLFS 267


>gi|257875144|ref|ZP_05654797.1| ABC transporter, substrate binding lipoprotein [Enterococcus
           casseliflavus EC20]
 gi|257809310|gb|EEV38130.1| ABC transporter, substrate binding lipoprotein [Enterococcus
           casseliflavus EC20]
          Length = 585

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +     
Sbjct: 14  FLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIFF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV 
Sbjct: 74  GILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   +
Sbjct: 133 DSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LL+ P  TA  ++   ++M ++A ++G     IGL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLVTPAATAYLYTKQLKHMMVIAGVLGGFASFIGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+   F++ F + 
Sbjct: 253 VLTAGAFFVIGFLFS 267


>gi|257865528|ref|ZP_05645181.1| ABC transporter [Enterococcus casseliflavus EC30]
 gi|257871865|ref|ZP_05651518.1| ABC transporter [Enterococcus casseliflavus EC10]
 gi|257799462|gb|EEV28514.1| ABC transporter [Enterococcus casseliflavus EC30]
 gi|257806029|gb|EEV34851.1| ABC transporter [Enterococcus casseliflavus EC10]
          Length = 585

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS IF +   +     
Sbjct: 14  FLQNALITAVAIGIVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYIFGVHFFVGAIFF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV 
Sbjct: 74  GILASMIITYIANNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D  L   I  L + ++   ++PLL T+ +  +AKA GM+ +    + + + +L+   +
Sbjct: 133 DSDKWLTIAIAILVLAVIILFFRPLLITSFDPMMAKAFGMKVQAYHYLLMFLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LL+ P  TA  ++   ++M ++A ++G     IGL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLVTPAATAYLYTKQLKHMMVIAGVLGGFASFIGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+   F++ F + 
Sbjct: 253 VLTAGAFFVIGFLFS 267


>gi|257868857|ref|ZP_05648510.1| cation ABC transporter [Enterococcus gallinarum EG2]
 gi|257803021|gb|EEV31843.1| cation ABC transporter [Enterococcus gallinarum EG2]
          Length = 585

 Score =  181 bits (459), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 139/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I +  G +GCFII + ++  GD I+H+ L GVALS I  +   +     
Sbjct: 14  FLQNALITAVAIGVVAGVIGCFIILRGMSLMGDAISHAVLPGVALSYILGVNFFVGAIFF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I  N  + SD  +G+   S ++L ++++      +TDL   LFG++LAV 
Sbjct: 74  GVLASIIITYISNNSLIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNVLAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +   I  L I ++   ++PLL T+ +  +AKA GM  +    + +++ +L+   +
Sbjct: 133 EGDKWVTIAIALLVIALIMIFFRPLLITSFDPMMAKAFGMNVQVYHYLLMLLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LL+ P  TA  F+    +M ++A I+G    +IGL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLVTPAATAYLFTKRLSHMMVIAGILGGASSVIGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+  LF+L F + 
Sbjct: 253 VLTAAILFVLGFLFS 267


>gi|313903882|ref|ZP_07837271.1| ABC-3 protein [Thermaerobacter subterraneus DSM 13965]
 gi|313466070|gb|EFR61595.1| ABC-3 protein [Thermaerobacter subterraneus DSM 13965]
          Length = 631

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 62/255 (24%), Positives = 131/255 (51%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F +RAL +G+ + ++    G F++ +R +  GD I+H+ L GVA++ +   P      
Sbjct: 17  YPFMVRALAAGVLVAVAGAVTGSFLLVRRWSLLGDAISHAVLPGVAVAYLLGWPYFTGAL 76

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
             A LT+  +  +++N  L SDA  G++     +L L ILS  +  + D+   LFG++L 
Sbjct: 77  ASALLTAAGIGFLERNTRLKSDAATGLLFLGAFALGLAILSRAR-SSVDVFHILFGNVLG 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D++L+  +  +   ++  ++K L     +   A+  G+    +  + +++ S  + 
Sbjct: 136 VSRADLVLMAVVAAVAAGLVALLFKELQLWAFDPVTAEVAGLPVRALHYLMMVLVSATLV 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L  ++L+ P  TA         +  LA ++G +  + GLY S   D  SGP
Sbjct: 196 AALQAVGVVLALAMLVTPPATAYLLVRRFPALIGLAVVLGTVAAVTGLYLSFYLDVASGP 255

Query: 243 SIIITSLFLFILSFF 257
           ++++ ++  F+++  
Sbjct: 256 AMVLVAMAGFVVALV 270


>gi|317122779|ref|YP_004102782.1| ABC transporter [Thermaerobacter marianensis DSM 12885]
 gi|315592759|gb|ADU52055.1| ABC-3 protein [Thermaerobacter marianensis DSM 12885]
          Length = 639

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 63/255 (24%), Positives = 130/255 (50%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F +RAL +G+ + ++    G F++ +R +  GD I+H+ L GVA++ +F  P      
Sbjct: 17  YPFMVRALLAGVLVAVAGAVTGSFLLVRRWSLLGDAISHAVLPGVAIAYLFGWPYFTGAL 76

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
             A LT+  +  +++N  L SDA  G++     +  L ILS  +  + D+   LFG++L 
Sbjct: 77  ATALLTAAGIGFVERNTRLKSDAATGLLFLGAFAAGLAILSRAR-SSVDVFHILFGNVLG 135

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++L+  +       +  ++K L     +   A+  G+    +  + +++ S  + 
Sbjct: 136 VARADLVLMAVVAAAVAGFVLLLFKELQLWAFDPLTAEVAGLPTRALHYLMMLLVSATLV 195

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L  ++L+ P  TA   +     M +LA  +GI+  + GLY S   +  SGP
Sbjct: 196 AALQAVGVVLALAMLVTPPATAYLLTRRFPAMILLAVGLGIVAAVTGLYLSFYLNVASGP 255

Query: 243 SIIITSLFLFILSFF 257
           ++++ ++  F+++  
Sbjct: 256 AMVLVAMAGFVMALV 270


>gi|172040205|ref|YP_001799919.1| ABC transport system, permease protein [Corynebacterium urealyticum
           DSM 7109]
 gi|171851509|emb|CAQ04485.1| ABC transport system, permease protein [Corynebacterium urealyticum
           DSM 7109]
          Length = 562

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 60/232 (25%), Positives = 123/232 (53%), Gaps = 1/232 (0%)

Query: 18  LSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQK 77
           ++ G +G FI+ + +A  GD I+H+ L GVA S +    L +   +   L +L +  I +
Sbjct: 1   MACGIVGSFIVLRGMALIGDAISHAVLPGVAASYLLGTNLFLGAVVAGLLATLAIGLISE 60

Query: 78  NEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFL 137
              + +D+ +G++  +  ++ +++++  +   TDLT  LFG++L V   D  L  GI   
Sbjct: 61  RSTVKNDSAIGIVFSTFFAIGVLLMAKAQ-TATDLTEILFGNVLTVQDADRNLSIGIAAA 119

Query: 138 NIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLL 197
            +++    +K L  +T +  +A++ G+    I    +++ +L+  +S++ +G+ L+ SLL
Sbjct: 120 VLILTLVFYKELKLSTFDPMMAQSAGVPVRAIHYGLMVVLTLVTVISLQTVGVILVVSLL 179

Query: 198 ILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSL 249
           I P   A   +     M  L+  I  L  ++GL+ S  ++  SG +I++T+ 
Sbjct: 180 ITPASAAYLLTNRLGVMIGLSVAISALSSVVGLFLSYSYNVSSGVTIVLTAS 231


>gi|256617487|ref|ZP_05474333.1| manganese ABC transporter substrate-binding lipoprotein
           [Enterococcus faecalis ATCC 4200]
 gi|256597014|gb|EEU16190.1| manganese ABC transporter substrate-binding lipoprotein
           [Enterococcus faecalis ATCC 4200]
          Length = 552

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/225 (29%), Positives = 123/225 (54%), Gaps = 1/225 (0%)

Query: 35  FGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHST 94
            GD I+H+ L GVA+S I  +   I   +   L S+++  I+ N  +  D  +G+   S 
Sbjct: 1   MGDAISHAVLPGVAISYILGINFFIGAIVFGLLASIIITFIKSNSVIKGDTAIGITFSSF 60

Query: 95  ISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTV 154
           ++L ++++      +TDL   LFG+ILAV   D  +  G+  L ++I+   +K LL T+ 
Sbjct: 61  LALGVILIGVAN-SSTDLFHILFGNILAVQDIDKWITIGVSVLVLVIVVLFFKELLITSF 119

Query: 155 NYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENM 214
           +  +AKA GM       + +++ +L+   +++ +G  LI ++LI P  TA  ++ S + M
Sbjct: 120 DPLMAKAIGMNVSFYHYLLMVLLTLVAVTAMQSVGTILIVAMLITPAATAYLYANSLKTM 179

Query: 215 AILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
             ++  +G    ++GL+    F+  +G SI++T+ FLF++SF   
Sbjct: 180 IFISATVGASSSLLGLFIGYSFNIAAGSSIVLTAAFLFVISFLIS 224


>gi|209528140|ref|ZP_03276614.1| ABC-3 protein [Arthrospira maxima CS-328]
 gi|209491428|gb|EDZ91809.1| ABC-3 protein [Arthrospira maxima CS-328]
          Length = 347

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 146/260 (56%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ I    + + 
Sbjct: 60  LQYGFMQRSLTIAILVGLICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFILGFNIFVG 119

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+    +++++  I+ +  +  DA +G++     +L + +++ ++  N  DL  FLFG+
Sbjct: 120 AFIAGVFSTVLIEIIRTHSKIKEDAAMGIVFSGFFALGITLITIIQKDNKIDLNHFLFGN 179

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V  +D+     I  + ++++F I+K LL  T + + A+A G+    + L  +M+ SL
Sbjct: 180 ILGVTASDVRDTMIIAAIVLLVVFLIYKELLFYTFDPQGAEAAGLPVNLLNLGLMMLISL 239

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P+ TA        N+ IL  +IG+   + G+Y S  ++ P
Sbjct: 240 TIVASLKAVGVILVLSLLITPSATAYLLVNRLHNVMILGVLIGVGSSMSGMYLSYFYNLP 299

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+++F + 
Sbjct: 300 SGPAIVLVASGLFLMAFLFS 319


>gi|284030399|ref|YP_003380330.1| ABC-3 protein [Kribbella flavida DSM 17836]
 gi|283809692|gb|ADB31531.1| ABC-3 protein [Kribbella flavida DSM 17836]
          Length = 334

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 134/254 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RAL +G+   LS   +G +++ +R++  GD I H A+ GVAL L+      +   +
Sbjct: 7   EFMQRALIAGLLTGLSAPAIGTYLVQRRLSLMGDGIGHIAITGVALGLLTGTAPALTAIL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +A   +  +  I+     S D  L ++ +  I+  ++++         L ++LFG +  V
Sbjct: 67  VAIAGATAIELIRARGKASGDVALALLFYGGIAGGVLLIGLAGQGAATLNTYLFGSLTTV 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+ ++ G+  + +++   +   L A   + E A+  G++ + + L+  ++ ++ ++V
Sbjct: 127 SPSDLYVVVGLAVVVLVVAVGLGPQLFAVCQDEEFARVTGLRVQLLNLLIAVMAAVTVTV 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+++L+++P  TA++ + S     + A  IG+   + G+  S   D   G +
Sbjct: 187 AMRTVGLLLVSALMVVPVATAQQLTRSFRTTFMTACGIGVFACLAGIVTSYHADVAPGAT 246

Query: 244 IIITSLFLFILSFF 257
           I++ +L  F+++  
Sbjct: 247 IVVLALACFVVAAV 260


>gi|254444794|ref|ZP_05058270.1| ABC 3 transport family [Verrucomicrobiae bacterium DG1235]
 gi|198259102|gb|EDY83410.1| ABC 3 transport family [Verrucomicrobiae bacterium DG1235]
          Length = 512

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/269 (22%), Positives = 140/269 (52%), Gaps = 10/269 (3%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP---- 56
           M +     AL   + + +S G LG FI+ ++++ FGDT++H+ L GVA+  +        
Sbjct: 65  MKDAVVRTALLGSVFLGISCGLLGSFIVVRKLSLFGDTLSHAVLPGVAIGYLVAGQKDPV 124

Query: 57  -LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTD 111
            + I   +   L ++++  I+K   +  D+ LG++      + +V+++ ++       + 
Sbjct: 125 AIFIGATVAGVLGTVMVNLIKKTTHIKEDSSLGMVLAGFYGIGIVLMNRIQKLPTGTQSG 184

Query: 112 LTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKL 171
           +  FLFG   A+++ ++ +I G+    ++++   ++  L  + +   AKA G+       
Sbjct: 185 VDKFLFGQAAALSSVEVWMIGGVALAAVVLVLVFYRQFLIGSFDIGFAKAMGLPAGLFHY 244

Query: 172 IFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLY 231
           + +M+ +  + VS++ +G  L++++L++P  +A   +     M ILA++ GI   ++G +
Sbjct: 245 LLMMLLAFTVVVSLQAVGAVLVSAMLVIPAASAYLLTERMHRMLILASVFGIFSGVLGAF 304

Query: 232 GSLIFD-TPSGPSIIITSLFLFILSFFYK 259
            S + +  P+GP +++ +  +F L F + 
Sbjct: 305 FSFLGNSLPTGPLMVLAASSVFTLCFLFS 333


>gi|312868111|ref|ZP_07728315.1| ABC transporter, ATP-binding protein [Streptococcus parasanguinis
           F0405]
 gi|311096515|gb|EFQ54755.1| ABC transporter, ATP-binding protein [Streptococcus parasanguinis
           F0405]
          Length = 499

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 125/243 (51%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F  RAL + + + L +  LG F+I +R +   DT++H +L GVA  L   +  T+  
Sbjct: 238 QYDFMQRALLAMVAMSLFSPVLGIFLILRRQSLMSDTLSHVSLAGVAFGLFLGISPTLST 297

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +I  + ++ L  ++       +    ++  + ++LALV++      +  L  +LFG  L
Sbjct: 298 MIIVIIAAVFLEYLRTLFKDFMEIGTAILMSTGLALALVLMRGGGKSSMSLDQYLFGSTL 357

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +    ++ ++ I F+ +++     +P+   T + + A  +G+    + ++F ++T + I
Sbjct: 358 TITDEQVIALFVIAFVVLVLTALFLRPMYILTFDEDTAFVDGLPVRTMSILFNVVTGVAI 417

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++ I   G  L++++++LP   A +   +   + ++A IIG +G+  GL  S I DTP+ 
Sbjct: 418 ALMIPAAGSLLVSTIMVLPASIALKLGKNFRGVMLIAVIIGFIGMFSGLILSYIADTPAS 477

Query: 242 PSI 244
            SI
Sbjct: 478 ASI 480


>gi|163759796|ref|ZP_02166880.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Hoeflea phototrophica DFL-43]
 gi|162282754|gb|EDQ33041.1| probable high-affinity zinc uptake system membrane abc transporter
           protein [Hoeflea phototrophica DFL-43]
          Length = 295

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 130/257 (50%), Positives = 195/257 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RA+ +GIG+ L  GPLGCFI+W+R+AYFGDT++H+ALLGVAL+ +F++ +T+ 
Sbjct: 13  MLDDFFTRAVLAGIGVALVAGPLGCFIVWRRLAYFGDTLSHAALLGVALAFLFEINITLA 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F ++   S+ LL +QK   LSSDA+LG++ HS ++L LV+L+FM WV  DL  FLFGDI
Sbjct: 73  VFAVSACVSIALLLLQKRATLSSDALLGLLAHSALALGLVVLAFMTWVRMDLMGFLFGDI 132

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IW  G + ++IL  IW+P  A TVN ELA+AE M P++  +IF+++ + +
Sbjct: 133 LAVSRIDVGIIWLGGAIVLVILALIWRPFFAATVNRELAEAENMNPDRANIIFMLLMAAV 192

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++S+K +G+ LIT++LI+P   ARRF++ PE MAILA +IG   ++ GL+GSL +DTP+
Sbjct: 193 IAISMKIVGVLLITAMLIIPAAAARRFASGPEQMAILAAVIGAASVVGGLFGSLEWDTPA 252

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LF+LS  
Sbjct: 253 GPSIVVAALGLFVLSIL 269


>gi|293396385|ref|ZP_06640663.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Serratia odorifera DSM 4582]
 gi|291421174|gb|EFE94425.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Serratia odorifera DSM 4582]
          Length = 293

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F
Sbjct: 14  YPFMQRAIVAAIVTGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFVLGIPLAIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +L    +++N  +  D ++G++     +  LV+ S +   +  L+  LFG++L 
Sbjct: 74  LSGIFCALATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRV-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++     I  + + ++    + L+    +   A+  G+  + +    + + ++ I 
Sbjct: 133 ITDGELKQTLLIAGITLAVVLLKRQDLMLYCFDPSHARVIGLPVKLLHYGLLCLLAMTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ +   ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFLLCRSFDRMLLVATVVSVFSCVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I    LF+++  Y +
Sbjct: 253 CIVIVQAVLFVIALLYSR 270


>gi|317125248|ref|YP_004099360.1| ABC transporter [Intrasporangium calvum DSM 43043]
 gi|315589336|gb|ADU48633.1| ABC-3 protein [Intrasporangium calvum DSM 43043]
          Length = 334

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 60/252 (23%), Positives = 133/252 (52%), Gaps = 1/252 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RA+ + + +      +G F++ +R++  GD + H AL GVA+ ++      +   +
Sbjct: 8   DFMQRAILAALLVGAVAPMVGIFVVQRRMSLIGDGMGHVALAGVAIGVLTHRSPVLTALV 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
            A + ++V+  ++     S D  L +I +  I+  +VI+S        +L  +LFG IL 
Sbjct: 68  AAVIAAVVIEILRARGRTSGDQALAIIFYGGIAAGVVIISKAPDGTPANLMKYLFGSILT 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+++   +  +  +  + +   L A   + E A+A G+    + ++  ++T+  + 
Sbjct: 128 VRQDDLVIFAVLAVVIAVTTWVLRPRLFAVANDEEYARAVGLPVLTLNIVLAVLTATTVV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++++ +G+ LI++L+I+P   A+ F+ S  +    A  +G++  + G+  S   +TPSG 
Sbjct: 188 IAMRIVGLLLISALMIVPNAAAQLFARSFSSGVRWAIALGLVSAVGGVVASYPLNTPSGG 247

Query: 243 SIIITSLFLFIL 254
           +I++ ++ LF+L
Sbjct: 248 TIVLVAIGLFLL 259


>gi|157370370|ref|YP_001478359.1| ABC-3 protein [Serratia proteamaculans 568]
 gi|157322134|gb|ABV41231.1| ABC-3 protein [Serratia proteamaculans 568]
          Length = 286

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+ +  +P+ I  F
Sbjct: 14  YPFMQRAILAAIVTGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFVLGIPVVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
                 ++    +++N  +  D ++G++     +  LV+ S +   +  L+  LFG++L 
Sbjct: 74  FSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRV-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++     +  + ++++    K L+    +   A+  G+  + +    + + +L I 
Sbjct: 133 ITDAELKQTLLMAGITLLVVLLKRKDLMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ +   ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMLCRSFDRMLMVATVVSVFSCVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I    LF+++  Y K
Sbjct: 253 CIVIVQAILFVVALLYSK 270


>gi|320539021|ref|ZP_08038696.1| putative chelated iron ABC transport system membrane protein
           [Serratia symbiotica str. Tucson]
 gi|320030954|gb|EFW12958.1| putative chelated iron ABC transport system membrane protein
           [Serratia symbiotica str. Tucson]
          Length = 286

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 59/258 (22%), Positives = 125/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F
Sbjct: 14  YPFMQRAIIAAIATGVICAVLSCYLVLKGWSLMGDAISHAVLPGMVIAFVLSIPLAIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G++     +  LV+ S +   N  LT  LFGD+L 
Sbjct: 74  LSGIFYAVATGYLKEHSRVKEDTVMGIVFSGMFAFGLVLFSRI-DTNQHLTHILFGDMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++     I    ++I+    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 133 ITDDELKQTLLIAGATLVIMVLKRKDFMLYCFDPHHARVIGLPVKLLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M I+AT++ +   ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMLCRSFDRMLIVATLVSVFSCVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I    LF+++  Y K
Sbjct: 253 CIVIVQAMLFVIALLYSK 270


>gi|311895947|dbj|BAJ28355.1| putative metal ABC transporter permease protein [Kitasatospora
           setae KM-6054]
          Length = 359

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/252 (22%), Positives = 128/252 (50%), Gaps = 1/252 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RA  + + + ++   +G +++ +R A  GD I H AL GV L  +FQ        +
Sbjct: 8   DFMQRAFLAAVLVGVTAPSIGIYLVQRRQALMGDGIGHVALTGVGLGFLFQANPMWTAVL 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLTSFLFGDILA 122
           +  L ++V+  ++       D  L ++ +  ++   +++S         L S+L+G IL 
Sbjct: 68  VCVLGAVVMELVRARGNQRGDIALAMLFYGGMAGGKLLVSMSSQSGAGSLESYLWGSILF 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+ +I  +  + + +   + + L A   + E A+  G+    + L+  ++ ++ ++
Sbjct: 128 VSPGDLAVIGLLAAVVVAVTVGLRRQLFAVCQDEEFARVTGLPVRVLNLLIAVMAAVTVT 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ + S       A  +G++  + G+  S   D PSGP
Sbjct: 188 VAMRVVGLLLVSALMVVPVAAAQQLTRSFAATQATAIGVGVVTALFGVGTSYQADLPSGP 247

Query: 243 SIIITSLFLFIL 254
           +I+  ++  F L
Sbjct: 248 TIVFLAILTFAL 259


>gi|315104198|gb|EFT76174.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL050PA2]
          Length = 312

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALRVAMVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQRSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFAGAFALGIVIISRTPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIIIVCVAGALVLALEWAVHKELVTVGLDRETARASNLPVFALDLLPYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|22125787|ref|NP_669210.1| chelated iron transport system membrane protein [Yersinia pestis
           KIM 10]
 gi|45442020|ref|NP_993559.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596674|ref|YP_070865.1| ABC chelated iron transporter, permease subunit yfeD [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807781|ref|YP_651697.1| chelated iron transport system membrane protein [Yersinia pestis
           Antiqua]
 gi|108812058|ref|YP_647825.1| chelated iron transport system membrane protein [Yersinia pestis
           Nepal516]
 gi|145598013|ref|YP_001162089.1| chelated iron transport system membrane protein [Yersinia pestis
           Pestoides F]
 gi|149365649|ref|ZP_01887684.1| chelated iron transport system membrane protein [Yersinia pestis
           CA88-4125]
 gi|153947167|ref|YP_001400679.1| chelated iron ABC transporter permease YfeD [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418184|ref|YP_001607040.1| chelated iron transport system membrane protein [Yersinia pestis
           Angola]
 gi|165927506|ref|ZP_02223338.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165939536|ref|ZP_02228082.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166011844|ref|ZP_02232742.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166211064|ref|ZP_02237099.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167400914|ref|ZP_02306420.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167422244|ref|ZP_02313997.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167424983|ref|ZP_02316736.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|167469749|ref|ZP_02334453.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis FV-1]
 gi|170024051|ref|YP_001720556.1| ABC-3 protein [Yersinia pseudotuberculosis YPIII]
 gi|186895730|ref|YP_001872842.1| ABC-3 protein [Yersinia pseudotuberculosis PB1/+]
 gi|218929531|ref|YP_002347406.1| chelated iron transport system membrane protein [Yersinia pestis
           CO92]
 gi|229837972|ref|ZP_04458131.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229895134|ref|ZP_04510310.1| chelated iron transport system membrane protein [Yersinia pestis
           Pestoides A]
 gi|229898534|ref|ZP_04513679.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229902374|ref|ZP_04517494.1| chelated iron transport system membrane protein [Yersinia pestis
           Nepal516]
 gi|294503560|ref|YP_003567622.1| chelated iron transport system membrane protein [Yersinia pestis
           Z176003]
 gi|17380574|sp|Q56955|YFED_YERPE RecName: Full=Chelated iron transport system membrane protein yfeD
 gi|21958712|gb|AAM85461.1|AE013792_9 permease for iron and manganese ABC transporter [Yersinia pestis
           KIM 10]
 gi|45436883|gb|AAS62436.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51589956|emb|CAH21588.1| ABC chelated iron transporter, permease subunit yfeD [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775706|gb|ABG18225.1| chelated iron transport system membrane protein [Yersinia pestis
           Nepal516]
 gi|108779694|gb|ABG13752.1| chelated iron transport system membrane protein [Yersinia pestis
           Antiqua]
 gi|115348142|emb|CAL21070.1| chelated iron transport system membrane protein [Yersinia pestis
           CO92]
 gi|145209709|gb|ABP39116.1| chelated iron transport system membrane protein [Yersinia pestis
           Pestoides F]
 gi|149292062|gb|EDM42136.1| chelated iron transport system membrane protein [Yersinia pestis
           CA88-4125]
 gi|152958662|gb|ABS46123.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pseudotuberculosis IP 31758]
 gi|162350999|gb|ABX84947.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis Angola]
 gi|165912585|gb|EDR31216.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165920561|gb|EDR37838.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165989309|gb|EDR41610.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166208244|gb|EDR52724.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166958750|gb|EDR55771.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167049767|gb|EDR61175.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167056170|gb|EDR65948.1| chelated iron ABC transporter, permease protein YfeD [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169750585|gb|ACA68103.1| ABC-3 protein [Yersinia pseudotuberculosis YPIII]
 gi|186698756|gb|ACC89385.1| ABC-3 protein [Yersinia pseudotuberculosis PB1/+]
 gi|229680709|gb|EEO76805.1| chelated iron transport system membrane protein [Yersinia pestis
           Nepal516]
 gi|229688082|gb|EEO80153.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229694338|gb|EEO84385.1| chelated iron transport system membrane protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229701896|gb|EEO89919.1| chelated iron transport system membrane protein [Yersinia pestis
           Pestoides A]
 gi|262361602|gb|ACY58323.1| chelated iron transport system membrane protein [Yersinia pestis
           D106004]
 gi|262365657|gb|ACY62214.1| chelated iron transport system membrane protein [Yersinia pestis
           D182038]
 gi|294354019|gb|ADE64360.1| chelated iron transport system membrane protein [Yersinia pestis
           Z176003]
          Length = 297

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 14  YPFMQRAIVAAIVTGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S +   +  L+  LFG++L 
Sbjct: 74  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRI-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ T++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 133 ISLTELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKFLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMICRSFDQMLVVATLVSVVACVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 253 CIVIIQALFFVVALIYN 269


>gi|1245467|gb|AAC46150.1| YfeD [Yersinia pestis]
          Length = 297

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 14  YPFMQRAIVAAIVTGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S +   +  L+  LFG++L 
Sbjct: 74  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRI-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ T++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 133 ISLTELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKFLHYGLLSLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMICRSFDQMLVVATLVSVVACVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 253 CIVIIQALFFVVALIYN 269


>gi|84496820|ref|ZP_00995674.1| putative metal transport ABC transporter [Janibacter sp. HTCC2649]
 gi|84383588|gb|EAP99469.1| putative metal transport ABC transporter [Janibacter sp. HTCC2649]
          Length = 340

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 134/257 (52%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  +AL + + + L+   +G F++ +R++  GD I H AL GVA+ ++      +    
Sbjct: 8   DFMRQALIAAVLVGLAAPLVGAFLVQRRMSLIGDGIGHVALAGVAVGILTGSMPVLTALA 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
            A   ++ +  I+     S D  L V+ +  I+L +V++S     +  +LT +LFG IL 
Sbjct: 68  AAVAAAVGVELIRAAGRTSGDIALAVMFYGGIALGVVLISKSSATSPGNLTGYLFGAILT 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
            +  DI++   +  + + + + +     A   + E A+A G+      +   ++T++ + 
Sbjct: 128 TSRADIVVFAVLAVVVVGVTWVLRHRFFAVANDEEYARAVGLPVMGYNIALSVLTAVTVV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS++ +G+ LIT+L+I+P  TA+  S S  +    A++IG+   + G+  S   +TPSG 
Sbjct: 188 VSMRVVGLLLITALMIIPNATAQLVSRSFRSSLAWASLIGVASSVSGVIASFYAETPSGG 247

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ ++  F++     
Sbjct: 248 TIVLLAIATFLVVSVIS 264


>gi|284049985|ref|ZP_06380195.1| ABC-3 protein [Arthrospira platensis str. Paraca]
 gi|291568146|dbj|BAI90418.1| ABC transporter permease protein [Arthrospira platensis NIES-39]
          Length = 298

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 79/260 (30%), Positives = 147/260 (56%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ I    + + 
Sbjct: 11  LQYGFMQRSLTIAILVGLICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFILGFNIFVG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+ A L+++++  I+ +  +  DA +G++     +L + +++ ++  N  DL  FLFG+
Sbjct: 71  AFVAAVLSTVLIEIIRTHCKIKEDAAMGIVFSGFFALGITLITIIQKDNKIDLNHFLFGN 130

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V  +D+     I  + + ++F I+K LL  T + + A+A G+    + L  +M+ SL
Sbjct: 131 ILGVTASDVRDTIIIAAIVLFVVFLIYKELLFYTFDPQGAEAAGLPVNLLNLGLMMLISL 190

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P+ TA        ++ IL  +IG+   I G+Y S  ++ P
Sbjct: 191 TIVASLKAVGVILVLSLLITPSATAYLLVNRLHHVMILGVLIGVGSSISGMYLSYFYNLP 250

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+++F + 
Sbjct: 251 SGPAIVLVASGLFLMAFLFS 270


>gi|270261545|ref|ZP_06189818.1| transporter [Serratia odorifera 4Rx13]
 gi|270045029|gb|EFA18120.1| transporter [Serratia odorifera 4Rx13]
          Length = 270

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/255 (21%), Positives = 124/255 (48%), Gaps = 1/255 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             RA+ + I   +    L C+++ +  +  GD I+H+ L G+ ++ +  +P+ I  F   
Sbjct: 1   MQRAILAAIVTGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFVLGIPVVIGAFFSG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              ++    +++N  +  D ++G++     +  LV+ S +   +  L+  LFG++L +  
Sbjct: 61  IFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRV-DTDQHLSHILFGNMLGITD 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            ++     I  + ++++    K L+    +   A+  G+  + +    + + +L I  S+
Sbjct: 120 AELKQTLLIAGITLVVVLLKRKDLMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI P + A     S + M ++AT++ +   ++G   S   D  +GP I+
Sbjct: 180 QAVGVILVIAMLIAPGIIAFMLCRSFDRMLVIATLVSVFSCVLGTLISFHIDGATGPCIV 239

Query: 246 ITSLFLFILSFFYKK 260
           I     FI++  Y K
Sbjct: 240 IVQAIAFIIALLYSK 254


>gi|238765232|ref|ZP_04626162.1| Chelated iron transport system membrane protein yfeD [Yersinia
           kristensenii ATCC 33638]
 gi|238696560|gb|EEP89347.1| Chelated iron transport system membrane protein yfeD [Yersinia
           kristensenii ATCC 33638]
          Length = 294

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 123/257 (47%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 11  YPFMQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 71  ISGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 130 ISLAELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT+  +L  ++G   S   D  +GP
Sbjct: 190 ASLQAVGVILVIAMLISPGIIAFMVCRSFDQMLVVATLASVLSCVLGTLISFHIDGATGP 249

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 250 CIVIIQALFFVIALIYS 266


>gi|265985846|ref|ZP_06098581.1| ABC-3 protein [Brucella sp. 83/13]
 gi|264664438|gb|EEZ34699.1| ABC-3 protein [Brucella sp. 83/13]
          Length = 284

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 139/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 13  LDDFFTRAIIAGIGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 73  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 132

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 133 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 193 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 252

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 253 PSIVVAALAIFILSLL 268


>gi|50842982|ref|YP_056209.1| ABC transporter ATP-binding protein [Propionibacterium acnes
           KPA171202]
 gi|50840584|gb|AAT83251.1| ABC transporter ATP-binding protein [Propionibacterium acnes
           KPA171202]
 gi|313813369|gb|EFS51083.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL025PA1]
          Length = 312

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAVVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|289426519|ref|ZP_06428262.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes SK187]
 gi|289428743|ref|ZP_06430426.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes J165]
 gi|295131053|ref|YP_003581716.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes SK137]
 gi|289153247|gb|EFD01965.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes SK187]
 gi|289158141|gb|EFD06361.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes J165]
 gi|291377135|gb|ADE00990.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes SK137]
 gi|313763581|gb|EFS34945.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL013PA1]
 gi|313773519|gb|EFS39485.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL074PA1]
 gi|313793974|gb|EFS41998.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL110PA1]
 gi|313801361|gb|EFS42612.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL110PA2]
 gi|313807960|gb|EFS46441.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL087PA2]
 gi|313811572|gb|EFS49286.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL083PA1]
 gi|313816761|gb|EFS54475.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL059PA1]
 gi|313819528|gb|EFS57242.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL046PA2]
 gi|313822148|gb|EFS59862.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL036PA1]
 gi|313823618|gb|EFS61332.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL036PA2]
 gi|313825942|gb|EFS63656.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL063PA1]
 gi|313829621|gb|EFS67335.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL063PA2]
 gi|313831312|gb|EFS69026.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL007PA1]
 gi|313834922|gb|EFS72636.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL056PA1]
 gi|313839918|gb|EFS77632.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL086PA1]
 gi|314914735|gb|EFS78566.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL005PA4]
 gi|314919303|gb|EFS83134.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL050PA1]
 gi|314920787|gb|EFS84618.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL050PA3]
 gi|314924639|gb|EFS88470.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL036PA3]
 gi|314930466|gb|EFS94297.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL067PA1]
 gi|314954376|gb|EFS98782.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL027PA1]
 gi|314957438|gb|EFT01541.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL002PA1]
 gi|314962095|gb|EFT06196.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL002PA2]
 gi|314963674|gb|EFT07774.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL082PA1]
 gi|314974187|gb|EFT18283.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL053PA1]
 gi|314976704|gb|EFT20799.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL045PA1]
 gi|314978812|gb|EFT22906.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL072PA2]
 gi|314984342|gb|EFT28434.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL005PA1]
 gi|314986531|gb|EFT30623.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL005PA2]
 gi|314990890|gb|EFT34981.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL005PA3]
 gi|315079524|gb|EFT51517.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL053PA2]
 gi|315081247|gb|EFT53223.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL078PA1]
 gi|315083614|gb|EFT55590.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL027PA2]
 gi|315087130|gb|EFT59106.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL002PA3]
 gi|315089303|gb|EFT61279.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL072PA1]
 gi|315095326|gb|EFT67302.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL038PA1]
 gi|315099209|gb|EFT71185.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL059PA2]
 gi|315100440|gb|EFT72416.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL046PA1]
 gi|327328411|gb|EGE70173.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL096PA2]
 gi|327329723|gb|EGE71479.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL096PA3]
 gi|327444198|gb|EGE90852.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL043PA2]
 gi|327444923|gb|EGE91577.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL043PA1]
 gi|327446408|gb|EGE93062.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL013PA2]
 gi|327452004|gb|EGE98658.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL092PA1]
 gi|327454960|gb|EGF01615.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL087PA3]
 gi|327457754|gb|EGF04409.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL083PA2]
 gi|328752163|gb|EGF65779.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL020PA1]
 gi|328755205|gb|EGF68821.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL087PA1]
 gi|328758315|gb|EGF71931.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL025PA2]
 gi|328760069|gb|EGF73649.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL099PA1]
 gi|332675933|gb|AEE72749.1| manganese transport system membrane protein MntC [Propionibacterium
           acnes 266]
          Length = 312

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVALVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040396|gb|ACT57192.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 260

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC
Sbjct: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI
Sbjct: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM
Sbjct: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS
Sbjct: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSIIITSLFLFILSFFYKK
Sbjct: 241 GPSIIITSLFLFILSFFYKK 260


>gi|300722773|ref|YP_003712064.1| Chelated iron transport system membrane protein yfeD [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629281|emb|CBJ89880.1| Chelated iron transport system membrane protein yfeD [Xenorhabdus
           nematophila ATCC 19061]
          Length = 298

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/259 (22%), Positives = 122/259 (47%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F  RA+++ I +      L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  
Sbjct: 13  MHDFMRRAIYAAIIVGAVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFVTGIPLAIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F+     +     +++N  +  D ++G++     +  LV+ + +   +  LT  LFG IL
Sbjct: 73  FLSGIFCAFATGYLKENSRIKEDTVMGIVFSGMFAFGLVLFTRI-DTDQHLTHILFGSIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   ++L    I  + +  +    K  +    +   A+  G+  + I    + + +L I
Sbjct: 132 GITQNELLQTLCIAGVTLATVLLKRKDFMLYCFDPNQARVVGLPVKVIHYGLLSLLALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P + A     S + M I+A +  +   ++G   S   D  +G
Sbjct: 192 VASLQAVGIILVIAMLISPGIIAFMLCRSFDRMLIVAIVASVSSSVLGTIVSFHIDGETG 251

Query: 242 PSIIITSLFLFILSFFYKK 260
           P I+I     F ++  Y +
Sbjct: 252 PCIVIIQAIFFTVALIYNQ 270


>gi|153011493|ref|YP_001372707.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563381|gb|ABS16878.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
          Length = 273

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 138/257 (53%), Positives = 203/257 (78%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RA+ +G+G+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + + I 
Sbjct: 1   MLDDFFTRAIIAGVGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINMMIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDI
Sbjct: 61  VFAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLVAFMTWVRVDLLSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI  I+G G   + +L  +W+P LA TV+ ++A+AEGM P   +++F+++ +++
Sbjct: 121 LAVSRMDIAFIYGGGVFVLAVLAWLWRPFLAATVSEDIARAEGMNPALSRIVFMLLLAIV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MAILA++IG  G+I GLYGS+ FDTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFSSTPEQMAILASLIGAAGVIGGLYGSIHFDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L +FILS  
Sbjct: 241 GPSIVVAALAIFILSLL 257


>gi|315109007|gb|EFT80983.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL030PA2]
          Length = 312

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVALVCSVVAGVIGSRVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|254720787|ref|ZP_05182598.1| zinc ABC transporter, permease protein [Brucella sp. 83/13]
 gi|306838500|ref|ZP_07471339.1| zinc ABC transporter, permease protein [Brucella sp. NF 2653]
 gi|306406421|gb|EFM62661.1| zinc ABC transporter, permease protein [Brucella sp. NF 2653]
          Length = 286

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 139/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|239834412|ref|ZP_04682740.1| ABC 3 transport family protein [Ochrobactrum intermedium LMG 3301]
 gi|239822475|gb|EEQ94044.1| ABC 3 transport family protein [Ochrobactrum intermedium LMG 3301]
          Length = 299

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 136/256 (53%), Positives = 202/256 (78%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +G+G+ L+TGPLGCFI+W+R+AYFGDT+AHSALLGVAL+L+F + L I +
Sbjct: 28  LDDFFTRAIIAGVGLALTTGPLGCFIVWRRMAYFGDTMAHSALLGVALALVFDINLMIGV 87

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 88  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLVAFMTWVRVDLLSFLFGDIL 147

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G   + +L  +W+P LA TV+ ++A+AEGM P   +++F+++ +++I
Sbjct: 148 AVSRMDIAFIYGGGVFVLAVLAWLWRPFLAATVSEDIARAEGMNPALSRIVFMLLLAIVI 207

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MAILA++IG  G+I GLYGS+ FDTPSG
Sbjct: 208 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAILASLIGAAGVIGGLYGSIHFDTPSG 267

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 268 PSIVVAALAIFILSLL 283


>gi|226355590|ref|YP_002785330.1| ABC transporter permease [Deinococcus deserti VCD115]
 gi|226317580|gb|ACO45576.1| putative ABC transporter, permease component [Deinococcus deserti
           VCD115]
          Length = 269

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 69/257 (26%), Positives = 143/257 (55%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +FF RAL + + + +    +G +++ + ++Y GD ++H+   G+  + + +  L +   +
Sbjct: 11  DFFQRALAAVVLVSVLCALVGAWVVLRGLSYIGDAMSHAVFPGIVAAFLMKGNLLVGALI 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A LT+L +  + +   L  D+ +G++     +L +V+LS      TDL++FL G+ L V
Sbjct: 71  AAVLTALGIGLVSQRSGLKQDSAIGIVFVGMFALGIVMLSRAPSFTTDLSNFLIGNPLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+     +  L   +L  I K LL  + +   A+A G+    ++ + +++  L++ +
Sbjct: 131 TPTDLWSALLVTALVGGLLTAIQKELLLASFDPTEARAIGLPVRPLESLLLILIGLVVVL 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G TL  SLLI  + TAR  + + + M + A ++G++G I GLY S   +T  G +
Sbjct: 191 TVQLVGTTLSVSLLITSSATARLLARNLKKMILTAALLGVVGGITGLYLSYFMNTAPGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  LF+L+ F+++
Sbjct: 251 IVLVNTALFLLALFFRR 267


>gi|307154565|ref|YP_003889949.1| ABC-3 protein [Cyanothece sp. PCC 7822]
 gi|306984793|gb|ADN16674.1| ABC-3 protein [Cyanothece sp. PCC 7822]
          Length = 297

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 79/260 (30%), Positives = 143/260 (55%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++ +  + + + 
Sbjct: 9   LQYSFMQRSLIEAIIVGVICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFLLNINIFVG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   L+++V+  I+    L  DA +G++  S  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFVAGLLSTIVINLIRTRSNLKEDAAMGIVFSSFFALGITLITIIQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   D+     IG + I+I+   +K LL  T +   A+A G+    + L  +++  L
Sbjct: 129 ILGVTVADLRDTLIIGVVVILIVVVFYKELLFYTFDKLGAQAAGLPVHLLDLGLMILIGL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + +L  +IG++  I G+Y S  ++ P
Sbjct: 189 TIVASLKTVGVILVLSLLITPAATAYLLVKRLHQVMLLGVVIGVISSISGMYLSYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LFIL+F + 
Sbjct: 249 SGPAIVLVASGLFILAFLFS 268


>gi|314968497|gb|EFT12595.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL037PA1]
          Length = 312

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVALVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|23500839|ref|NP_700279.1| zinc ABC transporter permease [Brucella suis 1330]
 gi|23464502|gb|AAN34284.1| zinc ABC transporter, permease protein [Brucella suis 1330]
          Length = 286

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|261492455|ref|ZP_05989011.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496363|ref|ZP_05992757.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261307948|gb|EEY09257.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311914|gb|EEY13061.1| high-affinity zinc uptake system membrane protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 289

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 173/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  +L   + +  
Sbjct: 31  DILFPAWLAGVLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLELDPYLAVIG 90

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ +++    S D +LG+I H+++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 91  MTILLALLLVWLEQKTNYSVDTVLGIIAHTSLSLGVITISLLDNVRVDLMSYLFGDLLAI 150

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N +D++ I     L  +IL   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 151 NFSDVVFIGIGATLICLILMLFWKRLLSITISPELAQIEGLNVARLRLLLMILTALTIAL 210

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE M ++A +  I+ +  GL  S   DTP+GPS
Sbjct: 211 SMKFVGALIITSLLIIPSATARRFAKTPEKMVLIAILFSIVAVTGGLLLSGWKDTPAGPS 270

Query: 244 IIITSLFLFILSFFYK 259
           ++I +  +F+LS F K
Sbjct: 271 VVICAGLIFLLSLFKK 286


>gi|17988520|ref|NP_541153.1| high-affinity zinc uptake system membrane protein ZNUB [Brucella
           melitensis bv. 1 str. 16M]
 gi|260544127|ref|ZP_05819948.1| ABC transporter, family 3 [Brucella abortus NCTC 8038]
 gi|260759378|ref|ZP_05871726.1| ABC 3 transporter [Brucella abortus bv. 4 str. 292]
 gi|261216561|ref|ZP_05930842.1| ABC-3 protein [Brucella ceti M13/05/1]
 gi|261313966|ref|ZP_05953163.1| ABC-3 protein [Brucella pinnipedialis M163/99/10]
 gi|261749687|ref|ZP_05993396.1| ABC 3 type transporter [Brucella suis bv. 5 str. 513]
 gi|261752931|ref|ZP_05996640.1| ABC-3 type transporter [Brucella suis bv. 3 str. 686]
 gi|265989286|ref|ZP_06101843.1| ABC-3 protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265996861|ref|ZP_06109418.1| ABC-3 protein [Brucella ceti M490/95/1]
 gi|265998975|ref|ZP_06111513.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|17984313|gb|AAL53417.1| high-affinity zinc uptake system membrane protein znub [Brucella
           melitensis bv. 1 str. 16M]
 gi|260097398|gb|EEW81272.1| ABC transporter, family 3 [Brucella abortus NCTC 8038]
 gi|260669696|gb|EEX56636.1| ABC 3 transporter [Brucella abortus bv. 4 str. 292]
 gi|260921650|gb|EEX88218.1| ABC-3 protein [Brucella ceti M13/05/1]
 gi|261302992|gb|EEY06489.1| ABC-3 protein [Brucella pinnipedialis M163/99/10]
 gi|261739440|gb|EEY27366.1| ABC 3 type transporter [Brucella suis bv. 5 str. 513]
 gi|261742684|gb|EEY30610.1| ABC-3 type transporter [Brucella suis bv. 3 str. 686]
 gi|262551158|gb|EEZ07319.1| ABC-3 protein [Brucella ceti M490/95/1]
 gi|262999955|gb|EEZ12645.1| ABC-3 protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091478|gb|EEZ16014.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
          Length = 284

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 13  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 73  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 132

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 133 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 193 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 252

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 253 PSIVVAALAIFILSLL 268


>gi|314923913|gb|EFS87744.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL001PA1]
 gi|314966025|gb|EFT10124.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL082PA2]
 gi|315094973|gb|EFT66949.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL060PA1]
 gi|327328093|gb|EGE69862.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL103PA1]
          Length = 312

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 135/254 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAMVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAIVSQNRRLKEDSVIGILFAGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVIVCVAGALVLALEWVVHKELVTVGLDRETAQASNLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +    +M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGHMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|238787078|ref|ZP_04630878.1| Chelated iron transport system membrane protein yfeD [Yersinia
           frederiksenii ATCC 33641]
 gi|238724866|gb|EEQ16506.1| Chelated iron transport system membrane protein yfeD [Yersinia
           frederiksenii ATCC 33641]
          Length = 294

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 123/257 (47%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 11  YPFMQRAIVAAIVTGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 71  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 130 ISLAELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ +   ++G   S   D  +GP
Sbjct: 190 ASLQAVGVILVIAMLIAPGIIAFLVCRSFDQMLVVATLVSVSACVLGTLISFHIDGATGP 249

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 250 CIVIIQALFFVVALIYN 266


>gi|37526566|ref|NP_929910.1| chelated iron transport system membrane protein yfeD-like protein
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785998|emb|CAE15049.1| Chelated iron transport system membrane protein yfeD homolog
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 295

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 120/257 (46%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RA+F+ I        L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+
Sbjct: 15  PFMQRAIFAAIVTGAVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFAAGIPLAIGAFL 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    ++++  +  D ++G++     +  LV+ + +   +  LT  LFG+IL +
Sbjct: 75  SGIFCAVATGYLKEHSRIKEDTVMGIVFSGMFAFGLVLFARI-DTDQHLTHILFGNILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              ++     I  + + ++    K  +    +   A+  G+  + +    + + S+ I  
Sbjct: 134 TKDELHQTLWITCITMAVILLKRKDFMLYCFDPNQARVVGLPVKLLHYGLLCLLSMTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ ++LI P + A     S + M I+A I  +   ++G   S   D  +GP 
Sbjct: 194 SLQAVGMILVIAMLISPGIIAFMLCRSFDRMLIVAIIASVSSSVLGTLISFHIDGATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I+I     F L+  Y +
Sbjct: 254 IVIVQAIFFTLALAYSQ 270


>gi|150396899|ref|YP_001327366.1| ABC-3 protein [Sinorhizobium medicae WSM419]
 gi|150028414|gb|ABR60531.1| ABC-3 protein [Sinorhizobium medicae WSM419]
          Length = 275

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 146/257 (56%), Positives = 207/257 (80%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+  L L + 
Sbjct: 1   MLDDFFIRALVAGIGIAMVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLMDLNLMVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFVVASAVSVLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI ++WG G L +  L  +W+PLLA+TVN ELA+AEG++PE+ +L F+++ +L+
Sbjct: 121 LAVSRADIDIVWGGGILVVFALVYLWRPLLASTVNPELAEAEGLKPERARLFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS+SPE MA+LA++IG + +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFSSSPETMAVLASLIGAVAVAGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LF+LS  
Sbjct: 241 GPSIVVAALALFVLSLL 257


>gi|282854650|ref|ZP_06263985.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes J139]
 gi|282582232|gb|EFB87614.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes J139]
 gi|314981909|gb|EFT26002.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL110PA3]
 gi|315090724|gb|EFT62700.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL110PA4]
          Length = 312

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 135/254 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAMVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAIVSQNRRLKEDSVIGILFAGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVIVCVAGALVLALEWVVHKELVTVGLDRETAQASNLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +    +M +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGHMMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|62317943|ref|YP_223796.1| zinc ABC transporter permease [Brucella abortus bv. 1 str. 9-941]
 gi|83269920|ref|YP_419211.1| sodium/dicarboxylate ABC transporter [Brucella melitensis biovar
           Abortus 2308]
 gi|161621166|ref|YP_001595052.1| 29 kDa membrane protein in psaA 5'region [Brucella canis ATCC
           23365]
 gi|163845443|ref|YP_001623098.1| hypothetical protein BSUIS_B1351 [Brucella suis ATCC 23445]
 gi|189023194|ref|YP_001932935.1| ABC transporter, family 3 [Brucella abortus S19]
 gi|225686871|ref|YP_002734843.1| zinc ABC transporter permease [Brucella melitensis ATCC 23457]
 gi|254691627|ref|ZP_05154881.1| zinc ABC transporter, permease protein [Brucella abortus bv. 6 str.
           870]
 gi|254698174|ref|ZP_05160002.1| zinc ABC transporter, permease protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254699249|ref|ZP_05161077.1| zinc ABC transporter, permease protein [Brucella suis bv. 5 str.
           513]
 gi|254702368|ref|ZP_05164196.1| zinc ABC transporter, permease protein [Brucella suis bv. 3 str.
           686]
 gi|254706511|ref|ZP_05168339.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711204|ref|ZP_05173015.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           B2/94]
 gi|254711805|ref|ZP_05173616.1| zinc ABC transporter, permease protein [Brucella ceti M644/93/1]
 gi|254714873|ref|ZP_05176684.1| zinc ABC transporter, permease protein [Brucella ceti M13/05/1]
 gi|254731619|ref|ZP_05190197.1| zinc ABC transporter, permease protein [Brucella abortus bv. 4 str.
           292]
 gi|256015884|ref|YP_003105893.1| zinc ABC transporter, permease protein [Brucella microti CCM 4915]
 gi|256030167|ref|ZP_05443781.1| zinc ABC transporter, permease protein [Brucella pinnipedialis
           M292/94/1]
 gi|256042849|ref|ZP_05445795.1| zinc ABC transporter, permease protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059820|ref|ZP_05450014.1| zinc ABC transporter, permease protein [Brucella neotomae 5K33]
 gi|256112191|ref|ZP_05453112.1| zinc ABC transporter, permease protein [Brucella melitensis bv. 3
           str. Ether]
 gi|256158350|ref|ZP_05456250.1| zinc ABC transporter, permease protein [Brucella ceti M490/95/1]
 gi|256256814|ref|ZP_05462350.1| zinc ABC transporter, permease protein [Brucella abortus bv. 9 str.
           C68]
 gi|260166782|ref|ZP_05753593.1| zinc ABC transporter, permease protein [Brucella sp. F5/99]
 gi|260564088|ref|ZP_05834573.1| ABC transporter, family 3 [Brucella melitensis bv. 1 str. 16M]
 gi|260568729|ref|ZP_05839198.1| ABC transporter, family 3 [Brucella suis bv. 4 str. 40]
 gi|260757257|ref|ZP_05869605.1| ABC 3 transporter [Brucella abortus bv. 6 str. 870]
 gi|260762621|ref|ZP_05874953.1| ABC 3 transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883061|ref|ZP_05894675.1| zinc ABC transporter permease [Brucella abortus bv. 9 str. C68]
 gi|261318795|ref|ZP_05957992.1| ABC-3 protein [Brucella pinnipedialis B2/94]
 gi|261319432|ref|ZP_05958629.1| ABC-3 protein [Brucella ceti M644/93/1]
 gi|261323799|ref|ZP_05962996.1| zinc ABC transporter permease [Brucella neotomae 5K33]
 gi|261756158|ref|ZP_05999867.1| ABC transporter [Brucella sp. F5/99]
 gi|265987198|ref|ZP_06099755.1| zinc ABC transporter permease [Brucella pinnipedialis M292/94/1]
 gi|265993618|ref|ZP_06106175.1| zinc ABC transporter permease [Brucella melitensis bv. 3 str.
           Ether]
 gi|294852953|ref|ZP_06793625.1| zinc transport system permease [Brucella sp. NVSL 07-0026]
 gi|297250165|ref|ZP_06933866.1| zinc transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|62198136|gb|AAX76435.1| ZnuB, zinc ABC transporter, permease protein [Brucella abortus bv.
           1 str. 9-941]
 gi|82940194|emb|CAJ13247.1| ABC transporter, family 3:Sodium:dicarboxylate symporter [Brucella
           melitensis biovar Abortus 2308]
 gi|161337977|gb|ABX64281.1| 29 kDa membrane protein in psaA 5'region [Brucella canis ATCC
           23365]
 gi|163676166|gb|ABY40276.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021768|gb|ACD74489.1| ABC transporter, family 3 [Brucella abortus S19]
 gi|225642976|gb|ACO02889.1| zinc ABC transporter, permease protein [Brucella melitensis ATCC
           23457]
 gi|255998544|gb|ACU50231.1| zinc ABC transporter, permease protein [Brucella microti CCM 4915]
 gi|260151731|gb|EEW86824.1| ABC transporter, family 3 [Brucella melitensis bv. 1 str. 16M]
 gi|260155394|gb|EEW90475.1| ABC transporter, family 3 [Brucella suis bv. 4 str. 40]
 gi|260673042|gb|EEX59863.1| ABC 3 transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677365|gb|EEX64186.1| ABC 3 transporter [Brucella abortus bv. 6 str. 870]
 gi|260872589|gb|EEX79658.1| zinc ABC transporter permease [Brucella abortus bv. 9 str. C68]
 gi|261292122|gb|EEX95618.1| ABC-3 protein [Brucella ceti M644/93/1]
 gi|261298018|gb|EEY01515.1| ABC-3 protein [Brucella pinnipedialis B2/94]
 gi|261299779|gb|EEY03276.1| zinc ABC transporter permease [Brucella neotomae 5K33]
 gi|261736142|gb|EEY24138.1| ABC transporter [Brucella sp. F5/99]
 gi|262764488|gb|EEZ10520.1| zinc ABC transporter permease [Brucella melitensis bv. 3 str.
           Ether]
 gi|264659395|gb|EEZ29656.1| zinc ABC transporter permease [Brucella pinnipedialis M292/94/1]
 gi|294818608|gb|EFG35608.1| zinc transport system permease [Brucella sp. NVSL 07-0026]
 gi|297174034|gb|EFH33398.1| zinc transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|326411287|gb|ADZ68351.1| ABC transporter, family 3 [Brucella melitensis M28]
 gi|326554576|gb|ADZ89215.1| ABC transporter, family 3 [Brucella melitensis M5-90]
          Length = 286

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|238797391|ref|ZP_04640891.1| Chelated iron transport system membrane protein yfeD [Yersinia
           mollaretii ATCC 43969]
 gi|238718822|gb|EEQ10638.1| Chelated iron transport system membrane protein yfeD [Yersinia
           mollaretii ATCC 43969]
          Length = 294

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 124/257 (48%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 11  YPFMQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 71  VSGIFCAVATGYLKEHSRVKEDTVMGIVFSGMFAFGLVMFSRM-DTDQHLSHILFGNMLG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 130 ISLAELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKFLHYGLLCLLALTIV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M I+AT++ ++  ++G   S   D  +GP
Sbjct: 190 ASLQAVGVILVIAMLIAPGIIAFMLCRSFDRMLIVATLVSVVACVLGTLISFHIDGATGP 249

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 250 CIVIIQALFFVIALIYS 266


>gi|225628414|ref|ZP_03786448.1| ABC 3 transport family protein [Brucella ceti str. Cudo]
 gi|237817488|ref|ZP_04596479.1| ABC 3 transport family protein [Brucella abortus str. 2308 A]
 gi|225616260|gb|EEH13308.1| ABC 3 transport family protein [Brucella ceti str. Cudo]
 gi|237787323|gb|EEP61540.1| ABC 3 transport family protein [Brucella abortus str. 2308 A]
          Length = 292

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 21  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 80

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 81  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 140

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 141 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 200

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 201 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 260

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 261 PSIVVAALAIFILSLL 276


>gi|218439505|ref|YP_002377834.1| ABC transporter [Cyanothece sp. PCC 7424]
 gi|218172233|gb|ACK70966.1| ABC-3 protein [Cyanothece sp. PCC 7424]
          Length = 300

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 73/260 (28%), Positives = 144/260 (55%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++ ++ + + + 
Sbjct: 12  LQYSFMQRSLIEAIIVGVICAIVGSYLMVQRLALLGDAISHSVLPGLAVAFLWGMNIFVG 71

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   ++++++  I+    L  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 72  AFIAGLISTILINIIRTRSNLKEDAAMGIVFSAFFALGITLITIIQKDNKIDLNHFLFGN 131

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V  +D+     I  + I+I+  ++K L   T +   A+A G+    ++L  +++  L
Sbjct: 132 ILGVTVSDVRDTLIIAVIIILIVVLLYKELHFYTFDRLGAQAVGLPVHLLELGLMILIGL 191

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL   +G++  I G+Y S  ++ P
Sbjct: 192 TIVASLKTVGVILVLSLLITPAATAYLLVKRLHQVMILGVGLGVISSISGMYLSYFYNLP 251

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+L+F + 
Sbjct: 252 SGPAIVLVASGLFVLAFLFS 271


>gi|261215429|ref|ZP_05929710.1| ABC 3 transporter [Brucella abortus bv. 3 str. Tulya]
 gi|260917036|gb|EEX83897.1| ABC 3 transporter [Brucella abortus bv. 3 str. Tulya]
          Length = 284

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 139/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 13  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++++T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 73  FAVAVAISAILLLLQRRHTLSADSLLGILSYATLSLGLVLMAFMTWVRVDLLSFLFGDIL 132

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 133 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 193 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 252

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 253 PSIVVAALAIFILSLL 268


>gi|290475411|ref|YP_003468299.1| chelated iron transport system membrane protein yfeD [Xenorhabdus
           bovienii SS-2004]
 gi|289174732|emb|CBJ81531.1| Chelated iron transport system membrane protein yfeD [Xenorhabdus
           bovienii SS-2004]
          Length = 291

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/257 (23%), Positives = 123/257 (47%), Gaps = 1/257 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F  RA+F+ + +      L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  
Sbjct: 13  MHDFMQRAIFASVIVGAVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFVAGIPLAIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F+     +     ++++  +  D ++G++     +L LV+ + +   +  LT  LFG IL
Sbjct: 73  FLSGIFCAFATGYLKEHSRIKEDTVMGIVFSGMFALGLVLFTRI-DTDQHLTHILFGSIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   +++    I  + + I+    K  +    +   A+  G+  + I    + + +L I
Sbjct: 132 GITQHELIQTLCIAGVTLAIVLLKRKDFMLYCFDPNQARVVGLPVKLIHYGLLSLLALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P + A     S + M I+A I  +   ++G   S   D  +G
Sbjct: 192 VASLQAVGIILVIAMLISPGIIAFMLCRSFDRMLIVAMIASVSSSVLGTIISFHIDGETG 251

Query: 242 PSIIITSLFLFILSFFY 258
           P I+I     FI +  Y
Sbjct: 252 PCIVIIQAIFFITALIY 268


>gi|225023865|ref|ZP_03713057.1| hypothetical protein EIKCOROL_00731 [Eikenella corrodens ATCC
           23834]
 gi|224943339|gb|EEG24548.1| hypothetical protein EIKCOROL_00731 [Eikenella corrodens ATCC
           23834]
          Length = 284

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   AL + + + ++ G L C+++ +  +  GD ++H+ L G+ L+ +F +PL I  F 
Sbjct: 15  PFMQNALLTALIVSITCGLLSCYLVLKGWSLMGDAVSHAVLPGIVLAFVFGIPLQIGAFA 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L S+ +  ++ N  L  D ++G++     +L LV+ + ++  +  LT  LFG++L V
Sbjct: 75  SGLLCSVGVGYLKNNSRLKEDTVMGIVFSGMFALGLVLFTKVE-TDQHLTHILFGNVLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  ++L  + I     + +    +  +    +   A+  G+ P+ +    + + +L I  
Sbjct: 134 SREELLQTFAICAAVALAVLLKRRDFMLYCFDPAQARIAGLSPQLLHYSLLTLLALTIIT 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++  G+ L+ ++LI P +TA   +   E M I+     +   + G   S   ++ +GPS
Sbjct: 194 AMQVAGVVLVVAMLISPGITAFLLTKRFERMMIIVVAASVFTSLTGTLLSYHLNSATGPS 253

Query: 244 IIITSLFLFILSFFYKK 260
           I+I    LF+L+  + K
Sbjct: 254 IVILQAILFLLALIWNK 270


>gi|306845404|ref|ZP_07477978.1| zinc ABC transporter, permease protein [Brucella sp. BO1]
 gi|306274147|gb|EFM55963.1| zinc ABC transporter, permease protein [Brucella sp. BO1]
          Length = 286

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVISGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|327334239|gb|EGE75953.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL097PA1]
          Length = 312

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 62/254 (24%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL   +   +  G +G  ++ + +A+ G+ +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAVVCSVVAGVIGSHVVLRGMAFIGNAVAHSVFPGLAVAFLMQGSLLLGGSIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLTTAILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L + + + + K L+   ++ E A+A  +    + L+  ++ ++ + +S
Sbjct: 138 DDDIVMVCVAGALVLALEWAVHKELVTVGLDRETARASDLPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     + +LA +IG    ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLRQIMVLAPVIGGFSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+  +  
Sbjct: 258 VLVATAVFLACWLV 271


>gi|311031168|ref|ZP_07709258.1| manganese ABC transporter (permease) [Bacillus sp. m3-13]
          Length = 451

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/269 (21%), Positives = 133/269 (49%), Gaps = 10/269 (3%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL----- 55
           + +      L   I + +++G +G F + ++ +  GD +AH+AL G+ ++ +        
Sbjct: 8   LQDPNVQWVLLGTILLGIASGVIGSFALLRKQSLLGDAMAHAALPGICIAFLIYGAKSMS 67

Query: 56  PLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV----NTD 111
              I   +   + +  +  I K+  +  D  +G++        +V+L++++         
Sbjct: 68  WFLIGASISGLIGTYCIQAIIKHSRIKEDTAIGLVLSVFFGFGIVLLTYIQQNGSGNQAG 127

Query: 112 LTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKL 171
           L SF+FG   A+   D+ +I  I F+ I I F ++K L   T + + A+  G+  + +  
Sbjct: 128 LDSFIFGQAAAIVGLDVQIISVIAFVLIFITFILFKELKLITFDPQFAQGIGLPTKWLNG 187

Query: 172 IFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLY 231
           + + +    + + ++ +G+ L+ ++LI P + AR ++   ++M +LA ++G +  ++G  
Sbjct: 188 LLMTMIVGAVVIGLQAVGVILMAAMLITPAIAARYWTERLDHMVVLAGLVGGISGVVGTL 247

Query: 232 GSLIF-DTPSGPSIIITSLFLFILSFFYK 259
            S +    P+GP II+ +  LF++S  + 
Sbjct: 248 LSTLSRGMPTGPLIILAATVLFLISLIFG 276


>gi|238783393|ref|ZP_04627416.1| Chelated iron transport system membrane protein yfeD [Yersinia
           bercovieri ATCC 43970]
 gi|238715638|gb|EEQ07627.1| Chelated iron transport system membrane protein yfeD [Yersinia
           bercovieri ATCC 43970]
          Length = 286

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 123/254 (48%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+  
Sbjct: 1   MQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAFVSG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              ++    ++++  +  D ++G++     +  LV+ S +   +  L+  LFG++L ++ 
Sbjct: 61  IFCAVATGYLKEHSRVKEDTVMGIVFSGMFAFGLVMFSRI-DTDQHLSHILFGNMLGISL 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            ++     I    ++++    K L+    +   A+  G+  + +    + + +L I  S+
Sbjct: 120 AELKQTLWIAGFTLLVVLLKRKDLMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI P + A     S + M I+AT++ ++  ++G   S   D  +GP I+
Sbjct: 180 QAVGVILVIAMLIAPGIIAFMLCRSFDRMLIVATLVSVVACVLGTLISFHIDGATGPCIV 239

Query: 246 ITSLFLFILSFFYK 259
           I     F+ +  Y 
Sbjct: 240 IIQALFFVFALIYS 253


>gi|254695077|ref|ZP_05156905.1| zinc ABC transporter, permease protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 286

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 139/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++++T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSYATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|306841290|ref|ZP_07474001.1| zinc ABC transporter, permease protein [Brucella sp. BO2]
 gi|306288692|gb|EFM60023.1| zinc ABC transporter, permease protein [Brucella sp. BO2]
          Length = 286

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWQPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|304413462|ref|ZP_07394935.1| permease protein of chelated iron ABC transporter [Candidatus
           Regiella insecticola LSR1]
 gi|304284305|gb|EFL92698.1| permease protein of chelated iron ABC transporter [Candidatus
           Regiella insecticola LSR1]
          Length = 288

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 60/258 (23%), Positives = 123/258 (47%), Gaps = 1/258 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           Y  F  RA+F+ I   +    L C+++ +  +  GD I+H+ L G+ L+ +  LPL I  
Sbjct: 13  YYPFMQRAIFTAIATGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFVLGLPLVIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F      +L    +++N  +  D ++G++     +L +V+ S +   +  L+  LFG+IL
Sbjct: 73  FFSGIFCALSTGYLKENSRIKEDTVMGIVFSGMFALGIVLFSQV-DTDQHLSHILFGNIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V  T+      I    ++++    K L+    +   A+  G+  + +    + + +L I
Sbjct: 132 GVTLTEFKQTLWITTFTLLVVLLKRKDLMLFCFDANHAQVIGLPIKWLHYGLLCLLALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +G+ L+ ++LI P + A       + M ++AT++ ++  ++G   S   D  +G
Sbjct: 192 VTSLQAVGVILVIAMLIAPGIIASLVCRRFDIMLMIATLVSVVSCVLGTLISFHIDGATG 251

Query: 242 PSIIITSLFLFILSFFYK 259
           P I+I     F +     
Sbjct: 252 PCIVIVQALFFFIVLIIS 269


>gi|256252720|ref|ZP_05458256.1| zinc ABC transporter, permease protein [Brucella ceti B1/94]
 gi|261219798|ref|ZP_05934079.1| zinc ABC transporter permease [Brucella ceti B1/94]
 gi|260918382|gb|EEX85035.1| zinc ABC transporter permease [Brucella ceti B1/94]
          Length = 284

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 204/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L + +L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAVLAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|159898588|ref|YP_001544835.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159891627|gb|ABX04707.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 304

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 72/253 (28%), Positives = 135/253 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF+R +  G+ + L+ G LGCF++ + +A+ GD +AH+ L GV L+ +  + + +     
Sbjct: 12  FFLRGMVVGMLMGLTCGVLGCFVVLRGMAFIGDALAHAVLPGVVLAYMGGISMVLGALGA 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               +L++  I + + +  D  +G++     +L +V+LS M+    DLT FLFG+IL + 
Sbjct: 72  GLFAALLISLISRTDYIREDTAIGIVFTGAFALGIVLLSRMRGYARDLTHFLFGNILGIA 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D+LL   +    +  +   ++PL+  T +   AKA G++  +     +++ +L I   
Sbjct: 132 PSDLLLTGLVTASVLGAIGLWYRPLMIMTFDPTHAKAIGLRLGRWHAGLMVLLALTIVSG 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           I+ +G+ L+ +LL+ P  TAR  +     M  LA + G    I+GLY S +    SG  +
Sbjct: 192 IQAVGVVLVAALLVTPAATARLLTNRLPTMIGLAALFGSSSAILGLYASYMLSIASGGVV 251

Query: 245 IITSLFLFILSFF 257
           ++ S  +F + F 
Sbjct: 252 VLASTGVFAVVFL 264


>gi|15807274|ref|NP_296004.1| manganese ABC transporter permease [Deinococcus radiodurans R1]
 gi|6460090|gb|AAF11829.1|AE002060_8 manganese ABC transporter, permease protein, putative [Deinococcus
           radiodurans R1]
          Length = 268

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 69/257 (26%), Positives = 138/257 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +FF+RAL +   + +    +G +++ + ++Y GD ++H+ L G+  + + +  L +   +
Sbjct: 11  DFFVRALLAVSLVSILCALIGAWVVLRGLSYIGDAMSHAVLPGIVSAFLLKGNLLLGAAI 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A LT+L +  I +   L  D+ +G++     +L +V+LS      +DL++FL G+ L V
Sbjct: 71  AAVLTALGIGWIGRRSGLKQDSAIGIVFVGMFALGIVLLSRAPTFTSDLSNFLIGNPLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+     +      +L  I K LL  + +   A+  G+   ++  + +++  L++ +
Sbjct: 131 TPADLWGALAVTLGVGGLLTAIQKELLLASFDPTEARTVGLPVTRLNNLLLVLIGLVVVL 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G TL  SLLI  +  AR  S S   M +LA  +GILG + GLY S   DT  G +
Sbjct: 191 TVQLVGTTLSVSLLITSSAAARLLSRSLRTMMLLAAALGILGGVSGLYASYYLDTAPGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  +F+L+  +++
Sbjct: 251 IVLVNTAIFLLALAFRR 267


>gi|238791721|ref|ZP_04635358.1| Chelated iron transport system membrane protein yfeD [Yersinia
           intermedia ATCC 29909]
 gi|238728825|gb|EEQ20342.1| Chelated iron transport system membrane protein yfeD [Yersinia
           intermedia ATCC 29909]
          Length = 294

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 123/257 (47%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 11  YPFMQRAIVAAIITGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++ N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 71  VSGIFCAIATGYLKDNSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 130 ISLAELKQTMWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M I+AT++ ++  ++G   S   D  +GP
Sbjct: 190 ASLQAVGVILVIAMLIAPGIIAFMVCRSFDQMLIVATLVSVVACVLGTLISFHIDGATGP 249

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 250 CIVIIQALFFVIALIYS 266


>gi|111024219|ref|YP_707191.1| zinc ABC transporter permease [Rhodococcus jostii RHA1]
 gi|110823749|gb|ABG99033.1| possible ABC Mn(2+)/Zn(2+) transporter, permease component
           [Rhodococcus jostii RHA1]
          Length = 308

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F +RAL + +   +    L C+++    +  GD ++H+ L GV L+ I   P  I   
Sbjct: 13  YDFMVRALITTLIAAVVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFAIGAV 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L   ++  ++    +  DA +G++  +  +L LV++S      TDL   +FG++L 
Sbjct: 73  IFGFLAVALIGVVRDTSRVKEDAAIGIVFSTLFALGLVLVSVTP-SQTDLNHIIFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++ I  +G +  + L    +       +   A A G+ P  +    + + +L   
Sbjct: 132 VSRSDLVQIAILGAVVFVALIVKRRDFTLYAFDPTHAHAIGLNPRLLGAALLGLLALTAV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   + S   M ++A  I     +IGLY S   DT SG 
Sbjct: 192 VALQAVGVILVVAMLIIPGATAYLLTDSFHRMLVIAPAISAACAVIGLYLSYHLDTASGG 251

Query: 243 SIIITSLFLFILSFFY 258
            ++++    F L + +
Sbjct: 252 MVVLSQGAAFALVYLF 267


>gi|145223753|ref|YP_001134431.1| ABC-3 protein [Mycobacterium gilvum PYR-GCK]
 gi|145216239|gb|ABP45643.1| ABC-3 protein [Mycobacterium gilvum PYR-GCK]
          Length = 314

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF +RA  + +        L C+++    +  GD ++H+ L GV L+ I   P  +   +
Sbjct: 14  EFMVRATVTTLIASTVCATLSCWLVLIGWSLMGDAVSHAVLPGVVLAHIVGAPFALGAII 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +   ++  ++       DA +GV+  +  +L LV++S       DL   +FG++L V
Sbjct: 74  FGFVAVGLIGVVRDTSRTKEDAAIGVVFTTLFALGLVLISVTP-SQVDLNHIIFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ +  +G + + +L    +       +   A A G+ P  +    + + +L   V
Sbjct: 133 SRADLIQVAVLGTVVMAVLVYKRRDFTLYAFDPHHAHAIGLNPRLLGAALLGLLALTAVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ +LLI P  TA   +     M ++A  I  +  + GLY S   DT SGP 
Sbjct: 193 ALQAVGVVLVVALLITPGATAYLITERFSRMLLIAPTIAAVCALTGLYASYYLDTASGPM 252

Query: 244 IIITSLFLFILSFFYK 259
           +++ +   F L++  +
Sbjct: 253 VVLANGTAFALAYLAR 268


>gi|238749494|ref|ZP_04610999.1| Chelated iron transport system membrane protein yfeD [Yersinia
           rohdei ATCC 43380]
 gi|238712149|gb|EEQ04362.1| Chelated iron transport system membrane protein yfeD [Yersinia
           rohdei ATCC 43380]
          Length = 281

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 122/254 (48%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+  
Sbjct: 1   MQRAIIAAIVTGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAFISG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L ++ 
Sbjct: 61  IFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLGISL 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            ++     I    ++++    K  +    +   A+  G+  + +    + + +L I  S+
Sbjct: 120 AELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI P + A     S + M ++AT++ +   ++G   S   D  +GP I+
Sbjct: 180 QAVGVILVIAMLIAPGIIAFLVCRSFDQMLLVATLVSVTACVLGTLISFHIDGATGPCIV 239

Query: 246 ITSLFLFILSFFYK 259
           I     F+++  Y 
Sbjct: 240 IIQALFFVVALIYN 253


>gi|332706691|ref|ZP_08426752.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
 gi|332354575|gb|EGJ34054.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
          Length = 295

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 71/256 (27%), Positives = 143/256 (55%), Gaps = 1/256 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R+L + + + +    +G +++ QR+A  GD I+HS L G+A++ +    + +  F+ 
Sbjct: 13  FMQRSLITAVLVGIVCAAVGSYLMVQRLALLGDAISHSVLPGLAIAFMIGADIFVGAFIA 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGDILAV 123
             ++++V+  I+    +  DA +G++  +  +L + +++ M+  N  DL  FLFG+IL+V
Sbjct: 73  GVVSTVVITWIRTRSQIKEDAAMGIVFSAFFALGITLITVMQKDNKIDLNHFLFGNILSV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +++    I  + + I+  ++K L+  T +   AKA G+    +    +++ +L I  
Sbjct: 133 TNEEVINTAIITAIVLSIILLLYKELMYYTFDPLGAKAAGLPTNLLNFGLMILIALTIVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K +G+ L+ ++LI P  TA         M IL + +G++  I G+Y S  F+ PSGP+
Sbjct: 193 SLKGVGVILVLAMLITPGATAYLLVHRLHQMMILGSALGVVASITGMYLSYFFNLPSGPA 252

Query: 244 IIITSLFLFILSFFYK 259
           I++ +  LF+L+F + 
Sbjct: 253 IVLVAFGLFMLAFLFS 268


>gi|119487942|ref|ZP_01621439.1| ABC-3 [Lyngbya sp. PCC 8106]
 gi|119455518|gb|EAW36656.1| ABC-3 [Lyngbya sp. PCC 8106]
          Length = 297

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 76/258 (29%), Positives = 138/258 (53%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ I    + I  F
Sbjct: 11  YSFMQRSLIVAILVGLICAVVGSYLMVQRLALLGDAISHSVLPGLAIAYIVGANIFIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGDIL 121
           +   ++++ +  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+IL
Sbjct: 71  IAGVISTVFINLIRTRSNIKEDAAMGIVFSAFFALGITLITIIQKDNKIDLNHFLFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V   ++     I  + I+I+  I+K LL  T +   A+A G+    +    +++ +L I
Sbjct: 131 GVTLGEVRDTAIIAVIVILIVVLIYKELLFYTFDPLGAEAVGLPVNLLNFGLMVLIALTI 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S+K +G+ L+ SLLI P  TA    +   +M      +G+L  I G+Y S  F+ PSG
Sbjct: 191 VASLKAVGVVLVLSLLITPAGTAYLLVSRLHHMMFCGVGVGVLSSISGMYLSYYFNLPSG 250

Query: 242 PSIIITSLFLFILSFFYK 259
           P+I++ +  LF L+F + 
Sbjct: 251 PAIVLVASGLFTLAFLFS 268


>gi|15965666|ref|NP_386019.1| high-affinity zinc uptake system membrane ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307315675|ref|ZP_07595204.1| ABC-3 protein [Sinorhizobium meliloti BL225C]
 gi|307321424|ref|ZP_07600822.1| ABC-3 protein [Sinorhizobium meliloti AK83]
 gi|15074847|emb|CAC46492.1| Probable high-affinity zinc uptake system membrane ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306892969|gb|EFN23757.1| ABC-3 protein [Sinorhizobium meliloti AK83]
 gi|306898662|gb|EFN29327.1| ABC-3 protein [Sinorhizobium meliloti BL225C]
          Length = 275

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 144/257 (56%), Positives = 205/257 (79%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+  L L + 
Sbjct: 1   MLDDFFIRALVAGIGIAMVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLMDLNLMVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A++ S++LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFIVASVVSVLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI ++WG G L I  L  +W+PLLA+TVN ELA+AEG+ PE+ +  F+++ +L+
Sbjct: 121 LAVSRADIDIVWGGGILVIFALVYLWRPLLASTVNPELAEAEGLNPERARFFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRF++SPE MA+ A++IG + +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFASSPEVMAVCASLIGAVAVAGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LF+LS  
Sbjct: 241 GPSIVVAALVLFVLSLL 257


>gi|326793511|ref|YP_004311331.1| ABC-type transporter integral membrane subunit [Marinomonas
           mediterranea MMB-1]
 gi|326544275|gb|ADZ89495.1| ABC-type transporter, integral membrane subunit [Marinomonas
           mediterranea MMB-1]
          Length = 265

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 110/253 (43%), Positives = 177/253 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E   RAL  G+G+    GPLG F++W+R+AYFGDT+AHSALLG+AL  +F + L + I +
Sbjct: 3   ELMFRALVGGLGVAAIAGPLGAFVVWRRMAYFGDTLAHSALLGIALGFLFDVNLNLAIIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +  L+ +QK   +++D +LG++ HS++SL +V +SF+  V  DL S+LFGD+LAV
Sbjct: 63  LCVGLAAALVTLQKKHIIATDTLLGILAHSSLSLGMVAVSFLDDVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I+G G   +++L   WKPLLA TVN ELAK EG   E  +L+ +++ +L+I++
Sbjct: 123 SQNDLYWIYGGGIAVLLLLAVFWKPLLAMTVNEELAKVEGYPVETTRLLLMLLVALVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSL+I+P  TAR+ S +P  MA +A++IG L +  GL+ S  +DTP+GPS
Sbjct: 183 AMKIVGVLLITSLMIIPAATARKLSQTPVQMASMASLIGCLSVCGGLWASYQWDTPTGPS 242

Query: 244 IIITSLFLFILSF 256
           +++ +  LF++++
Sbjct: 243 VVVCAATLFLVAY 255


>gi|308178815|ref|YP_003918221.1| iron/manganese/zinc ABC transporter inner membrane subunit
           [Arthrobacter arilaitensis Re117]
 gi|307746278|emb|CBT77250.1| iron/manganese/zinc ABC transporter, inner membrane subunit
           [Arthrobacter arilaitensis Re117]
          Length = 295

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 130/257 (50%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF +RAL + +   +    L C+++    +  GD ++H+ L GV L+ I   P  +   
Sbjct: 13  YEFMLRALITTLTASVVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFALGAV 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L  L++  ++    +  DA +G++  +  SL LV++S     +TDL   +FG++L 
Sbjct: 73  IFGFLAVLLIGIVRDTSRVKEDAAIGIVFTTLFSLGLVLISVTP-AHTDLNHIIFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ TD+  I  +G L + IL    +       +   A A G+ P  +  + + + +    
Sbjct: 132 VSWTDLAQIIILGALTLAILLTKRRDFTLYAFDPTHAHAIGLNPRLLGALLLALLATTAV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   +     M ++A +I  L  +IGLY S  FDT SG 
Sbjct: 192 VALQAVGVILVVAMLIIPGATAYLLTNRFSRMLMIAPLIAALCAVIGLYASYYFDTASGG 251

Query: 243 SIIITSLFLFILSFFYK 259
            ++++    F L++ + 
Sbjct: 252 MVVLSQGAAFFLAYLFS 268


>gi|148558596|ref|YP_001257989.1| zinc ABC transporter permease [Brucella ovis ATCC 25840]
 gi|148369881|gb|ABQ62753.1| zinc ABC transporter, permease protein [Brucella ovis ATCC 25840]
          Length = 286

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 140/256 (54%), Positives = 203/256 (79%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDT+AHSALLGVAL+LIF + L + +
Sbjct: 15  LDDFFTRAIIAGIGLALTTGPLGCFIIWRRMAYFGDTMAHSALLGVALALIFDINLMVGV 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F +A   S +LL +Q+   LS+D++LG+++H+T+SL LV+++FM WV  DL SFLFGDIL
Sbjct: 75  FAVAVAISAILLLLQRRHTLSADSLLGILSHATLSLGLVLMAFMTWVRVDLLSFLFGDIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+  DI  I+G G L +  L  +W+PLLA TV+ ++A+AEGM P   ++IF+++ +++I
Sbjct: 135 AVSRIDIAFIYGGGALILAALAWLWRPLLAATVSEDIARAEGMNPALSRIIFMLLLAIVI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +GI LITSLLI+P  TARRF+++PE MA+LA++IG  G+I GLYGS+ FDTPSG
Sbjct: 195 AIAMKIVGILLITSLLIIPAATARRFASTPEQMAVLASLIGAAGVIGGLYGSIHFDTPSG 254

Query: 242 PSIIITSLFLFILSFF 257
           PSI++ +L +FILS  
Sbjct: 255 PSIVVAALAIFILSLL 270


>gi|325577787|ref|ZP_08148062.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325160532|gb|EGC72658.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 277

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 130/257 (50%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F+
Sbjct: 15  DFMQNALLTALVVAVICALLSCYLVLKGWSLMGDAISHAVLPGIVLAFLAGIPLVIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++  +  LT  LFG++L V
Sbjct: 75  SGITCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVLFTKIQ-TSQHLTHILFGNVLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +  ++L    +  L    +   A+  G+ P+ +    + + +L I  
Sbjct: 134 SRQELIQTAIIALIIFILLGLKRRDFLLYCFDPSHARVAGLSPKLLHYGLLTLLALTIVS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   +   + M ++A I  +   ++G+  S  FD  +G  
Sbjct: 194 TMQVVGVILVVAMLIAPGITALTLTNRFDKMLVIAIISAVTASLLGVLLSYHFDASTGAC 253

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 254 IILLQALFFLIALVYSK 270


>gi|320335080|ref|YP_004171791.1| ABC transporter integral membrane subunit [Deinococcus maricopensis
           DSM 21211]
 gi|319756369|gb|ADV68126.1| ABC-type transporter, integral membrane subunit [Deinococcus
           maricopensis DSM 21211]
          Length = 279

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 69/257 (26%), Positives = 140/257 (54%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EFF RAL   + + +    +G +++ + ++Y GD ++H+   G+  + +    L I   +
Sbjct: 16  EFFTRALIGVVLVSVLCAMVGAYVVLRGLSYIGDAMSHAVFPGIVGAYLLHANLLIGAIL 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            + LTSL +  + +   L  D+ +G++     +L + +LS     + DL SFL G+ L V
Sbjct: 76  ASILTSLGIGYVTQRSGLRQDSAIGIVFVGMFALGVTLLSRADGGSRDLASFLVGNPLGV 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+ L   +  +  ++L  + K LL  + +   A+A G+   ++  + +++  L++ +
Sbjct: 136 SGADLTLAAVVTGVVALVLLGVQKELLLVSFDPTEARAIGLPVRRLNNLLLILIGLVVVL 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +I+ +G TL  S+LI  + +AR  +TS + M +LA ++G +G   GLY S   D   G +
Sbjct: 196 TIQLVGTTLSVSMLITSSASARLLTTSLKRMMVLAAVLGSVGGAAGLYASYYLDLAPGAT 255

Query: 244 IIITSLFLFILSFFYKK 260
           I++T+  +F+LS  +++
Sbjct: 256 IVLTNTAVFLLSLMFRR 272


>gi|253989341|ref|YP_003040697.1| chelated iron transport system membrane protein Yfed [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780791|emb|CAQ83953.1| chelated iron transport system membrane protein yfed homolog
           [Photorhabdus asymbiotica]
          Length = 295

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 120/257 (46%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RA+F+ I        L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+
Sbjct: 15  PFMQRAIFAAIVTGAVCAMLSCYLVLKGWSLMGDAISHAVLPGIVLAFAAGIPLAIGAFL 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +     ++++  +  D ++G++     +  LV+ + M   +  LT  LFG++L +
Sbjct: 75  SGIFCAFATGYLKEHSRIKEDTVMGIVFSGMFAFGLVLFARM-DTDQHLTHILFGNMLGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              ++     I  + ++++    K  +    +   A+  G+  + +    + + ++ I  
Sbjct: 134 TKDELNQTLWITCITMIVILLKRKDFMLYCFDPNQARVVGLPIKFLHYGLLCLLAMTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ ++LI P + A     S + M I+A I  +   ++G   S   D  +GP 
Sbjct: 194 SLQAVGMILVIAMLISPGIIAFTLCRSFDRMLIVAVIASVSSCVLGTLISFHIDGATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I+I     F L+  Y +
Sbjct: 254 IVIVQAIFFTLALTYSQ 270


>gi|301154688|emb|CBW14151.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 277

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 130/257 (50%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F+
Sbjct: 15  DFMQNALLTALVVAVICALLSCYLVLKGWSLMGDAISHAVLPGIVLAFLAGIPLVIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L +  +++N  +  D  +G++     ++ LV+ + ++  +  LT  LFG++L V
Sbjct: 75  SGIACALGVGYLKENSRIKEDTAMGIVFSGMFAIGLVLFTKIQ-TSQHLTHILFGNVLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +  ++L    +  L    +   A+  G+ P+ +    + + +L I  
Sbjct: 134 SRQELIQTAIIALIIFILLGLKRRDFLLYCFDPSHARVAGLSPKLLHYGLLTLLALTIVS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ ++LI P +TA   +   + M ++A I  +   ++G+  S  FD  +G  
Sbjct: 194 SMQVVGVILVVAMLIAPGITALTLTNRFDKMLVIAIISAVTASLLGVLLSYHFDASTGAC 253

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 254 IILLQAVFFLIALIYSK 270


>gi|254412155|ref|ZP_05025930.1| ABC 3 transport family [Microcoleus chthonoplastes PCC 7420]
 gi|196181121|gb|EDX76110.1| ABC 3 transport family [Microcoleus chthonoplastes PCC 7420]
          Length = 295

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 145/260 (55%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L + + + +    +G +++ QR+A  GD I+HS L G+A++ I  + + + 
Sbjct: 9   LQYSFMQRSLMTAVLVGIVCASVGSYLMVQRLALLGDAISHSVLPGLAIAYIVGVDIFLG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   ++++V+  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFLAGIVSTIVITWIRTRSQIKEDAAMGIVFSAFFALGITLITVIQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL+V   +++    I  + + I+  ++K L+  T +   AKA G+    +    +++ +L
Sbjct: 129 ILSVTGEEVINTAIITAIVLAIVLLLYKELMYYTFDPVGAKAAGLPTNLLNFGLMILIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ ++LI P  TA    T    M +L + IG++  I G+Y S  F+ P
Sbjct: 189 TIVASLKAVGVILVLAMLITPGATAYLLVTRLHQMMLLGSGIGVVASISGMYLSYFFNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +   F+L+F + 
Sbjct: 249 SGPAIVLVTFGFFMLAFLFS 268


>gi|315444080|ref|YP_004076959.1| ABC-type Mn2+/Zn2+ transporter, permease component [Mycobacterium
           sp. Spyr1]
 gi|315262383|gb|ADT99124.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Mycobacterium sp. Spyr1]
          Length = 314

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF +RA  + +        L C+++    +  GD ++H+ L GV L+ I   P  +   +
Sbjct: 14  EFMVRATVTTLIASTVCATLSCWLVLIGWSLMGDAVSHAVLPGVVLAHIVGAPFALGAII 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +   ++  ++       DA +GV+  +  +L LV++S       DL   +FG++L V
Sbjct: 74  FGFVAVGLIGVVRDTSRTKEDAAIGVVFTTLFALGLVLISVTP-SQVDLNHIIFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ +  +G + + ++    +       +   A A G+ P  +    + + +L   V
Sbjct: 133 SRADLIQVAVLGTVVMAVMVYKRRDFTLYAFDPHHAHAIGLNPRLLGAALLGLLALTAVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ +LLI P  TA   +     M ++A  I  +  + GLY S   DT SGP 
Sbjct: 193 ALQAVGVVLVVALLITPGATAYLITERFSRMLLIAPTIAAVCALTGLYASYYLDTASGPM 252

Query: 244 IIITSLFLFILSFFYK 259
           +++ +   F L++  +
Sbjct: 253 VVLANGTAFALAYLAR 268


>gi|205373101|ref|ZP_03225905.1| manganese ABC transporter membrane protein [Bacillus coahuilensis
           m4-4]
          Length = 437

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 125/262 (47%), Gaps = 10/262 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-----QLPLTICI 61
              L S + + +++G LG F + ++ +  GD +AH+AL G+ ++ +       + L I  
Sbjct: 15  QWVLLSTLLLGIASGVLGSFALLRKQSLIGDAVAHAALPGICIAFLLIGEKDFISLLIGA 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV----NTDLTSFLF 117
                L + ++  I     +  D  +G++        +++L+ +        + L  F+F
Sbjct: 75  TFTGLLAAYLIQFITSQSRIKEDTSIGLVLSVFFGAGIMLLTKVAQSPSGNKSGLDDFIF 134

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   D+ ++       I++ F ++K    +T + E A+  G+    +  +F+ + 
Sbjct: 135 GQAASLVGLDVQIMMVTALALIVVTFALFKEFKLSTFDPEFARGIGLPVGFLNFLFLSLL 194

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS-LIF 236
            + + + I+ +G+ ++ +LLI P + AR ++ S   M I+A ++G    I G   S L  
Sbjct: 195 VITVVIGIQAVGVIMMAALLITPAIAARFWTDSLGIMVIVAGLVGAFSGIAGTSISTLQR 254

Query: 237 DTPSGPSIIITSLFLFILSFFY 258
              +GP I++ +  +F+LS  +
Sbjct: 255 GLSTGPLIVLVATVVFVLSMLF 276


>gi|75907821|ref|YP_322117.1| hypothetical protein Ava_1599 [Anabaena variabilis ATCC 29413]
 gi|75701546|gb|ABA21222.1| ABC-3 [Anabaena variabilis ATCC 29413]
          Length = 281

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 137/260 (52%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ +    + + 
Sbjct: 9   LQYGFMQRSLVIAILVGLLCAVVGSYLMVQRLALLGDAISHSVLPGLAIAFMVGANIFVG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   L+++ +  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFIAGVLSTIAIAWIRTRSPIKEDAAMGIVFSAFFALGITLITVVQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   ++     I  + + ++  ++K LL  T +   A+A G+   ++    +++ +L
Sbjct: 129 ILGVTVDEVRDTAIIAAIVLTVVILLYKELLFYTFDPLGAQAAGLPVNRLNFGLMLLIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL   IG+   I G+Y S  ++ P
Sbjct: 189 TIVASMKAVGVILVLSLLITPGATAYLLVKRLHQVMILGAGIGVFSSISGMYLSYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++    LF+L+  + 
Sbjct: 249 SGPAIVLVVSGLFLLALLFS 268


>gi|330972142|gb|EGH72208.1| hypothetical protein PSYAR_16765 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 262

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPPAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|311069572|ref|YP_003974495.1| manganese ABC transporter permease [Bacillus atrophaeus 1942]
 gi|310870089|gb|ADP33564.1| manganese ABC transporter permease [Bacillus atrophaeus 1942]
          Length = 437

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 59/262 (22%), Positives = 132/262 (50%), Gaps = 10/262 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-----LPLTICI 61
              L   + + +++G LG F++ ++ +  GD +AHSAL GV ++ +       L   +  
Sbjct: 15  QWVLAGTLLLGIASGVLGSFVLLRKQSLIGDAMAHSALPGVCIAFLLTGQKSLLFFLVGA 74

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
            +   L +  + QI  +  +  D+ +G++      + +++L++++       + L SFLF
Sbjct: 75  AVFGLLGTWCIQQITGHSKIKEDSAIGIVLSVFFGVGIMLLTYIQQLGSGNQSGLDSFLF 134

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI++I  I  + +++    +K     T +   AK  GM  + +  + +++ 
Sbjct: 135 GQAASLVRQDIVIIAVISAVLLLVCAVFFKEFKIITFDMAFAKGLGMPVQFLNGLLVLLI 194

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD 237
              + + ++ +G+ ++ ++LI P V AR ++ +   MA++A +IG +    G   S   +
Sbjct: 195 VCAVVIGLQTVGVIMMAAMLITPAVAARYWTENLRAMAVIAGLIGGISGASGTLLSTTMN 254

Query: 238 -TPSGPSIIITSLFLFILSFFY 258
              +GP II+T+  +F+LS  +
Sbjct: 255 GMATGPLIILTATCVFLLSLLF 276


>gi|88797732|ref|ZP_01113320.1| high-affinity zinc uptake system membrane protein ZnuB [Reinekea
           sp. MED297]
 gi|88779409|gb|EAR10596.1| high-affinity zinc uptake system membrane protein ZnuB [Reinekea
           sp. MED297]
          Length = 284

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 110/254 (43%), Positives = 171/254 (67%), Gaps = 1/254 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +G+G+ L+  PLGCF+IW+R+AY GD  AH+++LGVALSLIF LPLT+ 
Sbjct: 1   MLDDFLIRAALAGLGVNLTAAPLGCFVIWRRMAYLGDATAHASILGVALSLIFSLPLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++      +L     N   + D +LGV++HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  V-LLTASLMALLSLALSNRGWAMDTLLGVLSHSALAIGLVAVSFVSGIRIDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+L IW   FL + +L   W  LL  T+N +LA A G+ P++ +LI  +  +++
Sbjct: 120 LAVSQTDLLTIWVGAFLVVGMLAYRWSNLLLVTLNPDLAIASGIDPKREQLILTLSLAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR  S +PE MA+L+ +IG     +GL  S  FDTP+
Sbjct: 180 VAVAIKIVGVLLIVAMLIIPAAGARPLSRTPETMAMLSAVIGGSASGLGLIASYQFDTPT 239

Query: 241 GPSIIITSLFLFIL 254
           GP+I+ T+  LF+L
Sbjct: 240 GPTIVCTATLLFLL 253


>gi|320010912|gb|ADW05762.1| ABC-3 protein [Streptomyces flavogriseus ATCC 33331]
          Length = 298

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/252 (22%), Positives = 129/252 (51%), Gaps = 1/252 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          +
Sbjct: 8   PFMQRALIAAVLVGITAPAIGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSTNPVWMATL 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           +A   S+V+  I+       D  L ++ +  ++  +++++      N +LTSFLFG +  
Sbjct: 68  VAVAGSVVMELIRWYGRTRGDIALAMLFYGGMAGGVMLINLSDTGSNANLTSFLFGSLST 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ ++
Sbjct: 128 VSEEDVTAIVVLAAFVVLVTVGLRRQLFAVSQDEEFARVTGLPVRALNLLVAVTAAITVT 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ + S +   +LA +IG    + G   S   D P G 
Sbjct: 188 VAMRVVGLLLVSALMVVPVAAAQQIAKSFKVTFVLAVVIGTAVALAGTVTSYYQDVPPGA 247

Query: 243 SIIITSLFLFIL 254
           +I++ ++  FI+
Sbjct: 248 TIVLLAIAAFIV 259


>gi|114320353|ref|YP_742036.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226747|gb|ABI56546.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 273

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 111/255 (43%), Positives = 179/255 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F +RAL +G G+    GPLG F++W+R+AYFGDT+AHSALLGVAL  +  L + + I
Sbjct: 1   MDDFLLRALLAGFGLAAVAGPLGSFVVWRRMAYFGDTLAHSALLGVALGFLIGLNVNLGI 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            ++    +++L+ ++  + L+ D ILG++ HST+SL LV L+F++ V  DL ++LFGDIL
Sbjct: 61  LLVCGALAVLLVVLRSRQRLADDTILGIMAHSTLSLGLVSLAFLEHVRVDLMAYLFGDIL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  T++  IW  G   + +L  IW+PLL  T++ ELA+AEG+    ++L+F+ + + +I
Sbjct: 121 AVGPTELWWIWLGGLAVLGVLALIWRPLLTMTLHEELARAEGVPLLPMQLLFMGLMAGVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++  +GI L+TSLLI+P  TAR F+ +PE MA+LA+++G L +  GL GS  +D P+G
Sbjct: 181 AIAMNIVGILLVTSLLIIPAATARLFARTPEQMAVLASLLGCLAVAGGLRGSWNWDLPTG 240

Query: 242 PSIIITSLFLFILSF 256
           P+I++T+  LF L+ 
Sbjct: 241 PAIVVTATLLFTLAM 255


>gi|291288047|ref|YP_003504863.1| ABC-3 protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290885207|gb|ADD68907.1| ABC-3 protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 496

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 130/265 (49%), Gaps = 11/265 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF----------Q 54
           +F++AL  G  + +     GC +I QR+A+ GD ++H+ + GV    +F           
Sbjct: 16  YFLKALIGGSIVAVVCAVAGCLVILQRMAFLGDALSHAMIAGVGAGYLFMKVFFGIEAAA 75

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILS-FMKWVNTDLT 113
             + +   + A +T  ++  + K   +  D  +G++     +  +V++S F K+++ D+ 
Sbjct: 76  GAMLVGSLIAAMITVFMIGFVAKVSRIKEDTSIGIMYTGIFAAGVVLVSVFSKYIHIDIV 135

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            F+ GDIL ++ TD+++   +    + ++   ++    T+ +  +A + G+     K +F
Sbjct: 136 HFIMGDILGISDTDMIVSSIVSATVLSVIILFFRYFKLTSFDPVMAASIGVPVLFFKYLF 195

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
               SL++  ++  +G+ L+  LLI P  TA   +   E M  LA + G   I+ GLY S
Sbjct: 196 TGCVSLIVVSAVSMVGVILVVGLLITPAATAYLLTDRLEKMMALAALFGFTSILGGLYLS 255

Query: 234 LIFDTPSGPSIIITSLFLFILSFFY 258
           L  ++  G +I++ +   F+    +
Sbjct: 256 LWMNSAGGGAIMLFATVQFLAVLIF 280


>gi|227327804|ref|ZP_03831828.1| chelated iron transport system membrane protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 285

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/256 (21%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + +        L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F
Sbjct: 13  YPFMQRALLAAVVTGTVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFLLGIPLVIGAF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G+I     +L LV+ + +   +  L   LFG++L 
Sbjct: 73  VSGIFCAVATGYVKEHSRVKEDTVMGIIFSGMFALGLVMFARI-DTDQHLNHILFGNVLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++  I  I  + + I+    +  +    +   A+  G+  + +    + + ++ I 
Sbjct: 132 ITQQELTQILLIAGVTLAIILLKRRDFMLYCFDPNHARVIGLPVKLLHYGLLSLLAMTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A       E M ++AT++ ++  I G   S   D  +GP
Sbjct: 192 ASLQAVGVILVIAMLIAPGIIAFMVCKRFERMVLVATLVSVISCIAGTLISFYIDGATGP 251

Query: 243 SIIITSLFLFILSFFY 258
            I+I     F L+  Y
Sbjct: 252 CIVIVQALFFTLALTY 267


>gi|222148616|ref|YP_002549573.1| ABC transporter membrane spanning protein (zinc) [Agrobacterium
           vitis S4]
 gi|221735602|gb|ACM36565.1| ABC transporter membrane spanning protein (zinc) [Agrobacterium
           vitis S4]
          Length = 270

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 135/257 (52%), Positives = 206/257 (80%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +G+G+ L+ GPLGCF+IW+R+AYFGDT+AHS+LLGVALSL+F + LT+ 
Sbjct: 1   MMDDFFVRALLAGVGLALTVGPLGCFVIWRRMAYFGDTMAHSSLLGVALSLLFSVNLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A + SL+LL +Q    LS+DA+LG+++H+T+++ LV+++FM WV  DL ++LFGDI
Sbjct: 61  VFLVAAIVSLLLLLLQNRRGLSADALLGILSHATLAIGLVLVAFMTWVRVDLMAYLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   DI  +W  G   I+ L  +W+PLLA TVN ++A+AEG++P + +LIF+++ +++
Sbjct: 121 LAVTPQDIATVWIGGLGVILCLCLLWRPLLAATVNEDVAEAEGLRPARARLIFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LIT+LLI+P  TARRFS +PE MA+LA++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGILLITALLIIPAATARRFSMTPEIMAVLASVIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALVLFILSLL 257


>gi|50121323|ref|YP_050490.1| chelated iron transport system membrane protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611849|emb|CAG75298.1| chelated iron transport system membrane protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 285

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/256 (21%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + +        L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F
Sbjct: 13  YPFMQRALLAAVVTGTVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFLLGIPLVIGAF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G+I     +L LV+ + +   +  L   LFG++L 
Sbjct: 73  VSGIFCAVATGYVKEHSRVKEDTVMGIIFSGMFALGLVMFARI-DTDQHLNHILFGNVLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++  I  I  + + I+    +  +    +   A+  G+  + +    + + ++ I 
Sbjct: 132 ITQQELTQILLIAGVTLAIILLKRRDFMLYCFDPNHARVIGLPVKLLHYGLLSLLAMTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A       E M ++AT++ ++  I G   S   D  +GP
Sbjct: 192 ASLQAVGVILVIAMLIAPGIIAFMICKRFERMVLVATLVSVISCIAGTLISFYIDGATGP 251

Query: 243 SIIITSLFLFILSFFY 258
            I+I     F L+  Y
Sbjct: 252 CIVIVQALFFTLALTY 267


>gi|322515098|ref|ZP_08068105.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
 gi|322118904|gb|EFX91086.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
          Length = 289

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   ALF+ + +      L C++I +  +  GD+I+H+ L GV +S +  LPL +  F 
Sbjct: 15  EFMQTALFTAVLVASVCAVLSCYLILKGWSLMGDSISHAVLPGVVVSSLLGLPLAVGAFA 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  L  D I+G+      +  +V+ + +      LT  LFG++L V
Sbjct: 75  SGLFCAISVGYLKENSRLKEDTIMGITFAGLFAFGIVLFTALP-TEQHLTHLLFGNLLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +++    I  +   ++    K  L    +   AK  G+  + +    + + +L I  
Sbjct: 134 TQAELIQTMIICAITFSMIIFKRKDFLLYCFDSRHAKVIGLPVKWLHYGLLALLALTIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA + S   + M ++A  I I   + G   S   D  +GP+
Sbjct: 194 AMQVVGVILVVAMLIAPGITAYQLSNRFDYMLVIAMTIAISSSVFGTILSYHIDAATGPT 253

Query: 244 IIITSLFLFILSFFYKK 260
           II+    LF+L+  + +
Sbjct: 254 IILIQSSLFVLALCFSR 270


>gi|288555767|ref|YP_003427702.1| Mn2+ ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288546927|gb|ADC50810.1| ABC transporter permease protein Mn2+ [Bacillus pseudofirmus OF4]
          Length = 292

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 80/258 (31%), Positives = 150/258 (58%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   +  +AL + + + +  G +GCFII + +A  GD I+H+ L GV +S +  +     
Sbjct: 12  MRYPYLQQALLAAVLVGIICGVIGCFIILRGMALMGDAISHAVLPGVVVSYMIGINFFFG 71

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   LT+L +  + +N  +  D+ +G++  +  +L +V+++ ++    DL   LFG++
Sbjct: 72  AVLTGVLTALAIGYVSQNSRIKDDSAIGILFTAAFALGIVMITGLRGTGVDLWHILFGNV 131

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+ +  GIGF  I+++   ++PLL +T +  +AKA G+    I  + +++ SL+
Sbjct: 132 LAVSRTDLWVTAGIGFFVILLIVIFYRPLLISTFDPVMAKATGIPVRFIHYLLMLLLSLV 191

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S+K +GI L+ ++LI P  TA   +     M  L+ + G++  I+G+Y S+I+D  S
Sbjct: 192 TVASLKSVGIVLVVAMLITPGATAYLLTDRLPVMLSLSAVFGVISAIVGIYFSVIYDVAS 251

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++ +  LF L+FF+
Sbjct: 252 GASIVLAASVLFGLAFFF 269


>gi|159027756|emb|CAO89626.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 301

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 72/260 (27%), Positives = 140/260 (53%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++ I    L + 
Sbjct: 13  LQYSFMQRSLIEAIIVGIICAVVGTYLMVQRLALLGDAISHSVLPGLAIAFIGNFNLLLG 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
             + + +++L++  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 73  ALLASMVSTLLINLIRNRSPIKEDAAMGIVFSAFFALGITLITLIQKNNKIDLNHFLFGN 132

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   +I     I  + ++ +  ++K LL  T +   A+A G+    + L  +++  L
Sbjct: 133 ILGVTADNIRDTLIIAVIVLLTVLLLYKELLFYTFDKIGAQAAGLPVNLLDLGLMLLIGL 192

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S++ +G+ L+ SLLI P  TA    T    +  +   +GI+  I G+Y S  ++ P
Sbjct: 193 TIVASLQAVGVILVLSLLITPAATAYLLVTRLHQVMGMGVGVGIISSISGMYLSYYWNLP 252

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+L+F + 
Sbjct: 253 SGPAIVLVTFTLFMLAFLFS 272


>gi|227111518|ref|ZP_03825174.1| chelated iron transport system membrane protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 285

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/256 (21%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + +        L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F
Sbjct: 13  YPFMQRALLAAVVTGTVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFLLGIPLVIGAF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G+I     +L LV+ + +   +  L   LFG++L 
Sbjct: 73  VSGIFCAVTTGYVKEHSRVKEDTVMGIIFSGMFALGLVMFARI-DTDQHLNHILFGNVLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++  I  I  + + I+    +  +    +   A+  G+  + +    + + ++ I 
Sbjct: 132 ITQQELTQILLIAGVTLAIILLKRRDFMLYCFDPNHARVIGLPVKLLHYGLLSLLAMTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A       E M ++AT++ ++  I G   S   D  +GP
Sbjct: 192 ASLQAVGVILVIAMLIAPGIIAFMVCKRFERMVLVATLVSVISCIAGTLISFYIDGATGP 251

Query: 243 SIIITSLFLFILSFFY 258
            I+I     F L+  Y
Sbjct: 252 CIVIVQALFFTLALTY 267


>gi|33240508|ref|NP_875450.1| ABC-type Mn2+/Zn2+ transport system permease components
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33238036|gb|AAQ00103.1| ABC-type Mn2+/Zn2+ transport system permease components
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 291

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 130/256 (50%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F  RAL     +    G L C++  +  A  GD ++H+ + GV ++    +P ++  F
Sbjct: 22  HDFMRRALAISALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYAIGIPFSVGAF 81

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +  ++  +++   +  D ++G++     +L LV++S +K  N DL   LFG  L 
Sbjct: 82  VFGVGSVALIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKIK-SNIDLMHILFGSPLG 140

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ +D+     I  + + IL    K L+    + + A++ G+    +  + + + SL   
Sbjct: 141 ISNSDVNQTVLICIIVLAILLIFRKDLMLYCFDAKHARSIGINTVFLHYLLLSVLSLAAV 200

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++LI P  TA   +   + M +LA I  ++  ++G+Y S   D  +G 
Sbjct: 201 AGLQTVGIILVVAMLITPGATAYLLTDRFDRMTLLAVISSMISSLLGVYISYWSDIETGG 260

Query: 243 SIIITSLFLFILSFFY 258
           SI++   F+F+L+F +
Sbjct: 261 SIVLVQTFIFLLAFLF 276


>gi|238753698|ref|ZP_04615060.1| Chelated iron transport system membrane protein yfeD [Yersinia
           ruckeri ATCC 29473]
 gi|238708250|gb|EEQ00606.1| Chelated iron transport system membrane protein yfeD [Yersinia
           ruckeri ATCC 29473]
          Length = 281

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 123/254 (48%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+  
Sbjct: 1   MQRAILAAIVTGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLAIGAFVSG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L +  
Sbjct: 61  IFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLGITR 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            ++     I  + ++++    K  +    +   A+  G+  + +    + + ++ I  S+
Sbjct: 120 DELEQTLWIAAITLLVVLLKRKDFMLYCFDPHHARIIGLPVKLLHYGLLCLLAMTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI P + A     S + M I+AT++ ++  ++G   S   D  +GP I+
Sbjct: 180 QAVGVILVIAMLIAPGIIAFMLCRSFDRMLIIATLVSVIACVLGTLISFHIDGATGPCIV 239

Query: 246 ITSLFLFILSFFYK 259
           I     F+++  Y 
Sbjct: 240 IIQALFFVITLIYS 253


>gi|87310377|ref|ZP_01092507.1| hypothetical protein DSM3645_29801 [Blastopirellula marina DSM
           3645]
 gi|87286876|gb|EAQ78780.1| hypothetical protein DSM3645_29801 [Blastopirellula marina DSM
           3645]
          Length = 513

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/264 (21%), Positives = 124/264 (46%), Gaps = 11/264 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ---------- 54
           +  RA+F+G  + +++  +GCFI+ +R+A+ GD I+HS L GV    +            
Sbjct: 17  YLFRAMFAGSLVAIASSMIGCFIVLRRMAFLGDAISHSMLAGVVGGYLLMKLIAGEEAHF 76

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILS-FMKWVNTDLT 113
             + I   +   +T L++  + +   +  D  +G++     +    + S F   ++ DL 
Sbjct: 77  GAMIIGALLAGFVTVLLIGFVSRASRIKDDTAIGIMYTGIFAFGGAMASVFSSEIHVDLM 136

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
             + GD+L V+   + ++  +  + + ++   ++ L  T+ +  +A + G+    I  + 
Sbjct: 137 HMVMGDVLVVDAERLWMMGAVTAIILFVVILFYRQLQLTSFDPIMAASVGVSAPLIGYLL 196

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
              TSL++  ++  +GI  +  LLI P   A        +M +L+  +G+  +++G+Y S
Sbjct: 197 TACTSLVVVSAVSIVGIIQVVGLLITPAAAAYLLCNRLSSMLVLSAALGVSSVVLGVYTS 256

Query: 234 LIFDTPSGPSIIITSLFLFILSFF 257
              +  +G SI++     F+    
Sbjct: 257 AWLNIGAGSSIVMAGTLQFMAILI 280


>gi|17231066|ref|NP_487614.1| permease protein of ABC transporter [Nostoc sp. PCC 7120]
 gi|17132707|dbj|BAB75273.1| permease protein of ABC transporter [Nostoc sp. PCC 7120]
          Length = 281

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 137/260 (52%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ +    + + 
Sbjct: 9   LQYGFMQRSLVIAILVGLLCAVVGSYLMVQRLALLGDAISHSVLPGLAIAFMVGANIFVG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   L+++ +  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFIAGVLSTIAIAWIRTRSPIKEDAAMGIVFSAFFALGITLITVVQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   ++     I  + + ++  ++K LL  T +   A+A G+   ++    +++ +L
Sbjct: 129 ILGVTVDEVRDTAIIAAIVLTVVILLYKELLFYTFDPLGAQAAGLPVNRLNFGLMLLIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL   IG+   I G+Y S  ++ P
Sbjct: 189 TIVASMKAVGVILVLSLLITPGATAYLLVKRLHQVMILGAGIGVFSSISGMYLSYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++    LF+L+  + 
Sbjct: 249 SGPAIVLVVSGLFLLALLFS 268


>gi|330952060|gb|EGH52320.1| hypothetical protein PSYCIT7_11939 [Pseudomonas syringae Cit 7]
          Length = 262

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 181/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++ +  LF+LSF   +
Sbjct: 241 PSIVVCAAALFLLSFVLPR 259


>gi|254456376|ref|ZP_05069805.1| ABC transporter, membrane spanning protein (zinc) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083378|gb|EDZ60804.1| ABC transporter, membrane spanning protein (zinc) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 267

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 125/247 (50%), Positives = 189/247 (76%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FFIRALF+GIGI L TGPLGCF++W+R++YFGDT+AHSALLGV ++  F L + I 
Sbjct: 1   MFDDFFIRALFAGIGIALVTGPLGCFVVWRRLSYFGDTLAHSALLGVTIAYTFDLNIAIS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+I+++ +L+L+Q+QK   L  DA+LG++ HS++++ LV++ F+ ++  D+   LFGDI
Sbjct: 61  VFLISSIIALILIQLQKKTNLPGDALLGLLAHSSLAVGLVVIGFLTFIRFDIMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVN  DIL+IW  G + +++L  IWKPL A+TVNYELA+AEG+ P++ K IF ++ + +
Sbjct: 121 LAVNINDILIIWSGGAIILIVLKLIWKPLFASTVNYELAEAEGLNPDRAKAIFTILMAAV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++SIK +G+ LIT +LI+P   AR  S SP+ M I + I G+L +++GL+ SL F+T S
Sbjct: 181 IAISIKMVGLLLITGMLIIPAAMARNISDSPQKMVIYSIIGGLLSVVLGLFTSLEFNTSS 240

Query: 241 GPSIIIT 247
           GPSII+ 
Sbjct: 241 GPSIIVA 247


>gi|297626117|ref|YP_003687880.1| metal transport system ABC transporter permease [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296921882|emb|CBL56442.1| Putative metal transport system ABC transporter permease
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 335

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 135/253 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + +     +  +G +I+ ++++  GD + H A+ GV L+L+     T    +
Sbjct: 7   AFMQRALIAALLSGFMSPAVGTYIVQRKLSLLGDGLGHVAIAGVGLALLTGWAPTPVAIV 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  + ++ +  ++++    +D  L ++ +  ++  +++          L+ +LFG +  V
Sbjct: 67  ICVVGAVSIELLRQSGRAPADVGLAILFYGGLATGVLLAGISGQGTGVLSQYLFGSLTTV 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+ L+  +  + I++   +   L A   + E A+++G+    +++  +++ S+ ++V
Sbjct: 127 SMSDVALVAVMAAIVIILSLGLSPQLFAVCADEEFARSQGLPVRALEICIVVMASVTVAV 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+++L+++P   A    T        A  IG++   IG+ GS  ++T SG +
Sbjct: 187 SMRTVGLLLVSALMVVPVAAANNLVTGFYRSMFTAIGIGVVVSFIGVTGSYYWNTASGAT 246

Query: 244 IIITSLFLFILSF 256
           I+++++ +F LS+
Sbjct: 247 IVVSAIAVFALSW 259


>gi|33865871|ref|NP_897430.1| ABC transporter [Synechococcus sp. WH 8102]
 gi|33633041|emb|CAE07852.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           WH 8102]
          Length = 294

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 126/256 (49%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F +RAL     +    G L C++  +  A  GD ++H+ L GV ++    LP ++  F
Sbjct: 22  HAFMVRALLVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVLPGVVVAYALGLPFSLGAF 81

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 82  VFGVGSVAAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 140

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DI     I  L +++L    + L+    +   A++ G+    +  + + + SL   
Sbjct: 141 ITAGDIQQTLLISALVLLLLLLFRRDLMLFCFDPTHARSIGINTGVLHYMLLGLLSLAAV 200

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V ++ +GI L+ ++L+ P  TA   +   + M +LA I  +L  + G++ S   D+ +  
Sbjct: 201 VGLQTVGIILVVAMLVTPGATAYLLTDRFDRMTVLAVISSVLSSVFGVFVSYWTDSSTAG 260

Query: 243 SIIITSLFLFILSFFY 258
            I++     F+L+F +
Sbjct: 261 CIVLVQTAQFLLAFLF 276


>gi|253688303|ref|YP_003017493.1| ABC-3 protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754881|gb|ACT12957.1| ABC-3 protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 285

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 122/258 (47%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  RAL + +        L C+++ +  +  GD I+H+ L G+ ++ +  +PL I 
Sbjct: 11  LTYPFMQRALLAAVVTGTVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFLLGIPLVIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+     ++    ++++  +  D ++G+I     +L LV+ + +   +  L   LFG++
Sbjct: 71  AFVSGIFCAVATGYVKEHSRVKEDTVMGIIFSGMFALGLVMFARI-DTDQHLNHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +   ++  I  I  + + I+    +  +    +   A+  G+  + +    + + ++ 
Sbjct: 130 LGITQQELTQILLIAGVTLGIVLLKRRDFMLYCFDPNHARVIGLPVKLLHYGLLSLLAMT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I  S++ +G+ L+ ++LI P + A       E M ++AT++ ++  I G   S   D  +
Sbjct: 190 IVASLQAVGVILVIAMLIAPGIIAFMVCKRFERMVLVATLVSVISCIAGTLISFYIDGAT 249

Query: 241 GPSIIITSLFLFILSFFY 258
           GP I+I     F L+  Y
Sbjct: 250 GPCIVIVQALFFTLALTY 267


>gi|309972481|gb|ADO95682.1| Fe/Mn/Zn ABC transporter permease protein [Haemophilus influenzae
           R2846]
          Length = 271

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 127/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLVGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKVLHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A    I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWVAIASSIASSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|68248962|ref|YP_248074.1| putative ABC-type chelated iron transport system, permease
           [Haemophilus influenzae 86-028NP]
 gi|68057161|gb|AAX87414.1| putative ABC-type chelated iron transport system, permease
           component [Haemophilus influenzae 86-028NP]
          Length = 271

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 127/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKVLHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A    I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWVAIASSIASSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|237797963|ref|ZP_04586424.1| zinc ABC transporter permease [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331020814|gb|EGI00871.1| zinc ABC transporter permease [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 262

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L ++VL+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TFGCLLLAVVLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPDDLAWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|113476872|ref|YP_722933.1| hypothetical protein Tery_3358 [Trichodesmium erythraeum IMS101]
 gi|110167920|gb|ABG52460.1| ABC-3 [Trichodesmium erythraeum IMS101]
          Length = 297

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 141/260 (54%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++      + I 
Sbjct: 9   LQYSFMQRSLLVAIIVGIICAVVGSYLMVQRLALLGDAISHSVLPGLAIAFWVGANIFIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   ++++++  I+   ++  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFIAGIISTILINLIRTRSSIKEDAAMGIVFSAFFALGITLMTIIQKDNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   D+     IG + ++++  ++K LL  T +   A+A G+    + L  +M+  L
Sbjct: 129 ILGVTVGDVRDTLIIGIIVLLVVILLYKELLFYTFDPLGAQAVGLPVNLLNLGLMMLIGL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL   IG L  I G+Y S  ++ P
Sbjct: 189 TIVASLKAVGVVLVLSLLITPASTAYLLVKRLHQVIILGVGIGTLSSISGMYISYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ S  LFIL+F + 
Sbjct: 249 SGPAIVLVSFGLFILAFLFS 268


>gi|37522882|ref|NP_926259.1| ABC transporter permease protein [Gloeobacter violaceus PCC 7421]
 gi|35213884|dbj|BAC91254.1| ABC transporter permease protein [Gloeobacter violaceus PCC 7421]
          Length = 300

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 137/258 (53%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL S + +       G ++I +R+A  GD ++ + + G+A++ I    + +  F
Sbjct: 15  YPFMQRALLSALLVGTICAITGSYLIVRRLALLGDAVSRAVMPGLAIAFIVGGNIFVGAF 74

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +   L++ ++  I  +  +  D  +G++     +  +++++ ++     DL  FLFG+IL
Sbjct: 75  IAGVLSTALIGYIHTHSKIKEDTAMGLVFSGFFATGIILITKIQSETKVDLMHFLFGNIL 134

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+L    I    +  +  ++K LL  + +   AKA G+  E + L+ + + +L I
Sbjct: 135 GVSESDLLATAVISAAVVATILLLFKELLFHSFDPLGAKAAGLPTEVLHLVLMSLIALTI 194

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +G+ L+ +L+I P  TA   +    +M  LA ++G +  ++GLY S   D  SG
Sbjct: 195 VASMQSVGVVLVIALMIAPGATAYLLTRRLPSMMGLAVLLGAIASLVGLYLSYYLDIASG 254

Query: 242 PSIIITSLFLFILSFFYK 259
           P++++ S+  F+L+F + 
Sbjct: 255 PAVVVVSIACFVLAFLFS 272


>gi|145640308|ref|ZP_01795892.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae R3021]
 gi|145274894|gb|EDK14756.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 22.4-21]
          Length = 271

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFC 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SYQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKILHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|78184586|ref|YP_377021.1| ABC transporter [Synechococcus sp. CC9902]
 gi|78168880|gb|ABB25977.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           CC9902]
          Length = 291

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F +RAL     +    G L C++  +  A  GD ++H+ L GV ++    LP ++  F
Sbjct: 10  HAFMVRALLVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVLPGVVVAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +N  DI+    I  L ++ L    + L+    +   A++ G+    +  + + + SL   
Sbjct: 129 INAADIIQTLLISLLVLVTLLVFRRDLMLFCFDPTHARSIGINTGVLHYMLLGLLSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   +   + M +LA    +L  ++G++ S   D+ +  
Sbjct: 189 AGLQTVGIILVVAMLVTPGATAYLLTDRFDRMTLLAVTSSVLSSLLGVFVSYWTDSSTAG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++     F+ +F +
Sbjct: 249 CIVLVQTAQFLFAFLF 264


>gi|229846447|ref|ZP_04466555.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 7P49H1]
 gi|229810540|gb|EEP46258.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 7P49H1]
          Length = 271

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLVGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIIFKRKDFLLYCFDPSHARVAGLSPKVLHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|320322190|gb|EFW78286.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331841|gb|EFW87779.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 262

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I     L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLTWILDGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|16272308|ref|NP_438521.1| iron (chelated) ABC transporter permease [Haemophilus influenzae Rd
           KW20]
 gi|145638732|ref|ZP_01794341.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittII]
 gi|260580577|ref|ZP_05848405.1| iron ABC transporter permease [Haemophilus influenzae RdAW]
 gi|260582549|ref|ZP_05850339.1| iron ABC transporter permease [Haemophilus influenzae NT127]
 gi|1175230|sp|P44660|Y359_HAEIN RecName: Full=Probable iron transport system membrane protein
           HI_0359
 gi|1573327|gb|AAC22018.1| iron (chelated) ABC transporter, permease protein (yfeD)
           [Haemophilus influenzae Rd KW20]
 gi|145272327|gb|EDK12235.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittII]
 gi|260092919|gb|EEW76854.1| iron ABC transporter permease [Haemophilus influenzae RdAW]
 gi|260094360|gb|EEW78258.1| iron ABC transporter permease [Haemophilus influenzae NT127]
 gi|309750222|gb|ADO80206.1| Fe/Mn/Zn ABC transporter permease protein [Haemophilus influenzae
           R2866]
          Length = 271

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 127/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEEHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKILHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A    I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWVAIASSIASSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|66043548|ref|YP_233389.1| hypothetical protein Psyr_0278 [Pseudomonas syringae pv. syringae
           B728a]
 gi|289674491|ref|ZP_06495381.1| hypothetical protein PsyrpsF_14602 [Pseudomonas syringae pv.
           syringae FF5]
 gi|63254255|gb|AAY35351.1| ABC-3 [Pseudomonas syringae pv. syringae B728a]
 gi|330938821|gb|EGH42344.1| hypothetical protein PSYPI_07940 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330977278|gb|EGH77233.1| hypothetical protein PSYAP_11200 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 262

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|256378785|ref|YP_003102445.1| ABC transporter [Actinosynnema mirum DSM 43827]
 gi|255923088|gb|ACU38599.1| ABC-3 protein [Actinosynnema mirum DSM 43827]
          Length = 287

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 73/256 (28%), Positives = 135/256 (52%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F+ RAL   +   +  G +G  ++ + +A+ GD +AHS   GVA++ +  + L +   
Sbjct: 13  YDFWRRALLVALLSGVVCGVIGSHVVLRGMAFIGDAVAHSVFPGVAIAFVLGVDLVLGGA 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   +T+L++    +N  L  D+++G+       L +VILS        L SFLFG IL 
Sbjct: 73  VAGVITALLVAVFAQNRRLKEDSVIGIFFAGAFGLGIVILSTAPGYGGSLESFLFGSILG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++ +D++ +  IG L ++    +   L A  ++ E A+A G     + L   ++ +L I 
Sbjct: 133 ISDSDVVAVAVIGALLLLCAAVLNGRLTAVALDREQARAVGFPVFWLDLALYVMVTLAIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S++ +G  L+ +LL+ P   AR  +     M +LA +IG  G ++GLY S  FD  +G 
Sbjct: 193 ISLQAVGNVLVLALLVTPAAAARLLTDRLGAMVVLAPVIGAGGSLLGLYLSYAFDLAAGG 252

Query: 243 SIIITSLFLFILSFFY 258
            I++    +F+L +F+
Sbjct: 253 LIVLALTGIFLLCWFF 268


>gi|294812534|ref|ZP_06771177.1| Metal transport ABC transporter [Streptomyces clavuligerus ATCC
           27064]
 gi|326441013|ref|ZP_08215747.1| metal transport system ABC transporter permease [Streptomyces
           clavuligerus ATCC 27064]
 gi|294325133|gb|EFG06776.1| Metal transport ABC transporter [Streptomyces clavuligerus ATCC
           27064]
          Length = 314

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 59/252 (23%), Positives = 130/252 (51%), Gaps = 1/252 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          +
Sbjct: 7   AFMQRALLAALLVGVTAPAIGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSTNPIWTAAL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDILA 122
           ++   ++++  I+       D  L ++ +  ++  +++++     +T DL SFLFG +  
Sbjct: 67  VSVAGAVIMELIRIYGRTRGDIALSMLFYGGMAGGVLLVNVSDTGSTGDLGSFLFGSLST 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+L I  + F  +++   + K L A + + E A+  G+    + L+  +  ++ IS
Sbjct: 127 VSDADLLAITLLAFFVLLVCVGLRKQLFAVSQDEEFARVTGLPVRALNLLIAVTAAVTIS 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ S S      LA  IG+   + G   S   D P G 
Sbjct: 187 VAMRVVGLLLVSALMVVPVAAAQQISRSFRATFALAVGIGVAVTLAGTTTSYYQDVPPGA 246

Query: 243 SIIITSLFLFIL 254
           +I++ ++ +F++
Sbjct: 247 TIVLLAIGIFVV 258


>gi|329934673|ref|ZP_08284714.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Streptomyces griseoaurantiacus M045]
 gi|329305495|gb|EGG49351.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Streptomyces griseoaurantiacus M045]
          Length = 328

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 123/248 (49%), Gaps = 1/248 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R +  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAVGIYLVQRRQSLMGDGIGHVAMTGVGLGFLLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
            ++ L ++++  I+       D  L ++ +  ++  ++ ++      N +LTS+LFG + 
Sbjct: 66  AVSVLGAVLMELIRWYGRTRGDLALAMLFYGGMAGGVMFINLAPGGSNANLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSPSDVTAICVLAGFVVLVTVGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++   S      LA  IG+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLGRSFAATFALAVAIGVSVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSL 249
            +I++ ++
Sbjct: 246 ATIVLLTI 253


>gi|72381879|ref|YP_291234.1| ABC-type Mn2+/Zn2+ transport system permease components
           [Prochlorococcus marinus str. NATL2A]
 gi|72001729|gb|AAZ57531.1| ABC-type Mn2+/Zn2+ transport system permease components
           [Prochlorococcus marinus str. NATL2A]
          Length = 290

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 67/258 (25%), Positives = 131/258 (50%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + ++F  RAL     +    G L C++  +  A  GD ++H+ + GV ++    LP ++C
Sbjct: 18  LTHDFMRRALMVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYALGLPFSLC 77

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  +++   +  D ++G++     +L LV++S +K  N DL   LFG  
Sbjct: 78  AFVFGVGSVALIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKIK-SNIDLMQILFGSP 136

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I F+ I IL    K L+    + + A++ G+    +  + + + SL 
Sbjct: 137 LGISRSDVNQTLIISFIVISILLIFRKDLMLYCFDAKHARSIGINTGILHYLLLTLLSLS 196

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +   + M ILA I      I+G+Y S   D  +
Sbjct: 197 AVVGLQTVGIILVVAMLITPGATAYLLTDRFDRMTILAVISSSFSSILGVYISYWSDIET 256

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++    +F+++F +
Sbjct: 257 GGSIVLVQTLIFLIAFLF 274


>gi|261821479|ref|YP_003259585.1| ABC transporter [Pectobacterium wasabiae WPP163]
 gi|261605492|gb|ACX87978.1| ABC-3 protein [Pectobacterium wasabiae WPP163]
          Length = 285

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 54/256 (21%), Positives = 121/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + +        L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F
Sbjct: 13  YPFMQRALLAAVVTGTVCAVLSCYLVLKGWSLMGDAISHAVLPGIVVAFLLGIPLVIGAF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    ++++  +  D ++G+I     +L LV+ + +   +  L   LFG++L 
Sbjct: 73  VSGIFCAIATGYVKEHSRVKEDTVMGIIFSGMFALGLVMFARI-DTDQHLNHILFGNVLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   ++  I  I  + + ++    +  +    +   A+  G+  + +    + + ++ I 
Sbjct: 132 ITRQELTQILLIAGVTLAVILLKRRDFMLYCFDPNHARIIGLPVKLLHYGLLSLLAMTIV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A       E M ++AT++ ++  I G   S   D  +GP
Sbjct: 192 ASLQAVGVILVIAMLIAPGIIAFMVCKRFERMVLVATLVSVISCIAGTLISFYIDGATGP 251

Query: 243 SIIITSLFLFILSFFY 258
            I+I     F L+  Y
Sbjct: 252 CIVIVQALFFTLALIY 267


>gi|148825359|ref|YP_001290112.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittEE]
 gi|229844552|ref|ZP_04464692.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 6P18H1]
 gi|148715519|gb|ABQ97729.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittEE]
 gi|229812801|gb|EEP48490.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 6P18H1]
          Length = 271

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 127/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +++ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKILHYGLLILLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A    I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWVAIASSIASSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|298484766|ref|ZP_07002866.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160620|gb|EFI01641.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 262

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 184/259 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    ++++ +++ +++I
Sbjct: 121 AISPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMVLMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|238757793|ref|ZP_04618976.1| Chelated iron transport system membrane protein yfeD [Yersinia
           aldovae ATCC 35236]
 gi|238704036|gb|EEP96570.1| Chelated iron transport system membrane protein yfeD [Yersinia
           aldovae ATCC 35236]
          Length = 281

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 123/254 (48%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F+  
Sbjct: 1   MQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLAIGAFVSG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L ++ 
Sbjct: 61  IFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLGISL 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            ++     I    ++++    K  +    +   A+  G+  + +    + + +L I  S+
Sbjct: 120 AELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP I+
Sbjct: 180 QAVGVILVIAMLIAPGIIAFMLCRSFDQMLVVATLVSVVACVLGTLISFHIDGATGPCIV 239

Query: 246 ITSLFLFILSFFYK 259
           I     F+++  Y 
Sbjct: 240 IIQALFFVVALIYS 253


>gi|89894590|ref|YP_518077.1| hypothetical protein DSY1844 [Desulfitobacterium hafniense Y51]
 gi|219669024|ref|YP_002459459.1| ABC transporter [Desulfitobacterium hafniense DCB-2]
 gi|89334038|dbj|BAE83633.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539284|gb|ACL21023.1| ABC-3 protein [Desulfitobacterium hafniense DCB-2]
          Length = 285

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 67/259 (25%), Positives = 147/259 (56%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  RAL   I + + T  +G F+I +R+A+ G+ +AH +L G+A+  +    L I 
Sbjct: 8   LQYAFMQRALIGTIAVAVLTAVVGTFVILRRLAFIGEGLAHGSLAGLAIGYLLGWNLYIA 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +     +L +  + +   +S D  +G++  ++++L + ++S +K+ +++LT +LFG +
Sbjct: 68  GNIYTIGLALFIGALHEKAKVSLDTAIGILFSTSMALGVALISSLKFYSSNLTGYLFGSV 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L++ + D+++I G   + + IL   +K  +    + E+A+  G+   ++    + + ++ 
Sbjct: 128 LSIGSFDLMIIVGSTCVILAILAVFYKEFVYYAFDPEMAEVTGLPRARLHYAMLAMIAVT 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + V+ + +GI L+T+LL +P  +A +++ S + + +L+   G++  I+GLY S   +  S
Sbjct: 188 VVVASQTVGIILVTALLTIPAASAFQWTHSLKKLVLLSVFFGLISAILGLYLSYYLNVAS 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI +T+  +F+LSF   
Sbjct: 248 GASIALTAAVIFLLSFLCS 266


>gi|86750516|ref|YP_487012.1| hypothetical protein RPB_3405 [Rhodopseudomonas palustris HaA2]
 gi|86573544|gb|ABD08101.1| ABC-3 [Rhodopseudomonas palustris HaA2]
          Length = 285

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 57/256 (22%), Positives = 122/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL   + +      L C+++ +  +  GD ++H+ L G+ L+ +  LP  I  F
Sbjct: 14  YPFMQRALVISVMVAAVCAVLSCYLVLKGWSLMGDAVSHAVLPGIVLAHVLNLPYAIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
                 ++    +  N  +  D ++G++      L LV+ + ++  +  L   LFG++L 
Sbjct: 74  AAGLSCAVFTGYLTANSRVKEDTVMGIVFSGMFGLGLVMFTKIE-TDQHLNHILFGNVLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++    +    ++++    + LL    +   A++ G+    +    +++ +L I 
Sbjct: 133 VTPRDLIETAIVAGGTLLVVLLKGRDLLLYCFDPNHARSIGLPVVWLHYGLLVLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +GI L+ ++L+ P  TA   + S + M ++AT++      +G   S   D  +G 
Sbjct: 193 ASLKAVGIILVVAMLVAPGATAYLLTDSFDRMLVIATVVATSSAALGTLISFHIDGATGA 252

Query: 243 SIIITSLFLFILSFFY 258
            I++T   +F+L+F +
Sbjct: 253 CIVLTQAVVFVLAFLF 268


>gi|331009455|gb|EGH89511.1| zinc ABC transporter permease [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 262

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GP G F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPPGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|330890990|gb|EGH23651.1| zinc ABC transporter permease [Pseudomonas syringae pv. mori str.
           301020]
          Length = 262

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 182/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L + +L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAGLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|71737862|ref|YP_272570.1| zinc ABC transporter permease [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257481820|ref|ZP_05635861.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289625099|ref|ZP_06458053.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646464|ref|ZP_06477807.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|71558415|gb|AAZ37626.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|330866589|gb|EGH01298.1| zinc ABC transporter permease [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330986804|gb|EGH84907.1| zinc ABC transporter permease [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 262

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLTWILGGSALVLVLIVALWRPLLAITVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|302186836|ref|ZP_07263509.1| hypothetical protein Psyrps6_10825 [Pseudomonas syringae pv.
           syringae 642]
          Length = 262

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 181/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L + +L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAALLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLGWILGGSTLVLVLIVALWRPLLAMTVHEELARVEGLPVATLRMTLMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVIAVCAGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|120406273|ref|YP_956102.1| ABC-3 protein [Mycobacterium vanbaalenii PYR-1]
 gi|119959091|gb|ABM16096.1| ABC-3 protein [Mycobacterium vanbaalenii PYR-1]
          Length = 664

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 127/256 (49%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  +RAL +G+        +GC+++ +   + G+ + H  L GVAL+ +  + L I   +
Sbjct: 12  DMVLRALVAGVIAACLCSLVGCWVLLRGNVFLGEAMTHGMLPGVALAALLGISLLIGGLV 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A + ++ +  + ++  LSSD  +G++    ++L ++++S  +    DLT FLFGD+ AV
Sbjct: 72  AALVMAVGVAALGRSSRLSSDTSVGLLLVGMLALGVIVVSRSQSFAVDLTGFLFGDVFAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++++     L +  +    +  +A T +   A   G++P+    +  M+ ++ +  
Sbjct: 132 RTADLVVLATALVLTLGAVIIGHRAFVAVTFDPRKAATLGLRPQLAIPVLTMLMAVAMVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S   +G  L+  LL+ P   A  +S S   + +L+ +IG   + +GL  S    T  G +
Sbjct: 192 SFHVVGTLLVLGLLVAPPAAALAWSRSIPRVMLLSALIGSAAVYLGLLISWYAGTAGGAT 251

Query: 244 IIITSLFLFILSFFYK 259
           I   ++ +F  S    
Sbjct: 252 IAGVAVLIFFASTLLS 267


>gi|145632607|ref|ZP_01788341.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 3655]
 gi|145634644|ref|ZP_01790353.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittAA]
 gi|144986802|gb|EDJ93354.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 3655]
 gi|145268189|gb|EDK08184.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittAA]
          Length = 271

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     L+  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLSHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITLSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|301169062|emb|CBW28659.1| putative ABC-type chelated iron transport system, permease
           component [Haemophilus influenzae 10810]
          Length = 271

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SYQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|318605913|emb|CBY27411.1| manganese ABC transporter, inner membrane permease protein SitD
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 291

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 14  YPFMQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 74  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+Q + +    + + +L I 
Sbjct: 133 ISLAELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLQVKLLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMVCRSFDQMLVVATVVSVVACVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I     F+++  Y +
Sbjct: 253 CIVIIQALFFVIALIYNR 270


>gi|316935566|ref|YP_004110548.1| ABC-3 protein [Rhodopseudomonas palustris DX-1]
 gi|315603280|gb|ADU45815.1| ABC-3 protein [Rhodopseudomonas palustris DX-1]
          Length = 290

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 57/256 (22%), Positives = 122/256 (47%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + +      L C+++ +  +  GD ++H+ L G+ ++ +  LPL    F
Sbjct: 14  YPFMQRALVASVMVAAVCAVLSCYLVLKGWSLMGDAVSHAVLPGIVVAHVLNLPLAAGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++V   +++N  +  D ++G++        LV+ + ++  +  L   LFG++L 
Sbjct: 74  VAGLSCAVVTGYLKENSRVKEDTVMGIVFSGMFGFGLVLFTRIE-TDQHLNHILFGNVLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I  +    ++ +    + LL    +   A++ G+    +    +++ +L I 
Sbjct: 133 VTPRDLIEIAIVAGGTLLAVLLKRRDLLLYCFDPHHARSIGLPVRALHYGLLVLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+K +GI L+ ++LI P  TA   + S E M ++A  +      +G   S   D  +G 
Sbjct: 193 ASLKAVGIILVVAMLIAPGATAYLLTDSFERMLLVAAAVATGSAAVGTLVSFHIDGATGA 252

Query: 243 SIIITSLFLFILSFFY 258
            I++T   +F  +F +
Sbjct: 253 CIVLTQALVFCAAFLF 268


>gi|282861794|ref|ZP_06270858.1| ABC-3 protein [Streptomyces sp. ACTE]
 gi|282563610|gb|EFB69148.1| ABC-3 protein [Streptomyces sp. ACTE]
          Length = 297

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 129/251 (51%), Gaps = 1/251 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          +
Sbjct: 7   PFMQRALIAAVLVGITAPAIGIYLVQRRQALMGDGIGHIAMTGVGLGFLMSANPVWMATL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           +A   S+V+  I+       D  L ++ +  ++  +++++      N +LTS+LFG +  
Sbjct: 67  VAVAGSVVMELIRWYGRTRGDIALAMLFYGGMAGGVMLINLSDTGSNANLTSYLFGSLST 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+  I  +  L I++   + + L A + + E A+  G+    + L+  +  ++ ++
Sbjct: 127 VSEEDVTTIVVLAALVILVTVGLRRQLFAVSQDEEFARVTGLPVRVLNLLVAVTAAVTVT 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ + S +   +L+ +IG    + G   S   D P G 
Sbjct: 187 VAMRVVGLLLVSALMVVPVAAAQQIAKSFKVTFVLSVVIGTAVTLAGTVTSYYQDVPPGA 246

Query: 243 SIIITSLFLFI 253
           +I++ ++  F+
Sbjct: 247 TIVLLAIAAFV 257


>gi|148827501|ref|YP_001292254.1| hypothetical protein CGSHiGG_04600 [Haemophilus influenzae PittGG]
 gi|148718743|gb|ABQ99870.1| hypothetical protein CGSHiGG_04600 [Haemophilus influenzae PittGG]
          Length = 271

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     L+  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLSHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITLSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|303251951|ref|ZP_07338122.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247110|ref|ZP_07529162.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|302649381|gb|EFL79566.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306856359|gb|EFM88510.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 276

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   ALF+ + +      L C++I +  +  GD I+H+ L GV +S +  LPL I  F 
Sbjct: 15  EFMQTALFTAVLVASVCAILSCYLILKGWSLMGDAISHAVLPGVVISSLLGLPLAIGAFT 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  L  D I+G++     +L +V+ + +   +  LT  LFG++L V
Sbjct: 75  SGLFCAISVGYLKENSRLKEDTIMGIMFSGLFALGIVLFTALP-SDQHLTHLLFGNLLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +++    I  L   ++    K  L    +   AK  G+  +++    + + +L I  
Sbjct: 134 TQNELIQTIIICTLTFSVIIFKRKDFLLYCFDSNHAKVIGLPVKRLHYGLLALLALTIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA + S   + M  +A  I I    +G   S   D  +GP+
Sbjct: 194 TMQVVGVILVVAMLIAPGITAYQLSNRFDYMLAIAMTIAISSSALGTILSYHIDAATGPT 253

Query: 244 IIITSLFLFILSFFYK 259
           II+    +F++    K
Sbjct: 254 IILIQSIVFVIVLISK 269


>gi|220908637|ref|YP_002483948.1| ABC transporter [Cyanothece sp. PCC 7425]
 gi|219865248|gb|ACL45587.1| ABC-3 protein [Cyanothece sp. PCC 7425]
          Length = 294

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 57/256 (22%), Positives = 123/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F ++AL+    +      L C++  +  +  GD ++HS + GV ++    +P  +  F
Sbjct: 20  YPFLVQALWVSAFVGTVCAVLSCYVTLKGWSLMGDAVSHSVVPGVVVAYALGIPFAVGAF 79

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +      + +  ++    L  DA++GV+     +L LV+++ +   N DL   LFG++L 
Sbjct: 80  LFGFGAVVAIGYVKSKTRLKEDAVIGVVFTGLFALGLVLVTKIP-SNVDLFHILFGNVLG 138

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DI+     G L ++++    K LL    +   AKA G+  + +    + + +L I 
Sbjct: 139 ISKEDIIQTLIAGLLTLVVILLRRKDLLLFCFDPNHAKAIGLNTQWMYYTLLSVLALTIV 198

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++  GI L+ ++L+ P   A   +   + M +++    +   ++G Y S   D  +G 
Sbjct: 199 TALQTAGIILVVAMLVTPGAIAYLLTDRFDRMLLISIASSVFSCLLGTYFSYHLDISTGG 258

Query: 243 SIIITSLFLFILSFFY 258
           +I++    LFI++  +
Sbjct: 259 AIVVALTLLFIVTMIF 274


>gi|16330509|ref|NP_441237.1| Mn transporter MntB [Synechocystis sp. PCC 6803]
 gi|2501365|sp|Q55282|MNTB_SYNY3 RecName: Full=Manganese transport system membrane protein mntB
 gi|2126525|pir||S55047 ABC-type transport system permease protein mntB [validated] -
           Synechocystis sp. (PCC 6803)
 gi|755077|gb|AAA68932.1| membrane protein [Synechocystis sp.]
 gi|1653000|dbj|BAA17917.1| Mn transporter; MntB [Synechocystis sp. PCC 6803]
          Length = 306

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 126/257 (49%), Gaps = 1/257 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF IRA++    + L    L C+I  +  +  GD I+H+ + GV L+    +P  I 
Sbjct: 18  LQYEFLIRAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHAVVPGVVLAYALNIPFAIG 77

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F      ++ +  ++    L  DA++G++     +L LV+++ +   N DL   LFG++
Sbjct: 78  AFTFGFGATVAIGYVKSKTRLKEDAVIGIVFTGFFALGLVLVTKIP-SNVDLFHILFGNV 136

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++  DI+     G + ++++    K LL    +   AKA G++ + +    + + +L 
Sbjct: 137 LGISQQDIIQTLIAGSITLIVILLRRKDLLLFCFDPNHAKAIGLRTQVMYYTLLSVLALT 196

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I  +++  GI L+ S+L+ P       S   ++M   + +  +L  ++G Y S  FD  +
Sbjct: 197 IVAALQTAGIILVISMLVTPGSIGYLLSDRFDHMLWYSVVSSVLSCVLGTYLSYHFDVST 256

Query: 241 GPSIIITSLFLFILSFF 257
           G  I++    LF+++  
Sbjct: 257 GGMIVVILTTLFVIAMI 273


>gi|37522878|ref|NP_926255.1| ABC transporter permease protein [Gloeobacter violaceus PCC 7421]
 gi|35213880|dbj|BAC91250.1| ABC transporter permease protein [Gloeobacter violaceus PCC 7421]
          Length = 343

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 137/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF +RAL S + +      +G +++ +R++  G  +++S + G+A++ +  + + +  F
Sbjct: 13  YEFMVRALISAVLVGSLCAVMGSYLVVRRLSLLGLVVSNSVVPGIAVAFLLYVNIFVGGF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +   L ++ L  +Q    +  DA +GV+  +   L +++++ ++     +L +FLFG+IL
Sbjct: 73  ISGILATVGLGWLQGKTRIKEDAAMGVVLSTFFGLGILLITKIQAERKVNLNNFLFGNIL 132

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +NT+D++   GI  + ++ ++ ++K  L  + + + A+A G+    +    + +T+L +
Sbjct: 133 GINTSDLITSAGIAAVVLLAVWALYKEFLLLSFDAQWAEAAGLPTRALHYAMMALTALTV 192

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +G+ L  +L+++P  TA   +     M  L+  +G+   ++GLY S   +  SG
Sbjct: 193 VASMQAVGVALTIALMVIPAATAYLLTNRLATMMGLSVGLGVTSSVVGLYLSYYLNLSSG 252

Query: 242 PSIIITSLFLFILSFF 257
           P+I + S   F     
Sbjct: 253 PTITLVSGLFFATVVL 268


>gi|182438810|ref|YP_001826529.1| putative metal transport ABC transporter permease protein
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326779465|ref|ZP_08238730.1| ABC-type transporter, integral membrane subunit [Streptomyces cf.
           griseus XylebKG-1]
 gi|178467326|dbj|BAG21846.1| putative metal transport ABC transporter permease protein
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326659798|gb|EGE44644.1| ABC-type transporter, integral membrane subunit [Streptomyces cf.
           griseus XylebKG-1]
          Length = 299

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 130/251 (51%), Gaps = 1/251 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +           
Sbjct: 9   PFMQRALIAAVLVGITAPAIGIYLVQRRQALMGDGIGHIAMTGVGLGFLLSTSPVWMATA 68

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           +A   ++V+  I+       D  L ++ +  ++  +++++      N +LTS+LFG +  
Sbjct: 69  VAVAGAVVMELIRWYGHTRGDLALAMLFYGGMAGGVMLINLSDTGSNANLTSYLFGSLAT 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++ I  +    +++   + + L A + + E A+  G+    + L+  +  ++ ++
Sbjct: 129 VSESDVIAICVLAAFVVLVTVGLRRQLFAVSQDEEFARVSGLPVRVLNLLIAVTAAVTVT 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ + S +   +LA +IG    + G   S   D P G 
Sbjct: 189 VAMRVVGLLLVSALMVVPVAAAQQITKSFKVTFVLAVVIGTAVTLTGTVTSYYQDVPPGA 248

Query: 243 SIIITSLFLFI 253
           +I++ ++ +F+
Sbjct: 249 TIVLLAIAVFV 259


>gi|123442178|ref|YP_001006159.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122089139|emb|CAL11981.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 295

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 124/257 (48%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 14  YPFMQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 74  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 133 ISLAELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMVCRSFDQMLVVATVVSVVACVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYK 259
            I+I     F+++  Y 
Sbjct: 253 CIVIIQALFFVIALIYN 269


>gi|87120942|ref|ZP_01076834.1| high-affinity zinc uptake system membrane protein ZnuB [Marinomonas
           sp. MED121]
 gi|86163780|gb|EAQ65053.1| high-affinity zinc uptake system membrane protein ZnuB [Marinomonas
           sp. MED121]
          Length = 268

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 112/253 (44%), Positives = 178/253 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +   RAL  G+G+    GPLG F++W+R+AYFGDT+AHSALLGV+L  +F++ L + +  
Sbjct: 3   DLLFRALLGGLGVAAVAGPLGAFVVWRRMAYFGDTLAHSALLGVSLGFLFEINLNLAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +LVL+ +QK   +++D +LG++ HS++SL LV +SF+  +  DL ++LFGD+LA+
Sbjct: 63  LCVGLALVLVTLQKKHIIATDTLLGILAHSSLSLGLVAVSFLDNIRIDLMAYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+  I+  G L + +L   WKPLLA TVN ELAK EG   E I+L+ +++ +L+I+V
Sbjct: 123 GTQDLYWIYSGGLLVLALLALFWKPLLAVTVNEELAKVEGYPVEAIRLLLMLLVALVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LITSL+I+P  TAR+ S SP  MA +A+++G L +  GL  S  +DTP+GPS
Sbjct: 183 AMKIVGVLLITSLMIIPAATARKLSRSPVQMASVASLLGCLAVSGGLLASFQWDTPAGPS 242

Query: 244 IIITSLFLFILSF 256
           +++ +  LF+L++
Sbjct: 243 VVVCAAVLFLLAY 255


>gi|46143675|ref|ZP_00204548.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207615|ref|YP_001052840.1| putative iron transport system membrane protein [Actinobacillus
           pleuropneumoniae L20]
 gi|165975583|ref|YP_001651176.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149398|ref|YP_001967923.1| iron transporter membrane protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249831|ref|ZP_07336035.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307244935|ref|ZP_07527032.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307251654|ref|ZP_07533559.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307253889|ref|ZP_07535741.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307256152|ref|ZP_07537939.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|307258343|ref|ZP_07540084.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307260584|ref|ZP_07542276.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307262714|ref|ZP_07544342.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|126096407|gb|ABN73235.1| putative iron transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875684|gb|ABY68732.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189914529|gb|ACE60781.1| putative iron transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302651398|gb|EFL81550.1| iron (chelated) transport system membrane protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854100|gb|EFM86308.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306860851|gb|EFM92859.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306863093|gb|EFM95035.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865333|gb|EFM97229.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306867527|gb|EFM99374.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306869661|gb|EFN01446.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306871969|gb|EFN03685.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 276

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   ALF+ + +      L C++I +  +  GD I+H+ L GV +S +  LPL I  F 
Sbjct: 15  EFMQTALFTAVLVASVCAVLSCYLILKGWSLMGDAISHAVLPGVVISSLLGLPLAIGAFT 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  L  D I+G++     +L +V+ + +   +  LT  LFG++L V
Sbjct: 75  SGLFCAISVGYLKENSRLKEDTIMGIMFSGLFALGIVLFTALP-SDQHLTHLLFGNLLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +++    I  L   ++    K  L    +   AK  G+  +++    + + +L I  
Sbjct: 134 TQNELIQTIIICTLTFSVIIFKRKDFLLYCFDSNHAKVIGLPVKRLHYGLLALLALTIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA + S   + M  +A  I I    +G   S   D  +GP+
Sbjct: 194 AMQVVGVILVVAMLIAPGITAYQLSNRFDYMLAIAMTIAISSSALGTILSYHIDAATGPT 253

Query: 244 IIITSLFLFILSFFYK 259
           II+    +F++    K
Sbjct: 254 IILIQSIVFVIVLISK 269


>gi|313836812|gb|EFS74526.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL037PA2]
 gi|314929779|gb|EFS93610.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL044PA1]
 gi|314972208|gb|EFT16305.1| anchored repeat-type ABC transporter, permease subunit
           [Propionibacterium acnes HL037PA3]
 gi|328907636|gb|EGG27400.1| ABC transporter ATP-binding protein [Propionibacterium sp. P08]
          Length = 285

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 135/254 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +AL       +  G +G  ++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLPKALLVAAVCSIVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGAIA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             +T++++  + +N  L  D+++G++     +L +VI+S     +  L  FLFG I  + 
Sbjct: 78  GLVTAILVAIVSQNRRLKEDSVIGILFAGAFALGIVIISRAPGYSGSLQQFLFGSITGIT 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+++   G L ++    + K L+   ++ E A+A  M    + L+  ++ ++ + +S
Sbjct: 138 NDDIVIVCVTGALVLLTERALHKELVTVGLDRETARATHMPVFALDLLLYVLVTMTVVIS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG L  ++GLY S   D P+G +I
Sbjct: 198 VQVIGNVLVLALLVTPAATARLLTDRLGRMMVLAPVIGGLSALVGLYLSWSIDLPAGGTI 257

Query: 245 IITSLFLFILSFFY 258
           ++ +  +F+L +  
Sbjct: 258 VLVATAVFLLCWVV 271


>gi|325964537|ref|YP_004242443.1| ABC-type Mn2+/Zn2+ transporter, permease component [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323470624|gb|ADX74309.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Arthrobacter phenanthrenivorans Sphe3]
          Length = 291

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F +RA+ +     +    L C+++    +  GD ++H+ L GV L+ I   P  +   
Sbjct: 10  YDFMVRAIVTTALAAVVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFALGAL 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           + A +   ++  ++    +  DA +G++  S  +L LV++S      TDL   +FG++L 
Sbjct: 70  VFALIAVTLIGVVRNTSRVKEDAAIGIVFSSLFALGLVLISVTP-SQTDLNHIIFGNLLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++ +  +G +  +IL    + L     +   A A G+ P ++  + + + +L   
Sbjct: 129 VSESDLIQVLVLGVVAFVILILKRRDLTLYAFDPTHAHAIGLSPRRLGALLLGLLALTSV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   +     M ++A ++  L  I G+Y S   DT SG 
Sbjct: 189 VALQTVGVVLVVAMLIIPGATAYLLTDRFSRMLLIAPVVSALCSITGIYVSYYLDTASGA 248

Query: 243 SIIITSLFLFILSFFYK 259
            +++T   +F   + + 
Sbjct: 249 MVVLTQGIVFAAVYLFS 265


>gi|116070450|ref|ZP_01467719.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           BL107]
 gi|116065855|gb|EAU71612.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           BL107]
          Length = 291

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F +RAL     +    G L C++  +  A  GD ++H+ L GV ++    LP ++  F
Sbjct: 10  HAFMLRALLVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVLPGVVVAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +N  DI+    I  L ++ L    + L+    +   A++ G+    +  + + + SL   
Sbjct: 129 INAADIVQTLLISLLVLVTLLVFRRDLMLFCFDPTHARSIGINTGVLHYMLLGLLSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   +   + M +LA    +L  ++G++ S   D+ +  
Sbjct: 189 AGLQTVGIILVVAMLVTPGATAYLLTDRFDRMTLLAVTSSVLSSLLGVFISYWTDSSTAG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++     F+ +F +
Sbjct: 249 CIVLVQTAQFLCAFLF 264


>gi|114320203|ref|YP_741886.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226597|gb|ABI56396.1| ABC-3 protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 312

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 76/253 (30%), Positives = 142/253 (56%), Gaps = 1/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL + + +    G L C+++ +R +  GD I+H+ L GVA++ +   P  I  F+ 
Sbjct: 38  FMQRALLTSVLVGTVCGMLSCYVVLKRWSLLGDAISHAVLPGVAVAYLLGWPFFIGAFIT 97

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             LTSL +  I+++  + SDA +G++  +  +L +VI+S +   +T L   LFG++L V 
Sbjct: 98  GALTSLGIGAIERHTRIKSDAAMGLMFTAAFALGIVIISKIA-SSTHLMHILFGNVLGVQ 156

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            + +LL    G +  ++++  ++PLL  T +   A+A G +   I    I++ +L I  S
Sbjct: 157 HSALLLTLVSGIVAFLVVWLFYRPLLLYTFDPLQAQALGFRTGAIHYGLILLLTLTIVAS 216

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L+ ++LI P  TA   +     M +L+  +G++  ++GLY S  FD  SG +I
Sbjct: 217 LETVGIILVVAMLITPGATAHLLTERLTTMMLLSIGVGVISAVVGLYLSFFFDVASGGAI 276

Query: 245 IITSLFLFILSFF 257
           ++ +  LF+++  
Sbjct: 277 VLVATGLFLIALL 289


>gi|254474046|ref|ZP_05087439.1| zinc ABC transporter, permease protein [Pseudovibrio sp. JE062]
 gi|211956935|gb|EEA92142.1| zinc ABC transporter, permease protein [Pseudovibrio sp. JE062]
          Length = 271

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 120/259 (46%), Positives = 193/259 (74%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F +RA+ +GIG+ L  GPLGCF++W+R+AYFGDT++HSALLGVAL+ +  + L + +
Sbjct: 1   MDDFILRAMLAGIGLALVAGPLGCFVVWRRMAYFGDTMSHSALLGVALAFLLNINLMLGV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +    SL LL +QK  +LS+DA+LG+++HS ++L +V+++FM  V  DL S LFGDIL
Sbjct: 61  LAVTVTVSLCLLILQKRGSLSTDALLGLLSHSALALGMVLIAFMSHVRFDLLSLLFGDIL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV   D++ I+    + + +++ +W+PLLA+TVN ELA+AEG  P+  +LIF+++ + +I
Sbjct: 121 AVGNEDVIAIYACAAVILGLMYFLWRPLLASTVNRELAEAEGFNPDLTQLIFMVMMAAII 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           ++++K +G+ LIT+LLI+P  TAR F+ +PE MA+ +++IG+  +++GL GSL FD+ SG
Sbjct: 181 AIAMKIVGVLLITALLIIPAATARWFARTPEQMAVASSVIGVASVVLGLEGSLQFDSASG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++ SL LF+LS F  +
Sbjct: 241 PSIVVASLCLFLLSLFASR 259


>gi|332161600|ref|YP_004298177.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665830|gb|ADZ42474.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 291

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 125/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA+ + I   +    L C+++ +  +  GD I+H+ L G+ L+    +PL I  F
Sbjct: 14  YPFMQRAIVAAIITGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     ++    +++N  +  D ++G++     +  LV+ S M   +  L+  LFG++L 
Sbjct: 74  VSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRM-DTDQHLSHILFGNMLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  ++     I    ++++    K  +    +   A+  G+  + +    + + +L I 
Sbjct: 133 ISLAELKQTLWIAGFTLLVVLLKRKAFMLYCFDPNHARVIGLPVKLLHYGLLCLLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ ++LI P + A     S + M ++AT++ ++  ++G   S   D  +GP
Sbjct: 193 ASLQAVGVILVIAMLIAPGIIAFMVCRSFDQMLVVATVVSVVACVLGTLISFHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I     F+++  Y +
Sbjct: 253 CIVIIQALFFVIALIYNR 270


>gi|126657199|ref|ZP_01728365.1| Mn transporter; MntB [Cyanothece sp. CCY0110]
 gi|126621470|gb|EAZ92181.1| Mn transporter; MntB [Cyanothece sp. CCY0110]
          Length = 300

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/258 (24%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F ++A++    + L    L C+I  +  +  GD I+HS + GV ++    LP  I 
Sbjct: 14  LQYGFLVQAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHSVVPGVVVAYAMNLPFAIG 73

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+     ++ +  I+ N  L  DA++G++     +  LV+++ +   N DL   LFG++
Sbjct: 74  AFLFGFGATVAIGYIKSNTRLKEDAVIGIVFTGFFAFGLVLVTKIP-SNIDLFHILFGNV 132

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++  DI+     G + ++++    K LL    +   AKA G+  + +    + + +L 
Sbjct: 133 LGISQLDIIQTLIAGIITLVVILLRRKDLLLFCFDPNHAKAIGLNTQMMYYTLLSVLALT 192

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I  +++  GI L+ S+L+ P       S   ++M ++A I  +L  ++G Y S   D  +
Sbjct: 193 IVAALQTAGIILVISMLVTPGSIGYLLSDRFDHMLVVAVISSVLSCVLGTYLSYHLDVST 252

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++     F+ +  +
Sbjct: 253 GGSIVVLLTVFFLFAMMF 270


>gi|262276954|ref|ZP_06054747.1| high-affinity zinc uptake system membrane protein ZnuB [alpha
           proteobacterium HIMB114]
 gi|262224057|gb|EEY74516.1| high-affinity zinc uptake system membrane protein ZnuB [alpha
           proteobacterium HIMB114]
          Length = 268

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 127/257 (49%), Positives = 191/257 (74%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +G+G+ L TGP+GCF IW+R+++FGDT+AHSALLGV ++L F+L +   
Sbjct: 1   MLDDFFIRALIAGLGVSLITGPMGCFTIWKRLSFFGDTLAHSALLGVTMALTFELNIPFA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+I+++ +++LL +QKN  L  DA+LG++ HS+++  LV++ F+  +  D+   LFGDI
Sbjct: 61  VFVISSIIAVMLLSLQKNTRLPGDALLGLLAHSSLATGLVVIGFLSNIRFDVMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAVN  DIL+IW  G + ++IL  IWK L A TVNY+LA+AEGM+P++  +IFI++ + M
Sbjct: 121 LAVNKIDILIIWIGGAIILIILKFIWKSLFAATVNYDLAEAEGMKPDRANVIFIILMAAM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+++IK +G+ LIT +LI+P   AR  S SP  M IL+ + GI+ + IGL+ SL F++PS
Sbjct: 181 IAIAIKMVGLLLITGMLIMPAAMARNLSDSPTKMVILSIVGGIMSVSIGLFASLEFNSPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSII  +L LF+LS  
Sbjct: 241 GPSIITAALILFLLSLI 257


>gi|120556682|ref|YP_961033.1| ABC-3 protein [Marinobacter aquaeolei VT8]
 gi|120326531|gb|ABM20846.1| ABC-3 protein [Marinobacter aquaeolei VT8]
          Length = 270

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 108/257 (42%), Positives = 179/257 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + + +
Sbjct: 10  DFFWRALLGGLGVALVAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNLGVVI 69

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +L L+ + +   L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+LA+
Sbjct: 70  TCVLIALALVLLSRTRTLATDTLLGILAHSALAIGLVTLSFMPDVRVDLTGLLFGDLLAM 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I+G     + +L  +W+ LL +T++ ELA+ EG+  E+++L  +++ SL+I+V
Sbjct: 130 TRQDLVWIYGGAAFVLSLLALLWRGLLMSTIHEELARVEGIPVERLRLALMLMFSLVIAV 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LIT+LLI+P  TARR + +PE+M  LA + G++ +  GL  S   DTP+GPS
Sbjct: 190 AMKIVGVLLITALLIIPAATARRLAHNPEHMTALAVVFGVMAVSGGLTLSWYLDTPAGPS 249

Query: 244 IIITSLFLFILSFFYKK 260
           +++T+  +F++ +   +
Sbjct: 250 VVVTAFLVFLMVYAGAR 266


>gi|294141798|ref|YP_003557776.1| iron-compound ABC transporter ATP-binding protein [Shewanella
           violacea DSS12]
 gi|293328267|dbj|BAJ02998.1| iron-compound ABC transporter, ATP-binding protein [Shewanella
           violacea DSS12]
          Length = 317

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 129/254 (50%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + A+F    +      L  +++ +  +  GD ++HS + GVA + +  LP  +  F  
Sbjct: 13  YMVNAIFISALVGGVCAFLSAYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAFFS 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA+ 
Sbjct: 73  GGLAATTMLFLSQRSKLKEDAIIGLIFTSFFGLGLFMVS-LSPTSVNIQTIVLGNILAIT 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D L +  I  +++++L   W+ L+    +   A++ G+ P ++K++F  + S     +
Sbjct: 132 PEDTLQLLLISGISLIVLVLKWRDLMVVFFDENHARSIGLNPNRLKILFFTLLSASTVAA 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+ ++++ P  TA + S     + IL+  IG +   +G Y S   D  +G  I
Sbjct: 192 LQTVGAFLVIAMVVTPGATAYQLSDRFGTLVILSVAIGAITSFVGAYLSFFIDGATGGII 251

Query: 245 IITSLFLFILSFFY 258
           ++    +F+L+F +
Sbjct: 252 VVLQACVFVLTFVF 265


>gi|293390117|ref|ZP_06634451.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950651|gb|EFE00770.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 267

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 170/254 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I  
Sbjct: 3   DILFPAWLTGIILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L S+ L+ ++ N   S D +LG+I HS +S+ +V +  +K V  DL S+LFGD+LA+
Sbjct: 63  LTLLLSIALVWLENNTQFSIDTLLGIIAHSCLSIGVVTVGLLKNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D+  I     + +  L   WKPL++TT++ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYQDLWYIGIGAIIVLAALCYFWKPLISTTISPELAQVEGINVKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE MAI+A  I ++ + +GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPETMAIIAVFISMIAVSLGLTLSAYYDTAAGPS 242

Query: 244 IIITSLFLFILSFF 257
           ++I S FLF+ S  
Sbjct: 243 VVICSTFLFLCSLL 256


>gi|283457220|ref|YP_003361790.1| Mn2+/Zn2+ ABC transporter permease [Rothia mucilaginosa DY-18]
 gi|283133205|dbj|BAI63970.1| ABC-type Mn2+/Zn2+ transport system, permease component [Rothia
           mucilaginosa DY-18]
          Length = 294

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/255 (23%), Positives = 130/255 (50%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F +RA    +        L C+++    +  GD I+H+ L GV L+ IF  P  +   +
Sbjct: 14  PFMLRAFVVTVIAAAVCALLSCWLVLLGWSLMGDAISHAVLPGVVLAYIFGAPFAVGAVI 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   ++  ++++  +  DA +G++  +  +  LV++S     NTDL   LFG++L V
Sbjct: 74  AALLAVALIGGVRRSGRVREDAAIGIVFTTMFAFGLVLISVTP-SNTDLNHILFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+  +  +  +   +L    +  +    +   A+A G++P  +  + +++ +L   V
Sbjct: 133 SWSDVWQVAILAVVVAAVLLVKRRDFVLYAFDPGFAQAVGLRPRLLGALLLIMLALTSVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++L++P  TAR  +     M  ++  + +LG + GLY S   D   G +
Sbjct: 193 ALQIVGVVLVVAMLVIPGSTARLITDRFVPMLAVSVGVSLLGTLTGLYASYHADVSPGGA 252

Query: 244 IIITSLFLFILSFFY 258
           +++T   LF L++ +
Sbjct: 253 VVVTQGILFALAYVF 267


>gi|172058754|ref|YP_001815214.1| ABC-3 protein [Exiguobacterium sibiricum 255-15]
 gi|171991275|gb|ACB62197.1| ABC-3 protein [Exiguobacterium sibiricum 255-15]
          Length = 286

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 73/257 (28%), Positives = 143/257 (55%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  ++L + + + +  G +GCFII + ++  GD I+H+ L GVA+S +  +   I   
Sbjct: 13  YDFLQKSLVTSVMVGIICGVIGCFIILRGMSLMGDAISHAVLPGVAISYLLGINFFIGAV 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               LT+L +  + +N  + +D  +G++  S  +L ++++SF++  ++DL   LFG++LA
Sbjct: 73  ATGLLTALGIGFVSQNSRIKNDTAIGILFTSAFALGIILISFLR-SSSDLYHILFGNVLA 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  +D+ +   IG + +  +F  +K LL T+ +  +A A G+    I  + + + +L+  
Sbjct: 132 VRPSDMWMTLAIGLIVLAAIFLFYKELLVTSFDPTMAAAYGLSTRLIHYLLMTMLTLVTV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   +     M  L+  +G +  ++GLY S  ++  SG 
Sbjct: 192 ASLQTVGIILVVAMLITPAATAYLLTNRLSRMIFLSAGLGTISSVVGLYFSFTYNLSSGA 251

Query: 243 SIIITSLFLFILSFFYK 259
           SI++ +  LF L F + 
Sbjct: 252 SIVLVATALFALVFIFS 268


>gi|90580059|ref|ZP_01235867.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Vibrio angustum S14]
 gi|90438944|gb|EAS64127.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Vibrio angustum S14]
          Length = 261

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 110/256 (42%), Positives = 189/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++VL+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLVLAVVLVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+L I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++L+ +++  ++I+V
Sbjct: 123 TTNDLLWIYCGGAVVLALLIYLWRPLLSMTISEEMAQVEGVNVDLMRLLLMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE+MA+LA+IIG + +++GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPESMAVLASIIGAIAVVLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  +F+LS   +
Sbjct: 243 VVVSAAAMFMLSQLKR 258


>gi|322421315|ref|YP_004200538.1| ABC-3 protein [Geobacter sp. M18]
 gi|320127702|gb|ADW15262.1| ABC-3 protein [Geobacter sp. M18]
          Length = 438

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/265 (23%), Positives = 123/265 (46%), Gaps = 11/265 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF----------Q 54
           +F +AL  G  + L +G +GC ++ +R+A+ GD ++H+ + GVA   +            
Sbjct: 16  YFQKALIGGCAVALVSGVVGCLVVLRRMAFLGDALSHAMIAGVAGGYLVMKLLFGIEAHA 75

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLT 113
             + +   + A LT  ++  + +   +  D  +G++     +L +V++S  +   + DL 
Sbjct: 76  PSMLLGSLIAAVLTVALIGLVSRVSRVKEDTAIGIMYTGVFALGVVVVSIFRQYIHIDLM 135

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            F+ GDIL V  +D+     +    + +L   ++    TT +  +A + GM    +    
Sbjct: 136 HFIMGDILGVADSDLWASVLVCATVLSVLVLFFRQFQLTTFDPVMAASTGMSVLLLDYAL 195

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
               SL++  ++  +G+ L+  LLI P  TA   S     M  LA + G+  +I GLY  
Sbjct: 196 TSCVSLVVVSAVSMVGVILVVGLLITPAATAYLLSDRLGRMMALAALFGVTSVIGGLYLC 255

Query: 234 LIFDTPSGPSIIITSLFLFILSFFY 258
           +  D+  G ++++     F++    
Sbjct: 256 VWLDSAGGGAVMLFCTLQFLVVLVV 280


>gi|302518920|ref|ZP_07271262.1| metal transport ABC transporter [Streptomyces sp. SPB78]
 gi|318059910|ref|ZP_07978633.1| metal transport ABC transporter [Streptomyces sp. SA3_actG]
 gi|318080414|ref|ZP_07987746.1| metal transport ABC transporter [Streptomyces sp. SA3_actF]
 gi|333027251|ref|ZP_08455315.1| putative metal transport ABC transporter [Streptomyces sp. Tu6071]
 gi|302427815|gb|EFK99630.1| metal transport ABC transporter [Streptomyces sp. SPB78]
 gi|332747103|gb|EGJ77544.1| putative metal transport ABC transporter [Streptomyces sp. Tu6071]
          Length = 316

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 126/251 (50%), Gaps = 1/251 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
              RAL + + + ++   +G +++ +R A  GD I H AL GV L  +           +
Sbjct: 8   IMQRALLAAVLVGITAPAIGIYLVQRRQALMGDGIGHVALTGVGLGFLLSASPLWTAAAV 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILAV 123
           +   ++V+  I+       D  L ++ +  ++  +V+ +      N +LTS+LFG +  V
Sbjct: 68  SVGGAIVMELIRWYGRTRGDVALAMLFYGGMAGGVVLTNLAPAGSNANLTSYLFGSLSTV 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D++ +  +    +++   + + L A + + E A+  G+    + L+  +  +  ++V
Sbjct: 128 SPSDVVAVCVLAAFVVLVTVGLRRHLFAVSQDEEYARVTGLPVRLLNLLVAVTAAATVTV 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+++L+++P   A++ + S       A  IG++  + G   S   D P G +
Sbjct: 188 AMRIVGLLLVSALMVIPVAAAQQLTRSFAFTFAGAVAIGVVTTLGGTTLSYYQDLPPGGT 247

Query: 244 IIITSLFLFIL 254
           I++ ++ +F++
Sbjct: 248 IVLLAIAVFVV 258


>gi|117618931|ref|YP_858178.1| zinc uptake ABC transporter, permease protein ZnuB [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117560338|gb|ABK37286.1| zinc uptake ABC transporter, permease protein ZnuB [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 259

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 111/258 (43%), Positives = 184/258 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ +
Sbjct: 1   MDSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L
Sbjct: 61  VVCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I
Sbjct: 121 SVQPMDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGVRVDVLRCVLMLLIGLVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+G
Sbjct: 181 AVAMKFVGALIITSLLIIPAATARRFSRTPEQMAGFAALIGCLAVLGGLLLSWYQDTPAG 240

Query: 242 PSIIITSLFLFILSFFYK 259
           PS+++ +  LFILS F K
Sbjct: 241 PSVVVCATSLFILSQFKK 258


>gi|260913876|ref|ZP_05920350.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Pasteurella dagmatis ATCC 43325]
 gi|260631963|gb|EEX50140.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Pasteurella dagmatis ATCC 43325]
          Length = 276

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 131/258 (50%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   ALF+ + + +    L C+++ +  +  GD I+H+ L GV ++ +  LPL+I  F
Sbjct: 13  YPFMQNALFTALIVAIICAVLSCYLVLKGWSLMGDAISHAVLPGVVIAFLLGLPLSIGAF 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
                 +L +  +++N  +  D ++G++     +  +V+ + ++  +  L+  LFG++L 
Sbjct: 73  GAGLFCALSVGYLKENSRIKEDTVMGIVFSGMFAFGIVLFTKVE-TDQHLSHILFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ ++++    I  +   I+    K  L    +    +  G+ P+ +    +++ +L I 
Sbjct: 132 VSDSELIETLIISAIIFSIITFKRKDFLLYCFDPSHTRVAGLSPKILHYGLLVLLALTII 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L+ ++LI P +TA   S   + M ++A  + ++  ++G   S   D  +GP
Sbjct: 192 TAMQVVGVILVVAMLISPGITAFTLSKRFDYMLLIAIAMSVITSLLGTIISYHIDAATGP 251

Query: 243 SIIITSLFLFILSFFYKK 260
            II+     F+++  ++K
Sbjct: 252 CIILLQALFFLIALIHQK 269


>gi|145636373|ref|ZP_01792042.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittHH]
 gi|145270538|gb|EDK10472.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae PittHH]
          Length = 271

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     L+  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLSHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPSHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A +  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIVSSITLSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|268592556|ref|ZP_06126777.1| metal ion ABC transporter, permease protein [Providencia rettgeri
           DSM 1131]
 gi|291311968|gb|EFE52421.1| metal ion ABC transporter, permease protein [Providencia rettgeri
           DSM 1131]
          Length = 288

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + I        L CF++ +  +  GD I+H+ L G+ ++ +  +PL I  F 
Sbjct: 15  PFMQKALITAIVSGTVCAILSCFLVLKGWSLMGDAISHAVLPGIIIASLLGIPLAIGAFA 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +++N  +  D ++G++     ++ LV+ + +      LT  LFGDIL +
Sbjct: 75  SGLFCAVATGYLKENSRIKEDTVMGIVFSGMFAIGLVMFAKI-DTEQHLTHILFGDILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             ++   I     + I I+    K  +    +   A+  G+  + I    + + +L I  
Sbjct: 134 TDSEFKQILLFAGVTIAIILLKRKDFMLYCFDPNQARVIGLPVKLIHYGLLSLLALTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P + A     S   M I+A I  +   +IG   S   +  +GP+
Sbjct: 194 SLQAVGIILVIAMLISPGIIAFVLCRSFGKMLIVAIIASVTSSVIGTILSFHINATTGPT 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++T    F+++  Y K
Sbjct: 254 IVVTQAVYFVIALLYSK 270


>gi|255326141|ref|ZP_05367228.1| manganese transport system membrane protein MntB [Rothia
           mucilaginosa ATCC 25296]
 gi|255296852|gb|EET76182.1| manganese transport system membrane protein MntB [Rothia
           mucilaginosa ATCC 25296]
          Length = 294

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/255 (23%), Positives = 129/255 (50%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F +RA    +        L C+++    +  GD I+H+ L GV L+ IF  P  +   +
Sbjct: 14  PFMLRAFVVTVIAAAVCALLSCWLVLLGWSLMGDAISHAVLPGVVLAYIFGAPFAVGAVI 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   ++  ++++  +  DA +G++  +  +  LV++S     NTDL   LFG++L V
Sbjct: 74  AALLAVALIGGVRRSGRVREDAAIGIVFTTMFAFGLVLISVTP-SNTDLNHILFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+  +  +  +   +L    +  +    +   A+A G++P  +  + +++ +L   V
Sbjct: 133 SWSDVWQVAILAVVVAAVLLVKRRDFVLYAFDPGFAQAVGLRPRLLGALLLIMLALTSVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++L++P  TAR  +     M  ++  + + G + GLY S   D   G +
Sbjct: 193 ALQIVGVVLVVAMLVIPGSTARLITDRFVPMLAVSVGVSLAGTLTGLYASYHADVSPGGA 252

Query: 244 IIITSLFLFILSFFY 258
           +++T   LF L++ +
Sbjct: 253 VVVTQGILFALAYVF 267


>gi|283783675|ref|YP_003374429.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis 409-05]
 gi|298252866|ref|ZP_06976660.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis 5-1]
 gi|283441968|gb|ADB14434.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis 409-05]
 gi|297533230|gb|EFH72114.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis 5-1]
          Length = 287

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 137/255 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F ++AL       +  G +GC+++ + +A+ GD +AHS   G+A++ + Q  L     + 
Sbjct: 18  FLLKALIVACLSSVICGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLFGGALA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T+L++    +N  L  D+ +GV   S  +L +VI+S        L SFLFG I  + 
Sbjct: 78  GVATALIVSIFSQNRRLREDSFIGVFFVSAFALGIVIISKASGYAGSLESFLFGSITGIP 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI ++   G + + IL    K L+  +++ E ++A G+    +  +  ++ ++ + VS
Sbjct: 138 DSDIAVVAFTGLIILAILCMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M ILA +IG +  I+G+Y S  FDT +G +I
Sbjct: 198 VQIIGNVLVLALLVTPAATARLLTDRLPRMMILAPVIGCVSSIVGMYISWSFDTATGGTI 257

Query: 245 IITSLFLFILSFFYK 259
           ++ +  LF+L++   
Sbjct: 258 VLVATALFVLAWVCS 272


>gi|295396610|ref|ZP_06806766.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970541|gb|EFG46460.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Brevibacterium mcbrellneri ATCC 49030]
          Length = 300

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 61/255 (23%), Positives = 128/255 (50%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  RAL + +   +    L C+++    +  GD ++H+ L GV L+ I  LP  +   
Sbjct: 13  YEFMSRALVATVIASVVCALLSCWLVLIGWSLMGDAVSHAVLPGVVLAYILGLPFALGAV 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           + A +T  ++  ++ N  +  D  +G++  +  +  LV++S      T+L   +FG+IL 
Sbjct: 73  VFAFITVGLIGAVRFNTRIKEDTAIGIVFTTLFAGGLVLISVTP-SQTNLGHIVFGNILG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++T+D++ I  +  + + IL    + L     +   A+  G+ P ++  + + + +L   
Sbjct: 132 ISTSDLVQIGVLAAVALAILVIKRRDLTLFAFDPTHARVIGISPRRLGALLLGVLALTTV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++++ +G+ L+ ++LI+P  TAR  +     M ++A  +     I G+Y S  FD   G 
Sbjct: 192 IALQIVGVVLVVAMLIIPGATARLVTEKFSRMLVIAPTLSAGCSIAGIYLSYWFDASPGG 251

Query: 243 SIIITSLFLFILSFF 257
            I++T   +F  ++ 
Sbjct: 252 LIVLTQGCVFTCAYL 266


>gi|218673631|ref|ZP_03523300.1| zinc uptake ABC transporter, permease protein [Rhizobium etli GR56]
          Length = 271

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 146/257 (56%), Positives = 211/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TDI LIWG G   +  L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSRTDIALIWGGGLFVLAALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALILFILSLL 257


>gi|33152160|ref|NP_873513.1| iron (chelated) transport system membrane protein [Haemophilus
           ducreyi 35000HP]
 gi|33148382|gb|AAP95902.1| iron (chelated) transport system membrane protein [Haemophilus
           ducreyi 35000HP]
          Length = 276

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 124/257 (48%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + +      L C++I +  +  GD I+H+ L GV ++ +  LPL I  F 
Sbjct: 15  EFMQMALLTAVLVASVCAVLSCYLILRGWSLMGDAISHAVLPGVVVANLAGLPLAIGAFS 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  +  D ++G++     +L +V+ + +      LT  LFG++L V
Sbjct: 75  SGLFCAISIGYLKENSRIKEDTLMGIMFAGLFALGIVLFTALP-SEQHLTHLLFGNLLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T + +    I  +   ++    K  L    +   AK  G+  + +    + I +L I  
Sbjct: 134 TTPEFIQTVIICIITFALMLFKRKDFLVYCFDLNHAKVIGLPVKWLHYGLLSILALTIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA + S   + M ++A  + I   I+G   S   D+ +GP+
Sbjct: 194 AMQVVGVILVVAMLIAPGITAYQLSNRFDKMLVIALAVAISSSILGTILSYHIDSATGPT 253

Query: 244 IIITSLFLFILSFFYKK 260
           II+    +FI      +
Sbjct: 254 IILIQSLIFIAVVIKGQ 270


>gi|150389432|ref|YP_001319481.1| ABC-3 protein [Alkaliphilus metalliredigens QYMF]
 gi|149949294|gb|ABR47822.1| ABC-3 protein [Alkaliphilus metalliredigens QYMF]
          Length = 291

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 144/256 (56%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++   A+ +G+ + +  G +GCFII + +A  GD I+H+ L GV ++ +      I   
Sbjct: 15  YQYLQNAMIAGVLVGVICGMMGCFIILRGMALMGDAISHAVLPGVVIAYLLGFSFFIGAV 74

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   +T++ +  I ++  +  D+ +G++  +  +L +V+++  K  +  L   LFG++LA
Sbjct: 75  ITGAMTAIGIGYITQHSKIKDDSAIGIMFTAAFALGIVMITAQKGTDVHLWHILFGNVLA 134

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D+ +I+ IG + I  L   ++  L +T +  +A+A G+  +KI  + +++ SL+  
Sbjct: 135 VSRVDLWVIFTIGVVVIGGLLLFYRQFLLSTFDPTMAQAIGLPTKKIHYLLMLMLSLVTV 194

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++  +GI L+ ++LI P  TA   +     M  L+ + G++  +IG+Y S I+D  +G 
Sbjct: 195 AALNTVGIVLVVAMLITPGSTAYLLTNRLPIMLALSALFGVVSSVIGVYCSFIYDVATGG 254

Query: 243 SIIITSLFLFILSFFY 258
           SI++ +  LF ++F +
Sbjct: 255 SIVLVASILFAMAFLF 270


>gi|327188698|gb|EGE55898.1| zinc uptake ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 316

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 148/257 (57%), Positives = 212/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +GIG+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 46  MLDDFFVRAILAGIGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 105

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 106 VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 165

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 166 LAVSTTDIALIWGGGLFVLVALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 225

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG   ++ GL+GSL +DTPS
Sbjct: 226 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAAAVVGGLFGSLTYDTPS 285

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 286 GPSIVVAALVLFILSLL 302


>gi|241205422|ref|YP_002976518.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859312|gb|ACS56979.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 271

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 147/257 (57%), Positives = 214/257 (83%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLVAMAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSPTPEIMAVLASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALILFILSLL 257


>gi|307249331|ref|ZP_07531325.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306858625|gb|EFM90687.1| Chelated iron transport system membrane protein yfeD
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 276

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 64/256 (25%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   ALF+ + +      L C++I +  +  GD I+H+ L GV +S +  LPL I  F 
Sbjct: 15  EFMQTALFTAVLVASVCAVLSCYLILKGWSLMGDAISHAVLPGVVISSLLGLPLAIGAFT 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  L  D I+G++     +L +V+ + +   +  LT  LFG++L V
Sbjct: 75  SGLFCAISVGYLKENSRLKEDTIMGIMFSGLFALGIVLFTALP-SDQHLTHLLFGNLLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +++    I  L   ++    K  L    +    K  G+  +++    + + +L I  
Sbjct: 134 TQNELIQTIIICTLTFSVIIFKRKDFLLYCFDSNHTKVIGLPVKRLHYGLLALLALTIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA + S   + M  +A  I I    +G   S   D  +GP+
Sbjct: 194 AMQVVGVILVVAMLIAPGITAYQLSNRFDYMLAIAMTIAISSSALGTILSYHIDAATGPT 253

Query: 244 IIITSLFLFILSFFYK 259
           II+    +F++    K
Sbjct: 254 IILIQSIVFVIVLISK 269


>gi|269103071|ref|ZP_06155768.1| zinc ABC transporter permease protein ZnuB [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268162969|gb|EEZ41465.1| zinc ABC transporter permease protein ZnuB [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 261

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 116/256 (45%), Positives = 188/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI L  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIALIAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL ++LFGD+LAV
Sbjct: 63  CCLALAVILVTLQKQKLVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            TTD+  I+G G L + +L  +W+PLL+ T+N E+A+ EG+  + ++L+ +++  L+I+V
Sbjct: 123 TTTDLYWIYGGGVLVLGMLVWLWRPLLSMTINEEMAQVEGINVDLMRLLLMLMVGLVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE MA LA+IIG + ++ GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPEMMACLASIIGAIAVVGGLILSWQYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  LFILS F K
Sbjct: 243 VVVSAAALFILSQFKK 258


>gi|239941028|ref|ZP_04692965.1| putative metal transport ABC transporter permease protein
           [Streptomyces roseosporus NRRL 15998]
 gi|239987507|ref|ZP_04708171.1| putative metal transport ABC transporter permease protein
           [Streptomyces roseosporus NRRL 11379]
 gi|291444468|ref|ZP_06583858.1| metal transport system ABC transporter permease [Streptomyces
           roseosporus NRRL 15998]
 gi|291347415|gb|EFE74319.1| metal transport system ABC transporter permease [Streptomyces
           roseosporus NRRL 15998]
          Length = 299

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 129/251 (51%), Gaps = 1/251 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +           
Sbjct: 9   PFMQRALIAAVLVGITAPAIGIYLVQRRQALMGDGIGHIAMTGVGLGFLLSTSPVWMATA 68

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           +A   ++ +  I+       D  L ++ +  ++  +++++      N +LTS+LFG +  
Sbjct: 69  VAVAGAVTMELIRWYGHTRGDLALAMLFYGGMAGGVMLINLSDTGSNANLTSYLFGSLST 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++ I  +    +++   + + L A + + E A+  G+    + L+  +  ++ ++
Sbjct: 129 VSESDVIAISVLAAFVVVVTVGLRRQLFAVSQDEEFARVSGLPVRVLNLLVAVTAAVTVT 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ + S +   +L+ +IG    + G   S   D P G 
Sbjct: 189 VAMRVVGLLLVSALMVVPVAAAQQITKSFKVTFVLSVVIGTAVTLTGTVTSYYQDVPPGA 248

Query: 243 SIIITSLFLFI 253
           +I++ ++ +F+
Sbjct: 249 TIVLLAIAVFV 259


>gi|116252918|ref|YP_768756.1| high-affinity zinc uptake system membrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257566|emb|CAK08663.1| putative high-affinity zinc uptake system membrane protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 271

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 147/257 (57%), Positives = 213/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLLAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSPTPEIMAVLASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALILFILSLL 257


>gi|11467415|ref|NP_043272.1| hypothetical protein CypaCp135 [Cyanophora paradoxa]
 gi|1351805|sp|P31606|YCXC_CYAPA RecName: Full=Uncharacterized membrane protein in ycf23-apcF
           intergenic region; AltName: Full=ORF299
 gi|1016216|gb|AAA81303.1| putative protein of 299 amino acids [Cyanophora paradoxa]
          Length = 299

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 130/246 (52%), Gaps = 1/246 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA   G+   L  G +G F++ QR+    D I+HS L G+A++  F +PL     + 
Sbjct: 32  FMQRAFVIGLIAALLAGIVGSFLMLQRLTLLSDAISHSVLPGLAIAFSFGIPLIFGALLA 91

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGDILAV 123
           + ++ +++  I+    L  D  +G++  S   L ++++S ++  N  DL  FLFG+IL +
Sbjct: 92  SIISVIIINWIRTESRLKEDTAIGIVFASFFGLGILLISVIQKENKVDLNHFLFGNILGI 151

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D+     I  + ++     ++ L   T +  +A+  G+    ++  F+++ +L I V
Sbjct: 152 TSEDLQNTSIILAIILLFFISCYRQLKCYTFDPIMAQTIGLPINFLQSTFLILVALTIIV 211

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+K IG+ L+ +LL+ P  T      S E + + ++IIG+     G+  S +F+ P GP+
Sbjct: 212 SMKAIGVILVLALLVTPGATGLLIGKSLEYVILTSSIIGVSCSFSGMLLSYLFNIPPGPT 271

Query: 244 IIITSL 249
           I++ + 
Sbjct: 272 IVLITS 277


>gi|149376893|ref|ZP_01894648.1| high-affinity zinc uptake system membrane protein ZnuB
           [Marinobacter algicola DG893]
 gi|149358785|gb|EDM47254.1| high-affinity zinc uptake system membrane protein ZnuB
           [Marinobacter algicola DG893]
          Length = 270

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 107/253 (42%), Positives = 180/253 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + + +
Sbjct: 10  DFFWRALIGGLGVALIAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNVGVIV 69

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++ L+   +++ L++D +LG++ HS +++ LV LSFM  +  DLT  LFGD+LA+
Sbjct: 70  TCVVLAIALVLFSRSKTLATDTLLGILAHSALAIGLVTLSFMPDIRVDLTGLLFGDLLAM 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L I+G   L + +L  +W+ LL +T++ ELA+ EG+  E+++L+ +++ S++I+V
Sbjct: 130 SRNDLLWIYGGALLILALLTVLWRGLLMSTIHEELARVEGVPVERLRLVLMLMFSIVIAV 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ LIT+LLI+P  TARR + +PE+M  LA + G + +  GL  S   DTP+GPS
Sbjct: 190 AMKIVGVLLITALLIIPAATARRLAGNPEHMVGLAILFGFIAVSGGLTMSWHLDTPAGPS 249

Query: 244 IIITSLFLFILSF 256
           +++T   +F+L +
Sbjct: 250 VVVTGFAVFLLVY 262


>gi|330828239|ref|YP_004391191.1| high affinity zinc ABC transporter permease [Aeromonas veronii
           B565]
 gi|328803375|gb|AEB48574.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas veronii B565]
          Length = 259

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 109/258 (42%), Positives = 184/258 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ +
Sbjct: 1   MDSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L
Sbjct: 61  VVCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I
Sbjct: 121 SVQPMDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGIRVDVLRCVLMLLIGLVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+G
Sbjct: 181 AVAMKFVGALIITSLLIIPAATARRFSQTPEQMAGFAALIGCLAVLGGLTLSWYQDTPAG 240

Query: 242 PSIIITSLFLFILSFFYK 259
           PS+++ +  LF+LS F +
Sbjct: 241 PSVVVCATSLFVLSQFKR 258


>gi|227822309|ref|YP_002826280.1| zinc ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
 gi|227341309|gb|ACP25527.1| zinc ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
          Length = 273

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 150/257 (58%), Positives = 209/257 (81%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +GIGI +  GPLGCF+IW+R+AYFGDT+AHSALLGVALSL+ +L L I 
Sbjct: 1   MLDDFFVRALVAGIGIAVVAGPLGCFVIWRRMAYFGDTMAHSALLGVALSLLLELNLMIS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  SL+LL +QK  ALS+DA+LG+++HS +S+ LVI++FM WV  DL  FLFGDI
Sbjct: 61  VFIVASAVSLLLLFLQKRGALSTDALLGILSHSALSIGLVIVAFMTWVRIDLVGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +IWG G L I+ L  +W+PLLA+TVN ELA+AEG++PE+ +L F+++ +L+
Sbjct: 121 LAVSEADIDIIWGGGILVILSLVYLWRPLLASTVNPELAEAEGLKPERARLFFMLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRF+TSPE MAI+A++IG L +  GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITSLLIIPAATARRFATSPEVMAIIASLIGALAVTGGLFGSLHWDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LF+LS  
Sbjct: 241 GPSIVVAALALFVLSLL 257


>gi|261868305|ref|YP_003256227.1| acylphosphatase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391994|ref|ZP_06636328.1| acylphosphatase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|53802288|gb|AAU94305.1| AfeD [Aggregatibacter actinomycetemcomitans]
 gi|261413637|gb|ACX83008.1| acylphosphatase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952528|gb|EFE02647.1| acylphosphatase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 282

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 59/258 (22%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   AL + + + +    L C+++ +  +  GD I+H+ L G+ ++    LPL+I  F
Sbjct: 14  YPFMQNALITALLVSVICAMLSCYLVLKGWSLMGDAISHAVLPGIVVAFWLGLPLSIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + S+ +  +++N  +  D  +G++     +L +V+ + ++     LT  LFG++L 
Sbjct: 74  IAGLVCSISVGYLKENSRIKEDTAMGIVFSGMFALGIVLFTKIE-TEQHLTHILFGNLLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  ++   + +  L  +++F   K  L    +    K  G+ P  +    +++ +L I 
Sbjct: 133 VSDAEVWQTFFMTALIFLVIFLRRKDFLLYCFDPNQTKIVGLSPRLLHYSLLILLALTII 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L+ ++LI P +TA   +   + M  +A I  +   I+G   S   D  +GP
Sbjct: 193 SAMQVVGVILVVAMLISPGITAFILTKRFDYMIAIALITSVSTSILGTIISYYIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            II+     F+ +  Y K
Sbjct: 253 CIILLQATAFLTALIYSK 270


>gi|224370491|ref|YP_002604655.1| putative ABC-type manganese/zinc transport system, permease
           component [Desulfobacterium autotrophicum HRM2]
 gi|223693208|gb|ACN16491.1| putative ABC-type manganese/zinc transport system, permease
           component [Desulfobacterium autotrophicum HRM2]
          Length = 419

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 58/263 (22%), Positives = 121/263 (46%), Gaps = 11/263 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLT------ 58
           +F +AL  G  + +    +GC ++ +R+A+ GD ++H+ + GVA   +            
Sbjct: 13  YFQKALIGGSIVAIVAAVVGCLVVLRRMAFLGDALSHAMIAGVAGGYLVMKFFFGLEAHA 72

Query: 59  ----ICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLT 113
               +   + A  T  ++  + +   +  D  +G++     +L +V +S  +   + DL 
Sbjct: 73  PGMLLGSLIAAISTVALISFVSRISRVKEDTAIGIMYTGIFALGVVFVSIFRHYIHIDLM 132

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            F+ GDIL V  TD+ +   +    + IL   ++     T +  +A + G+    +  + 
Sbjct: 133 HFIMGDILGVADTDLWVSAFVAATVLTILILFFRHFQLATFDPIMAASIGLPVVFLDYLL 192

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
               SL++  ++  +G+ L+  LLI P  TA   S   + M +LA++ G   ++ GLY  
Sbjct: 193 TTCVSLVVVSAVSMVGVILVVGLLITPAATAYLLSDRLDKMMMLASLFGFTSVVGGLYLC 252

Query: 234 LIFDTPSGPSIIITSLFLFILSF 256
           +  D+  G +I++     F++  
Sbjct: 253 VWLDSSGGGAIMLFCTLQFLVVL 275


>gi|328544323|ref|YP_004304432.1| Zinc ABC transporter permease [polymorphum gilvum SL003B-26A1]
 gi|326414065|gb|ADZ71128.1| Zinc ABC transporter, permease protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 281

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 131/256 (51%), Positives = 190/256 (74%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ L  GPLGCFI+W+R+AYFGDT++H+ALLGVAL+ + Q+ +T  
Sbjct: 1   MLDDFFTRALVAGIGVALVAGPLGCFIVWRRLAYFGDTLSHAALLGVALAFLLQVDITFA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++  L SL+LL +Q+   LSSDA+LG++ HS+++L LV L+FM WV  DL  FLFGDI
Sbjct: 61  VFVVCALVSLLLLVLQRRGTLSSDALLGLLAHSSLALGLVCLAFMTWVRMDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V+  DI +I+  G   + +L  IW+PL A TV+ ELA+AEGM P +  L+F+++ + +
Sbjct: 121 LSVSRLDITVIYLGGAAVLGVLAWIWRPLFAATVSVELAEAEGMNPRRANLVFMLLMAGV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +G+ LIT+LLI+P  TARR S+ PE MA LA + G   +  GLYGSL FDTPS
Sbjct: 181 IAIAMKIVGVLLITALLIIPAATARRLSSGPEQMAALAALAGATAVGAGLYGSLAFDTPS 240

Query: 241 GPSIIITSLFLFILSF 256
           GPSI++ ++ LF +S 
Sbjct: 241 GPSIVVAAMGLFGVSL 256


>gi|227540822|ref|ZP_03970871.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227183354|gb|EEI64326.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 287

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 125/257 (48%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +        +G  ++ + +A+ GD +AH+   G+A++   Q+ + +   +
Sbjct: 17  AFLPRALVIALVCSAVCAVVGSHVVLRGMAFIGDAVAHAVFPGIAIAFALQVSVLLGGAL 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +    +   +  DA++G+   +  +  LV++S +   +  LTSFLFG I  V
Sbjct: 77  TGAAVAVAVAYFSQRRRVKEDALIGIFFAAAFAAGLVVMSRIDGYSASLTSFLFGSITGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +    G L I ++  + +      ++ E A+A G     + L   +  +  + +
Sbjct: 137 PARDVTITAVGGALIIALVLALTRRFTIVALDRETARALGYNVFLLDLALYLCVTAAVVL 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +G  L+ +LL+ P  TAR  +     M  +A  IG+ G + G+Y S   D P+G +
Sbjct: 197 SIRTVGNILVLALLLTPAATARLVTQRLHTMMAVAVAIGVAGSVTGIYLSWALDLPTGAT 256

Query: 244 IIITSLFLFILSFFYKK 260
           I++T   +F++ +  ++
Sbjct: 257 IVLTLTGIFLVFWVAQR 273


>gi|315121884|ref|YP_004062373.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495286|gb|ADR51885.1| zinc uptake ABC transporter, permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 263

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 209/256 (81%), Positives = 237/256 (92%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
           YNEFFIRALF+GIGI+LSTGPLGCFI+WQR+ YFGDTIAHSALLGVA SL+  LPL +CI
Sbjct: 3   YNEFFIRALFAGIGIILSTGPLGCFIVWQRMTYFGDTIAHSALLGVAFSLMLNLPLPLCI 62

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           FM+A LTS++LLQIQK+E ++SDAILGVITHSTIS++L++LSFM WVNTDLTSFLFGDIL
Sbjct: 63  FMVAALTSIILLQIQKSEFIASDAILGVITHSTISISLIMLSFMTWVNTDLTSFLFGDIL 122

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A+NT DI++IW +G LNI+IL KIWK LLATTVNYELAKAEGMQPEK+KLIF MIT+LMI
Sbjct: 123 AINTNDIIIIWSVGILNIVILIKIWKSLLATTVNYELAKAEGMQPEKVKLIFTMITALMI 182

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           S+SIKFIGITLITSLLILPTVTARRF+TSPENM IL T+IGILG+I+GLYGSLIFDTPSG
Sbjct: 183 SISIKFIGITLITSLLILPTVTARRFATSPENMVILTTVIGILGVILGLYGSLIFDTPSG 242

Query: 242 PSIIITSLFLFILSFF 257
           PSIIITSL  FILSF 
Sbjct: 243 PSIIITSLIFFILSFL 258


>gi|301062447|ref|ZP_07203099.1| ABC 3 transport family protein [delta proteobacterium NaphS2]
 gi|300443447|gb|EFK07560.1| ABC 3 transport family protein [delta proteobacterium NaphS2]
          Length = 283

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/259 (25%), Positives = 133/259 (51%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  +F   AL +G+ + +S G +G  ++  RI +    IAH+A  GV L   +     + 
Sbjct: 5   LQYDFMRNALLAGLLVSISCGIIGSLVVVNRIVFISGGIAHAAFGGVGLGFFYGFSPFLG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
               A+  SL++  +       +D I+GV+    +++ ++++      + DL S+LFG I
Sbjct: 65  AAAFASGASLIMGAVSLKNKHRADTIIGVLWAIGMAVGIILIDLTPGYHVDLMSYLFGSI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV + D+ L+  +     + +   +K  +A + + E A   G+  + + L+ + +T+  
Sbjct: 125 LAVPSADLWLMLPLDGFIFLAVLFFYKEFVALSYDEEFAFVMGVPVKTLYLLLLGMTAFS 184

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I + I+ +G+ L+ +LL +P   A +++ S  +M +L++I+ I    +GL+ S +FD  S
Sbjct: 185 IVMIIRVVGLILVIALLTIPPFIAEKYTRSLGHMMLLSSILSICFTFLGLWLSYVFDITS 244

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +II+ +   F  S    
Sbjct: 245 GATIILVAGVGFFFSQILN 263


>gi|321312612|ref|YP_004204899.1| manganese ABC transporter permease [Bacillus subtilis BSn5]
 gi|320018886|gb|ADV93872.1| manganese ABC transporter (permease) [Bacillus subtilis BSn5]
          Length = 435

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 57/261 (21%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
              L   + +  ++G LG F++ ++ +  GD +AHSAL GV L+ +F    ++  F++  
Sbjct: 15  QWVLAGTLLLGTASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFLFTGQKSLPFFLLGA 74

Query: 67  LT-----SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
                  +  +  I +      D+ +G++      + +++L++++       + L SFLF
Sbjct: 75  ALAGLLGTFCIQLIPRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQQGAGSQSGLDSFLF 134

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI+LI GI  + +++    +K     T ++  AK  G+    +  +   + 
Sbjct: 135 GQAASLVRQDIILIAGISAVLLLLCIVFFKEFTLITFDFAFAKGLGIPVRFLNGLLACLI 194

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF- 236
              + + ++ +G+ L+ ++LI P + AR ++     M ++A I G    + G   S    
Sbjct: 195 VCAVVIGLQTVGVILMAAMLITPAIAARYWTERLTGMIVIAGITGGGSGVAGTLLSTTMK 254

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP +I+++  LF++S  
Sbjct: 255 GMATGPLMILSATLLFLVSMI 275


>gi|284043841|ref|YP_003394181.1| ABC transporter [Conexibacter woesei DSM 14684]
 gi|283948062|gb|ADB50806.1| ABC-3 protein [Conexibacter woesei DSM 14684]
          Length = 280

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 70/253 (27%), Positives = 130/253 (51%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA    +   +  G +GCF++ + +A+ GDT+AH+   GVA++ +  +   +   + 
Sbjct: 16  FMQRAFLVAVICGVVCGVIGCFVVLRGMAFIGDTVAHAVFPGVAIAFVLGVDFVLGGALA 75

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             LT+L++  + +N  L  D ++GV   +  SL +V+LS     +  L SFLFG IL ++
Sbjct: 76  GLLTALLITVVSQNRRLREDTVIGVFFAAAFSLGIVVLSSAPGYSGSLESFLFGQILGIS 135

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+  +   G   +   F + K L+A +++ E A+A G+   ++ +    + +  I +S
Sbjct: 136 DGDVRAVAATGAGLLAAAFALRKELVAVSLDRESARAAGLPVFRLDMALYAMVTAAIVIS 195

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+ +LLI P   AR  +     M +LA  IG L  + GLY S      +G  I
Sbjct: 196 LQAVGNVLVLALLITPAACARLLTDRLGAMLLLAPAIGALCSLAGLYLSYELGLAAGGLI 255

Query: 245 IITSLFLFILSFF 257
           ++ +  +F+  + 
Sbjct: 256 VLVATGVFVACWL 268


>gi|297559712|ref|YP_003678686.1| ABC transporter [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296844160|gb|ADH66180.1| ABC-3 protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 300

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 61/258 (23%), Positives = 135/258 (52%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  RAL + + + L T  +G +++ +R+A  GD I H AL GVAL L+      +   
Sbjct: 7   YEFMRRALVAAVLVGLVTPIIGTYLVQRRLALLGDGIGHVALTGVALGLLTSTSPVLTAA 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
           ++ATL ++++  ++     S D  L ++ +  I+  ++++       N  L S+LFG + 
Sbjct: 67  VVATLGAVLIELVRVRARTSGDVALALLFYGGIAGGVLLIGLTPGASNATLVSYLFGSVS 126

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V  +D+ ++  +    I ++    + L     + E+A+A G+    + ++  +  +L +
Sbjct: 127 TVEESDLWVVGVLAAGVIAVVAVFGRELFVLCQDEEVARAHGLPVRFLSVLLAVTAALTV 186

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G+ ++++L+I+P   A++ + S     +LA +IG+L  + GL  S   +   G
Sbjct: 187 VIAMRVVGVLMVSALMIVPVAAAQQLTKSFRVTMLLAVLIGLLSSVGGLTTSFYAELSPG 246

Query: 242 PSIIITSLFLFILSFFYK 259
            +I++ +L +F ++    
Sbjct: 247 ATIVLLALAVFGVAVAVG 264


>gi|227489233|ref|ZP_03919549.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227090764|gb|EEI26076.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 283

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 125/257 (48%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +        +G  ++ + +A+ GD +AH+   G+A++   Q+ + +   +
Sbjct: 17  AFLPRALVIALVCSAVCAVVGSHVVLRGMAFIGDAVAHAVFPGIAIAFALQVSVLLGGAL 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +    +   +  DA++G+   +  +  LV++S +   +  LTSFLFG I  V
Sbjct: 77  TGAAVAVAVAYFSQRRRVKEDALIGIFFAAAFAGGLVVMSRIDGYSASLTSFLFGSITGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +    G L I ++  + +      ++ E A+A G     + L   +  +  + +
Sbjct: 137 PARDVTITAVGGALIIALVLALTRRFTIVALDRETARALGYNVFLLDLALYLCVTAAVVL 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           SI+ +G  L+ +LL+ P  TAR  +     M  +A  IG+ G + G+Y S   D P+G +
Sbjct: 197 SIRTVGNILVLALLLTPAATARLVTQRLHTMMAVAVSIGVAGSVTGIYLSWALDLPTGAT 256

Query: 244 IIITSLFLFILSFFYKK 260
           I++T   +F++ +  ++
Sbjct: 257 IVLTLTGIFLVFWVAQR 273


>gi|239979351|ref|ZP_04701875.1| metal transport system ABC transporter permease [Streptomyces albus
           J1074]
 gi|291451226|ref|ZP_06590616.1| metal transport system ABC transporter permease [Streptomyces albus
           J1074]
 gi|291354175|gb|EFE81077.1| metal transport system ABC transporter permease [Streptomyces albus
           J1074]
          Length = 301

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 129/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + L+   +G +++ +R A  GD I H A+ GVAL  +          
Sbjct: 6   YAFMQRALLAAVLVGLTAPAIGTYLVQRRQAIMGDGIGHVAMTGVALGFLLNTSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGDIL 121
            +A L S+ +  I+     S D  L ++ +  ++  ++I++     +T +L ++LFG I 
Sbjct: 66  AVAVLGSVGMELIRSRGRTSGDVALALLFYGGMAGGVMIINLAPGGSTANLNTYLFGSIT 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  D+  +  +  L + +   + + L A   + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSPEDLTAVVVLALLVLAVTLGLRRQLFAVCQDEEFARVTGLPVRLLNLVIAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++++++P   A+R +         A +IG++  + G   +   D PSG
Sbjct: 186 TVAMRIVGLLLVSAMMVIPVAAAQRLTKGFGATLAGAMVIGVVVSLAGTVTTYYVDAPSG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++ +F++
Sbjct: 246 AAIVLLAIVVFLI 258


>gi|16080127|ref|NP_390953.1| manganese ABC transporter permease [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221311015|ref|ZP_03592862.1| manganese ABC transporter membrane protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221320258|ref|ZP_03601552.1| manganese ABC transporter membrane protein [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221324541|ref|ZP_03605835.1| manganese ABC transporter membrane protein [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|14916933|sp|O35024|MNTC_BACSU RecName: Full=Manganese transport system membrane protein mntC
 gi|2293153|gb|AAC00231.1| YtgC [Bacillus subtilis]
 gi|2635559|emb|CAB15053.1| manganese ABC transporter (permease) [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 435

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
              L   + +  ++G LG F++ ++ +  GD +AHSAL GV L+ +F    ++  F++  
Sbjct: 15  QWVLAGTLLLGTASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFLFTGQKSLPFFLLGA 74

Query: 67  LT-----SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
                  +  +  I +      D+ +G++      + +++L++++       + L SFLF
Sbjct: 75  ALAGLLGTFCIQLIPRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQQGAGSQSGLDSFLF 134

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI+LI GI  + +++    +K     T +   AK  G+    +  +   + 
Sbjct: 135 GQAASLVRQDIILIAGISAVLLLLCIVFFKEFTLITFDLAFAKGLGIPVRFLNGLLACLI 194

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF- 236
              + + ++ +G+ L+ ++LI P +TAR ++     M I+A I G +  + G   S    
Sbjct: 195 VCAVVIGLQTVGVILMAAMLITPAITARYWTERLTGMIIIAGITGGVSGVAGTLLSTTMK 254

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP +I+++  LF+ S  
Sbjct: 255 GMATGPLMILSATLLFLFSMI 275


>gi|323489328|ref|ZP_08094558.1| MntD [Planococcus donghaensis MPA1U2]
 gi|323396969|gb|EGA89785.1| MntD [Planococcus donghaensis MPA1U2]
          Length = 285

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 140/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  +AL + I + +  G +GCFII + +A  GD I+H+ L GVA+S    +       
Sbjct: 10  YDFLQKALLTSIMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYAIGINFFFGAV 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               LT++ +  + +N  +  D  +G++  +  +L +++++ ++  +TDL   LFG++LA
Sbjct: 70  FTGVLTAIGIGFVSQNSRIKQDTAIGIMFSAAFALGVILITVLE-SSTDLYHILFGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  +D+ +  GIG   ++ +F  +K LL T+ +  +A+  G+    I    + + +++  
Sbjct: 129 VRPSDMWITLGIGLTVLVSVFVFYKELLVTSFDETMAEVYGLPVRLIHYFLMTLLTMVTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   +     M  ++  IG+   IIGLY S  ++  SG 
Sbjct: 189 ASLQTVGIILVVAMLITPAATAYLLTDRLSTMIFISATIGVSAAIIGLYFSFSYNLASGA 248

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF L+F + 
Sbjct: 249 TIVLAATTLFFLAFVFS 265


>gi|227501762|ref|ZP_03931811.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium accolens ATCC 49725]
 gi|306835941|ref|ZP_07468934.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium accolens ATCC 49726]
 gi|227077787|gb|EEI15750.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium accolens ATCC 49725]
 gi|304568215|gb|EFM43787.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium accolens ATCC 49726]
          Length = 306

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 134/253 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RA+   +   +  G +GC+++ + +A+ GD ++H+   G+A++   Q  + +   +
Sbjct: 19  DFLARAVGISLIAAIVCGVIGCYVVLRGMAFIGDAVSHAVFPGLAIAFALQTSVLLGGAV 78

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++++    +   + +D+I+G+   +  +L +VI+S     +  LTSFLFG +  V
Sbjct: 79  AGAVVAVLIAAFSQRNHVRADSIIGIFFAAAFALGMVIISRTDGYSASLTSFLFGSLTGV 138

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TDI +   +  + + ++      L AT ++ E A+A G+    + +I  +  +  + +
Sbjct: 139 SRTDITVAASVCLVVLAVVVAFGPQLNATCLDRETARAMGLPVFALDIILYLCVTAAVVI 198

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+  IG  L+ +LLI P  TAR  + +   M  L+ IIG +    G+Y +   D P+G +
Sbjct: 199 SVSTIGNILVLALLITPAATARLLTANLTTMMFLSAIIGAVCSFFGIYLAWAIDLPAGAT 258

Query: 244 IIITSLFLFILSF 256
           I++T   LF++ +
Sbjct: 259 IVLTLTVLFLIVW 271


>gi|212711428|ref|ZP_03319556.1| hypothetical protein PROVALCAL_02501 [Providencia alcalifaciens DSM
           30120]
 gi|212685884|gb|EEB45412.1| hypothetical protein PROVALCAL_02501 [Providencia alcalifaciens DSM
           30120]
          Length = 288

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 120/257 (46%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + I        L CF++ +  +  GD I+H+ L G+ ++ +  +PL I  F+
Sbjct: 15  PFMQKALITAIVTGTVCAILSCFLVLKGWSLMGDAISHAVLPGIIIASLIGIPLAIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +++N  +  D ++G++     ++ LV+ + +      LT  LFGDIL +
Sbjct: 75  SGLFCAIATGYLKENSRIKEDTVMGIVFSGMFAIGLVMFAKI-DTEQHLTHILFGDILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +   I     + I I+    K  +    +   A+  G+  + +    + + +L I  
Sbjct: 134 TDDEFKQILLFAGITIAIILLKRKDFMLYCFDPNQARVIGLPVKWLHYGLLSLLALTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P + A     S   M ++A I  +   ++G   S   +  +GP+
Sbjct: 194 SLQAVGIILVIAMLISPGIIAFVLCRSFGWMLVIAIIASVTSSVLGTIVSFHINATTGPT 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+++  Y K
Sbjct: 254 IVVIQAGYFVIALIYSK 270


>gi|256825025|ref|YP_003148985.1| Mn2+/Zn2+ ABC transporter permease [Kytococcus sedentarius DSM
           20547]
 gi|256688418|gb|ACV06220.1| ABC-type Mn2+/Zn2+ transport system, permease component [Kytococcus
           sedentarius DSM 20547]
          Length = 330

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 56/255 (21%), Positives = 125/255 (49%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF  RAL + + + +    +G FI+ + ++  GD + H AL GV + L+          +
Sbjct: 8   EFMQRALLAALLVGVVAPMVGIFIVQRGLSMIGDALGHVALAGVGIGLVMHTQPVWSALV 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDILA 122
           +A   +L++  ++      SD ++ ++ H+ I+L +V+LS         L ++LFG I  
Sbjct: 68  VAVAAALLIETLRARGGTGSDVVIALMLHAGIALGVVLLSTSPAAGGAGLENYLFGAITT 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
               D++    +G + +     +   L A   + E ++++G+    + ++   + ++ I 
Sbjct: 128 TTRADLVTFAVLGLVVVAATTLLRPRLFAVAQDEEYSRSQGLPVTALNMLLSALVAVTIV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S++ +G+ LI++L+++P   A+R +         A  IG +  + G+  S   D PSG 
Sbjct: 188 MSMRVVGLLLISALMVVPNAAAQRLTRGFAAAWWCAIAIGAVSAVGGVTLSYSHDLPSGG 247

Query: 243 SIIITSLFLFILSFF 257
           +I++ ++ ++     
Sbjct: 248 TIVLVTVAIYAAVIV 262


>gi|190892433|ref|YP_001978975.1| zinc ABC transporter permease [Rhizobium etli CIAT 652]
 gi|190697712|gb|ACE91797.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 271

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 147/257 (57%), Positives = 212/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   ++ L  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLVALAWLWRPLLAATVNAELAEAEGLRPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+ A++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVFASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALVLFILSLL 257


>gi|297243292|ref|ZP_06927226.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis AMD]
 gi|296888699|gb|EFH27437.1| ABC-type Mn2+/Zn2+ transporter, permease component [Gardnerella
           vaginalis AMD]
          Length = 287

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 138/252 (54%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F ++AL       +  G +GC+++ + +A+ GD +AHS   G+A++ + Q  L +   + 
Sbjct: 18  FLLKALIVACLSSVICGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLLGGALA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T+L++    +N  L  D+ +GV   S  +L +VI+S        L SFLFG I  + 
Sbjct: 78  GVATALIVSIFSQNRRLREDSFIGVFFVSAFALGIVIISKASGYAGSLESFLFGSITGIP 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI ++   G + + IL    K L+  +++ E ++A G+    +  +  ++ ++ + VS
Sbjct: 138 DSDIAVVAITGLIILAILCMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LL+ P  TAR  +     M +LA +IG +  I+G+Y S  FDT +G +I
Sbjct: 198 VQIIGNVLVLALLVTPAATARLLTDRLSRMMVLAPVIGCVSSIVGMYISWSFDTATGGTI 257

Query: 245 IITSLFLFILSF 256
           ++ +  LF+L++
Sbjct: 258 VLVATALFVLAW 269


>gi|124025370|ref|YP_001014486.1| ABC transporter [Prochlorococcus marinus str. NATL1A]
 gi|123960438|gb|ABM75221.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. NATL1A]
          Length = 290

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 130/258 (50%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + ++F  RAL     +    G L C++  +  A  GD ++H+ + GV ++    LP ++ 
Sbjct: 18  LTHDFMRRALMVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYALGLPFSLG 77

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  +++   +  D ++G++     +L LV++S +K  N DL   LFG  
Sbjct: 78  AFVFGVGSVALIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKIK-SNIDLMQILFGSP 136

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I F+ I IL    K L+    + + A++ G+    +  + + + SL 
Sbjct: 137 LGISRSDVNQTLIISFIVISILLIFRKDLMLYCFDAKHARSIGINTGILHYLLLTLLSLS 196

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +   + M +LA I      IIG+Y S   D  +
Sbjct: 197 AVVGLQTVGIILVVAMLITPGATAYLLTDRFDQMTLLAVISSSFSSIIGVYISYWSDIET 256

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++    +F+++F +
Sbjct: 257 GGSIVLVQTLIFLIAFLF 274


>gi|33862689|ref|NP_894249.1| ABC transporter [Prochlorococcus marinus str. MIT 9313]
 gi|33634605|emb|CAE20591.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9313]
          Length = 289

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           +EF +RAL     +    G L C++  +  A  GD ++H+ + GV ++    LP +I  F
Sbjct: 20  HEFMVRALVVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYALGLPFSIGAF 79

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +  ++  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 80  VFGVGSVALIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 138

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DI     I  + + IL  + +  +    +   A++ G+    +  + + + SL   
Sbjct: 139 ISMADIQQTLLISGIVVAILLVLRRDFMLFCFDPTHARSIGINTGLLHYLLLSVLSLAAV 198

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++LI P  TA   +   + M +LA +   L  ++G+Y S   D+ +  
Sbjct: 199 AGLQTVGIILVVAMLITPGATAYLLTDRFDRMTLLAILSSALSSVLGVYISYWTDSSTAG 258

Query: 243 SIIITSLFLFILSFFYK 259
            I++    LF+L+F + 
Sbjct: 259 CIVLVQTVLFLLTFLFS 275


>gi|94984639|ref|YP_604003.1| hypothetical protein Dgeo_0532 [Deinococcus geothermalis DSM 11300]
 gi|94554920|gb|ABF44834.1| ABC-type Mn2+ transport system, permease component [Deinococcus
           geothermalis DSM 11300]
          Length = 269

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 67/257 (26%), Positives = 141/257 (54%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +FF+RAL + + + +    +G +++ + ++Y GD ++H+ L G+  + +    L +   +
Sbjct: 11  DFFLRALAAVVLVSILCALVGAWVVLRGLSYIGDAMSHAVLPGIVGAFLTGGNLLLGALV 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A LT+L +  +     L  D+ +G++     +L +V+LS +    TDL++FL G+ L V
Sbjct: 71  AAVLTALGIGAVSGRGGLKQDSAIGIVFVGMFALGVVMLSRVSTFTTDLSNFLIGNPLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+    G+  +   +L  + K LL  + +   A+A G+    +  + +++  L++ +
Sbjct: 131 TPGDLWGALGVTLVVGALLTAVQKELLLASFDPTEARAIGLPVRWLNHLLLILIGLVVVL 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G TL  SLLI  +  AR  + S + M +LA ++G LG + GLY S   +T  G +
Sbjct: 191 TVQLVGTTLSVSLLITSSAAARLLARSLKKMILLAALLGTLGGVTGLYLSYYVNTAPGAT 250

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  +F+L+  +++
Sbjct: 251 IVLVNTAIFLLALAFRR 267


>gi|170079094|ref|YP_001735732.1| zinc ABC transport family protein [Synechococcus sp. PCC 7002]
 gi|169886763|gb|ACB00477.1| zinc ABC transport family protein [Synechococcus sp. PCC 7002]
          Length = 290

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 134/256 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL +GI + ++ G +G F++  RI +    IAH+A  G+ L   FQ         
Sbjct: 23  DFMQNALMAGILVSIACGIIGTFVVVNRIVFISGGIAHAAYGGIGLGYFFQFNPIWGAIA 82

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +++L +  +++      D ++GV+    +++ ++++ F +     L S+LFG ILAV
Sbjct: 83  FGLISALGMGWVEQQTKQRGDTLIGVMWAIGMAIGIILIDFTEGYKAGLESYLFGSILAV 142

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ L++G+  + I ++  ++K LLA + +   A    +    + L+ + + +L + +
Sbjct: 143 PRSDLWLMFGVDCVIIALIALLYKELLAISFDPVFATTRNLPVRSLYLVLVGLIALTVVM 202

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +G+ ++ +LL +P   A ++      M  LA+++GI     GL+ S  F+  SG +
Sbjct: 203 VMQIVGLIMVIALLTIPAAIASQWQKKITAMMGLASLLGISFTTTGLWLSYRFNLTSGAT 262

Query: 244 IIITSLFLFILSFFYK 259
           II+ S   ++LS   K
Sbjct: 263 IILVSGIAYLLSLGLK 278


>gi|294623552|ref|ZP_06702398.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|291597034|gb|EFF28239.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
          Length = 293

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 136/249 (54%), Gaps = 1/249 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQ-SATDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+L  ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMLSAVVGVFFSYSYNWPS 248

Query: 241 GPSIIITSL 249
           G +I++   
Sbjct: 249 GATIVLACT 257


>gi|119511537|ref|ZP_01630646.1| permease protein of ABC transporter [Nodularia spumigena CCY9414]
 gi|119463848|gb|EAW44776.1| permease protein of ABC transporter [Nodularia spumigena CCY9414]
          Length = 281

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 72/260 (27%), Positives = 139/260 (53%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ +    +   
Sbjct: 9   LQYSFMQRSLIIAIIVGLLCAVVGSYLMVQRLALLGDAISHSVLPGLAIAFMLGGNIYFG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   ++++ +  IQ    +  DA +G++  +  +L + +++ ++     DL  FLFG+
Sbjct: 69  AFIAGVVSTMAIAWIQTRSPIKEDAAMGIVLSAFFALGITLITVIQKSQKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V + ++     I  + ++++F ++K LL  T +   A+A G+   ++    ++I +L
Sbjct: 129 ILGVTSNEVRDTAIIAAIVLIVIFLLYKELLFYTFDPLGAQAAGLPVNQLNFGLMLIIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL   IG++  I G+Y S  ++ P
Sbjct: 189 TIVASMKTVGVVLVLSLLITPGATAYLLVKRLHQVMILGAFIGVISSISGMYLSYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++    LF+L+  + 
Sbjct: 249 SGPAIVLVVSGLFLLALLFS 268


>gi|238063048|ref|ZP_04607757.1| ABC-3 type transporter [Micromonospora sp. ATCC 39149]
 gi|237884859|gb|EEP73687.1| ABC-3 type transporter [Micromonospora sp. ATCC 39149]
          Length = 311

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 137/255 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +GC+++ + +A+ GD +AH+   G+A++ + Q  L +   +
Sbjct: 16  AFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFVLQGSLVLGGAV 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L++    +N  +  D+++GV   +T +L +VI+S        L  FLFG I  +
Sbjct: 76  AGVATALLIAIFSQNRRVKEDSLIGVFLVATFALGIVIISQAPGYAGSLQQFLFGSITGI 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G G + + ++  + K  +A  ++ E++++ G+    + ++  ++ +L + +
Sbjct: 136 PDRDLYVVGGTGLVILGLVLALHKEFVAVCLDREMSRSMGLPVFWLDIVLYVLVTLAVVI 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LLI P   AR  +     M +LA  IG +   +GLY S  +DTP G +
Sbjct: 196 SLQTIGNILVLALLITPAAAARLLTDRLGVMMLLAPAIGGVSAFVGLYLSWSYDTPVGGT 255

Query: 244 IIITSLFLFILSFFY 258
           +++ +  +F+ ++  
Sbjct: 256 VVLVATAIFLAAWLI 270


>gi|188587395|ref|YP_001918940.1| ABC-3 protein [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352082|gb|ACB86352.1| ABC-3 protein [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 289

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 149/257 (57%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++   A+ +G  + +  G +GCFII +R++  GD I+H+ L GV +S +  +   I   
Sbjct: 20  YQYLQNAIIAGTLVGILCGVIGCFIILRRLSLMGDAISHAVLPGVVISYMLGITFFIGAV 79

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    T+L +  + +N  L  D+ +G++  +  +L +V+++ +     DL   LFG++LA
Sbjct: 80  ITGVATALGIGYVSQNSKLKDDSSIGILFTAAFALGIVMITALDGTEVDLWHILFGNVLA 139

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D+LL    G ++++ +F  ++ L+ +T +  +A+A G+  +K+  + +++ SL+  
Sbjct: 140 VSRSDLLLTASTGIVSLIGIFIYYRELVISTFDPIMARAIGIATDKLHYLLMLLLSLVTV 199

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   + +   M IL+ IIG++  + G+Y S I+D  +G 
Sbjct: 200 ASLQTVGIVLVVAMLITPAATAFLLTRNLARMLILSAIIGVISSLAGVYFSFIYDVATGG 259

Query: 243 SIIITSLFLFILSFFYK 259
           +I++    LF+ +F + 
Sbjct: 260 AIVLAVSVLFLAAFLFS 276


>gi|315633957|ref|ZP_07889246.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeD [Aggregatibacter segnis ATCC
           33393]
 gi|315477207|gb|EFU67950.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeD [Aggregatibacter segnis ATCC
           33393]
          Length = 282

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 65/258 (25%), Positives = 128/258 (49%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   AL + + + +    L C+++ +  +  GD I+H+ L G+ ++    LPLTI  F
Sbjct: 14  YPFMQNALITALLVSIICAMLSCYLVLKGWSLMGDAISHAVLPGIVVAFWLSLPLTIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L S+ +  +++N  +  D  +G++     +L +V+ S ++  +  LT  LFG++L 
Sbjct: 74  VAGLLCSVCVGYLKENSRIKEDTAMGIVFSGMFALGIVLFSKIE-TDQHLTHILFGNLLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  ++L    I  +   ++F   K  L    +   AK  G+ P  +    +++ +L I 
Sbjct: 133 VSDAEMLQTLVISAVVFGVVFLRRKDFLLYCFDATQAKIVGLSPRLLHYSLLILLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L+ ++LI P +TA   S   ++M ++A    I   I G   S   D  +GP
Sbjct: 193 SAMQVVGVILVVAMLISPGITAFILSKRFDHMIVIALATSISTSIFGTIISYHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            II+    +F+ +  Y K
Sbjct: 253 CIILLQAAVFLTALIYSK 270


>gi|261867809|ref|YP_003255731.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413141|gb|ACX82512.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 261

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 109/257 (42%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I  
Sbjct: 3   DILFPAWLTGIILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L S+ L+ ++ N   S D +LG+I HS +S+ +V +  +K V  DL S+LFGD+LA+
Sbjct: 63  LTLLLSIALVWLENNTQFSIDTLLGIIAHSCLSIGVVTVGLLKNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D+  I     + +  L   WKPL++ T++ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYQDLWYIGIGAIIVLAALCYFWKPLISATISPELAQVEGINVKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE MAI+A  I ++ + +GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPETMAIIAVFISMIAVSLGLTLSAYYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S FLF+ S   K+
Sbjct: 243 VVICSTFLFLCSLLKKQ 259


>gi|258517251|ref|YP_003193473.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257780956|gb|ACV64850.1| ABC-3 protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 285

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 152/260 (58%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  +F +RAL +G  + +    +G F++ +R ++  DT+AH +L GVAL L   +     
Sbjct: 5   LQYDFMVRALAAGAIVGIICPAIGVFLVLRRYSFMADTLAHVSLAGVALGLYLGVNPFAV 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
               A   +L + ++++N+ L  +AIL ++  + ++LA+V++S  +    DL  +LFG I
Sbjct: 65  TVGTALTAALSIERMRENQKLPGEAILALVMSAGLALAVVLISLSQGFGVDLMGYLFGSI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V   D+  I  +G L +++LF ++K       + + A+  G+  +K+ L+FI++T+L 
Sbjct: 125 LTVGPRDVWGILLLGLLVLLVLFFLFKEFFLMAFDEDYARVSGLPYDKLNLVFIILTALT 184

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           +++S++ +G  L+ +L+++P +T+   S S + +  L+  +GI  I+ GL  S  ++ PS
Sbjct: 185 VAISLRIVGGLLVGALMVIPVLTSLLVSRSFKQVFFLSMFLGISEILTGLVVSYYWNLPS 244

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G ++++T+L +F  ++   K
Sbjct: 245 GGAVVLTALAVFFAAYSSGK 264


>gi|148243287|ref|YP_001228444.1| ABC-type Mn2+ transport system permease component [Synechococcus
           sp. RCC307]
 gi|147851597|emb|CAK29091.1| ABC-type Mn2+ transport system permease component [Synechococcus
           sp. RCC307]
          Length = 280

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 127/256 (49%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RAL     +    G L C++  +  A  GD ++H+ L GV L+    LP ++  F
Sbjct: 11  HDFMVRALLVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVLPGVVLAYALGLPFSLGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 71  VFGVGSVTAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DI     I  L + +L  + + LL    +   A++ G+    +  + + + SL   
Sbjct: 130 ISQADIQQTLLISALVVAVLLLLRRDLLLFCFDPTHARSIGINTGLLHYVLLSVLSLAAV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   +   + M +LA    +L  ++G+  S   D+ +  
Sbjct: 190 AGLQSVGIILVVAMLVTPGATAYLLTDRFDRMTLLAITSSVLASLLGVIISYWSDSSTAG 249

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 250 CIVLVQTGLFLLAFLF 265


>gi|145297629|ref|YP_001140470.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850401|gb|ABO88722.1| ABC-type high affinity zinc transporter, permease component
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 259

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 110/258 (42%), Positives = 184/258 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            + F + AL +G+GI L  GPLG F++W+++AYFGDT++H+ L G+AL ++ Q+ LT+ +
Sbjct: 1   MDSFLLYALAAGLGIALLAGPLGSFVVWRKMAYFGDTLSHACLFGIALGILLQVDLTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +     +++L+ + +N+ +++D +LG++ HS +SL LV LSFM  V  DL ++LFGD+L
Sbjct: 61  VVCCLAMAMLLVIMSRNQQVATDTLLGILAHSALSLGLVTLSFMDNVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +V   D+L I+G G L ++ L+++W PLL+ T++ ELA+ EG++ + ++ + +++  L+I
Sbjct: 121 SVQPVDLLWIYGGGALVLLTLWRLWDPLLSMTISEELARVEGVRVDVLRCVLMLLIGLVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++KF+G  +ITSLLI+P  TARRFS +PE MA  A +IG L ++ GL  S   DTP+G
Sbjct: 181 AVAMKFVGALIITSLLIIPAATARRFSQTPEQMAGFAALIGCLAVLGGLSLSWYQDTPAG 240

Query: 242 PSIIITSLFLFILSFFYK 259
           PS+++ +  +FILS F K
Sbjct: 241 PSVVVCATSMFILSQFKK 258


>gi|119716167|ref|YP_923132.1| ABC-3 protein [Nocardioides sp. JS614]
 gi|119536828|gb|ABL81445.1| ABC-3 protein [Nocardioides sp. JS614]
          Length = 337

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 130/257 (50%), Gaps = 4/257 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RA+ + +   L+   +G +++ +R+A  GD I H A+ GVAL L+  +       +
Sbjct: 11  PFMQRAIIAALFTGLAAPVVGTYLVQRRLALMGDGIGHVAVTGVALGLLTGVSPVWMAVL 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           ++ L ++++  I++    + D  L ++ +  ++  ++I          L ++LFG I  +
Sbjct: 71  VSVLGAILIEVIRERGHANGDVALALLFYGGLAGGVLITGLAGQSGARLQTYLFGSITTM 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L+   +  + +++   +   L A   + E A+  G+      ++  ++ ++ +SV
Sbjct: 131 SEADVLVTMALAGVVVLLGVGLAPQLFAVAQDQEFARVAGLNIRAYNVLVAVLAAVSVSV 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFD----TP 239
           +++ +G+ L+++L+++P  TA++ + S     + A  +G +  + GL  S          
Sbjct: 191 AMRTVGLLLVSALMVVPVATAQQLTRSFRGTLLAAMALGTVAAVGGLLISAAAPDGTTVA 250

Query: 240 SGPSIIITSLFLFILSF 256
            GP+I++ +L  F LS+
Sbjct: 251 PGPAIVLLALGCFTLSW 267


>gi|126664514|ref|ZP_01735498.1| zinc ABC transporter, permease protein [Marinobacter sp. ELB17]
 gi|126630840|gb|EBA01454.1| zinc ABC transporter, permease protein [Marinobacter sp. ELB17]
          Length = 268

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 106/253 (41%), Positives = 177/253 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS + Q+P+ + +
Sbjct: 6   LDDFFWRALIGGLGVALVAGPLGCFVVWRRLAYFGDTLAHSALLGIALSFVIQVPINVGV 65

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +     +L L+   +++ L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+L
Sbjct: 66  IITCLGLALALVLFSRSKTLATDTLLGILAHSALAIGLVTLSFMPSVRMDLTGLLFGDLL 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ +D+  I+G     + +L  +W+ LL +T++ ELA+ EG+  E+++L  I++ +++I
Sbjct: 126 AMSRSDLWWIYGGAATILCLLALLWRGLLMSTIHEELARVEGVPVERLRLALILMFAIVI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LIT+LLI+P  TARR + +PE M  +A + G + +  GL  S   DTP+G
Sbjct: 186 AVAMKIVGVLLITALLIIPAATARRLARTPEQMVAMAMLFGFIAVTGGLALSWELDTPAG 245

Query: 242 PSIIITSLFLFIL 254
           PS+++T+   F+L
Sbjct: 246 PSVVVTAFSCFLL 258


>gi|126695967|ref|YP_001090853.1| ABC transporter [Prochlorococcus marinus str. MIT 9301]
 gi|126543010|gb|ABO17252.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9301]
          Length = 290

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 124/249 (49%), Gaps = 1/249 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + +EF  +AL     +    G L  ++  +  A  GD ++HS + GV ++    LP ++ 
Sbjct: 17  LTHEFMRKALLMSSLVAAVCGFLSSYLTLKGWALMGDAVSHSVMPGVVVAYALGLPFSLG 76

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  I++   +  D ++G++     +L +V++S +K  N DL S LFG  
Sbjct: 77  AFIFGVGSVALIGFIKQKSRVKEDTVIGLVFTGFFALGIVLVSKIK-SNIDLHSILFGSP 135

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I  L +++L    K L+    +   AK  G+    +  + +   SL 
Sbjct: 136 LGISLSDVKQTIFICLLVVILLSIFRKDLMLYCFDPRHAKTVGINVFFLHYLLLTCLSLA 195

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +   +NM +++ +  I+  +IG+Y S  FD  +
Sbjct: 196 AVVGLQSVGIILVVAMLITPGATAYLLTDKFDNMTVISVLSAIISSLIGIYVSFWFDLET 255

Query: 241 GPSIIITSL 249
           G SI++   
Sbjct: 256 GGSIVLAQT 264


>gi|116671821|ref|YP_832754.1| ABC-3 protein [Arthrobacter sp. FB24]
 gi|116611930|gb|ABK04654.1| ABC-3 protein [Arthrobacter sp. FB24]
          Length = 291

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F +RA+ +     +    L C+++    +  GD ++H+ L GV L+ I   P  I   
Sbjct: 13  YDFMVRAIITTALAAIVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFAIGAL 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           + A +   ++  ++    +  DA +G++  S  +L LV++S      TDL   +FG++L 
Sbjct: 73  VFALIAVTLIGVVRNTSRVKEDAAIGIVFSSLFALGLVLISVTP-SQTDLNHIIFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D++ +  +G +   IL    + L     +   A A G+ P+++  + + + +L   
Sbjct: 132 VSIPDLIQVLVLGVVAFAILILKRRDLTLYAFDPTHAHAIGLSPKRLGALLLGLLALTSV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   +     M ++A +I  +  I G+Y S   DT SG 
Sbjct: 192 VALQTVGVVLVVAMLIIPGATAYLLTDRFSRMLVIAPVISAVCSITGIYLSYYLDTASGA 251

Query: 243 SIIITSLFLFILSFFYK 259
            +++T   +F   + + 
Sbjct: 252 MVVLTQGVVFAAVYLFS 268


>gi|291485513|dbj|BAI86588.1| manganese ABC transporter, membrane protein [Bacillus subtilis
           subsp. natto BEST195]
          Length = 435

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 57/261 (21%), Positives = 123/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
              L   + +  ++G LG F++ ++ +  GD +AHSAL GV L+ +F    ++  F++  
Sbjct: 15  QWVLAGTLLLGTASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFLFTGQKSLPFFLLGA 74

Query: 67  LT-----SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
                  +  +  I +      D+ +G++      + +++L++++       + L SFLF
Sbjct: 75  ALAGLLGTFCIQLIPRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQQGAGSQSGLDSFLF 134

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI+LI GI    +++    +K     T +   AK  G+    +  +   + 
Sbjct: 135 GQAASLVRQDIILIAGISAALLLLCIVFFKEFTLITFDLAFAKGLGIPVRFLNGLLACLI 194

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF- 236
              + + ++ +G+ L+ ++LI P + AR ++     M ++A I G +  + G   S    
Sbjct: 195 VCAVVIGLQTVGVILMAAMLITPAIAARYWTERLTGMIVIAGITGGVSGVAGTLLSTTMK 254

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP +I+++  LF+ S  
Sbjct: 255 GMATGPLMILSATLLFLFSMI 275


>gi|221315341|ref|ZP_03597146.1| manganese ABC transporter membrane protein [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
          Length = 438

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
              L   + +  ++G LG F++ ++ +  GD +AHSAL GV L+ +F    ++  F++  
Sbjct: 18  QWVLAGTLLLGTASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFLFTGQKSLPFFLLGA 77

Query: 67  LT-----SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
                  +  +  I +      D+ +G++      + +++L++++       + L SFLF
Sbjct: 78  ALAGLLGTFCIQLIPRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQQGAGSQSGLDSFLF 137

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI+LI GI  + +++    +K     T +   AK  G+    +  +   + 
Sbjct: 138 GQAASLVRQDIILIAGISAVLLLLCIVFFKEFTLITFDLAFAKGLGIPVRFLNGLLACLI 197

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF- 236
              + + ++ +G+ L+ ++LI P +TAR ++     M I+A I G +  + G   S    
Sbjct: 198 VCAVVIGLQTVGVILMAAMLITPAITARYWTERLTGMIIIAGITGGVSGVAGTLLSTTMK 257

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP +I+++  LF+ S  
Sbjct: 258 GMATGPLMILSATLLFLFSMI 278


>gi|218441643|ref|YP_002379972.1| ABC transporter [Cyanothece sp. PCC 7424]
 gi|218174371|gb|ACK73104.1| ABC-3 protein [Cyanothece sp. PCC 7424]
          Length = 285

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 79/257 (30%), Positives = 134/257 (52%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF   AL  GI + L    +G ++I QR+A  GD IAH  L G+++S    + + I  F
Sbjct: 11  YEFMRNALGIGILVGLLCPVVGSYLIVQRMALLGDVIAHCVLPGLSISFFLGIDILIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L + ++  I+    +  D+ + +   S  +L + ++S +K    DL SFLFGDIL 
Sbjct: 71  TSGILGAFLIAWIRSQSRIKVDSAMALTFSSFFALGITLMSVLK-NKLDLDSFLFGDILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V +TDI     I  L ++ +   +K LL    +   A+A G+    I   F+++ +L I 
Sbjct: 130 VTSTDIYRTLIITVLILLTIKLFYKELLFYVFDRNGAQAIGLPINTIYTGFMVVITLTII 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ SLL+ P + A         M IL + IG++  + G+Y S  ++ PSGP
Sbjct: 190 ASMQAVGVILVISLLVGPALAAYLLVKELHQMMILGSAIGMISSVTGVYISYYYNLPSGP 249

Query: 243 SIIITSLFLFILSFFYK 259
            I++ S  LF+++  + 
Sbjct: 250 MIVLMSSSLFLMALLFS 266


>gi|169831699|ref|YP_001717681.1| ABC-3 protein [Candidatus Desulforudis audaxviator MP104C]
 gi|169638543|gb|ACA60049.1| ABC-3 protein [Candidatus Desulforudis audaxviator MP104C]
          Length = 279

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 136/257 (52%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  RA  +GI   L    +  F++ QR+++ G  ++HSAL G+A+ +   +       
Sbjct: 6   YEFMQRAFLAGILAGLLCSFVSLFVVLQRMSFVGVGVSHSALGGIAIGVFLGVNPVFSAA 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +  T+ +  +  + K   L +D ++GV   ++++  + ++S       +L  FLFG+ILA
Sbjct: 66  VFCTVVAWAIGLVSKEGRLHADTVIGVFFSASMAFGIALISLAPGYQPELFGFLFGNILA 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   DI+L+   G + ++ L   +K LL    + E A+A G+    +    + + ++ + 
Sbjct: 126 VTPADIVLLTASGAVIVLFLTFFFKELLFMCFDEESARAAGIPVTFLYYALLTVIAVTVV 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS+K +GI L ++LL++P VT   FS +   M  ++   G+   + GL+ S + + PSG 
Sbjct: 186 VSVKILGIVLASALLVIPAVTGYEFSRNFRGMLAVSVGSGVFSALAGLWLSYVLNLPSGA 245

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF+L+F   
Sbjct: 246 TIVLCATALFLLAFILS 262


>gi|145631813|ref|ZP_01787572.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae R3021]
 gi|144982532|gb|EDJ90086.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae R3021]
          Length = 271

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     L+  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLSHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A I  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIISSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|209549966|ref|YP_002281883.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535722|gb|ACI55657.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 271

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 146/257 (56%), Positives = 213/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV++TDI LIWG G   ++ +  +W+PLLA TVN ELA+AEG++PE+ +L F+++ +++
Sbjct: 121 LAVSSTDIALIWGGGLFVLVAMAWLWRPLLAATVNAELAEAEGLKPERARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSATPEIMAVLASVIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALILFILSLL 257


>gi|89073525|ref|ZP_01160048.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium sp. SKA34]
 gi|89050789|gb|EAR56270.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium sp. SKA34]
          Length = 261

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 109/256 (42%), Positives = 188/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLVLAVILVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+L I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++L+ +++  ++I+V
Sbjct: 123 TTNDLLWIYCGGAVVLALLIYLWRPLLSMTISEEMAQVEGVNVDLMRLLLMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE+MA+ A+IIG + +++GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPESMAVFASIIGAIAVVLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  +FILS   +
Sbjct: 243 VVVSAAAMFILSQLKR 258


>gi|146310771|ref|YP_001175845.1| ABC-3 protein [Enterobacter sp. 638]
 gi|145317647|gb|ABP59794.1| ABC-3 protein [Enterobacter sp. 638]
          Length = 285

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/256 (26%), Positives = 137/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  LSGGLAAASMLFLNQRSRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG ++I++L   WK L+ T  +   A+A G++PE++K++F  + ++   
Sbjct: 129 IAPEDILQLTIIGVVSILVLLFKWKDLMVTFFDENHARAIGLRPERLKILFFTLLAVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG L   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSLTSFLGAWASYYLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|226311066|ref|YP_002770960.1| manganese ABC transporter permease protein [Brevibacillus brevis
           NBRC 100599]
 gi|226094014|dbj|BAH42456.1| manganese ABC transporter permease protein [Brevibacillus brevis
           NBRC 100599]
          Length = 286

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             EF  +ALF+ + + L  G +G FII + ++  GD I+H+ L GVALS  F +   +  
Sbjct: 9   QYEFLQKALFTSVVVGLICGVIGSFIILRGMSLMGDAISHAVLPGVALSYAFGINFFVGA 68

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   LT++ +  + +N  + +D  +G++  S  ++ +++++ +K  +TDL   LFG++L
Sbjct: 69  VLTGVLTAVGIGYVSQNSRIKNDTAIGILFTSAFAIGIIMVTMLK-SSTDLYHILFGNVL 127

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV ++D+ +  GIG + I+ ++  +K LL T+ +  +A A G++   I  + + + +++ 
Sbjct: 128 AVRSSDMWVTVGIGVIVIVTVYAFFKELLLTSFDPTIAAAYGLRNNLIHYLLMTLLTMVT 187

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P  TA   +     M  LA   G+L  +IGLY S  ++  SG
Sbjct: 188 VASLQTVGIVLVVAMLITPAATAYLLTDRLSIMIFLAGGFGMLSSVIGLYFSFTYNLASG 247

Query: 242 PSIIITSLFLFILSFFYKK 260
            +I++ +  LF L+F + +
Sbjct: 248 ATIVVVATVLFFLAFLFSR 266


>gi|319943172|ref|ZP_08017455.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Lautropia mirabilis ATCC 51599]
 gi|319743714|gb|EFV96118.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Lautropia mirabilis ATCC 51599]
          Length = 290

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/253 (22%), Positives = 121/253 (47%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL     + +    L CF++ +  A  GD I+H+   GV ++ +  +PL +  F+
Sbjct: 13  DFMRDALLMAAVVAVPCALLSCFLVLKGWALMGDAISHAVFPGVVIAYMIGIPLAVGAFV 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+   + ++  +  D ++GV+  S  +L L++  + +     L   LFGD+L  
Sbjct: 73  AGMGCALLTGYVNEHSRIKQDTVMGVVFSSMFALGLLLYVWAR-SEVHLEHILFGDVLGT 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L    I  +    +   W+ L+  + +   A+  G+    +    +   SL +  
Sbjct: 132 SPQDLLESGSIALVVAGWISLKWRDLMLQSFDPVQARTAGLPVRLLHYALLAAVSLAVVG 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   AR  + +   M ++A ++ ++  ++G+Y +   D+   P+
Sbjct: 192 ALKSVGIVLTISLLIAPGAIARLLTRTFGRMLVVAVLLTVVTSLVGVYLAFFLDSAPAPT 251

Query: 244 IIITSLFLFILSF 256
           I++     FI++ 
Sbjct: 252 IVLLLALQFIVAL 264


>gi|251792186|ref|YP_003006906.1| acylphosphatase [Aggregatibacter aphrophilus NJ8700]
 gi|247533573|gb|ACS96819.1| acylphosphatase [Aggregatibacter aphrophilus NJ8700]
          Length = 282

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 61/258 (23%), Positives = 129/258 (50%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   AL + + + +    L C+++ +  +  GD I+H+ L G+ ++    LPL +  F
Sbjct: 14  YPFMQNALITALLVSIICAMLSCYLVLKGWSLMGDAISHAVLPGILVAFWLSLPLALGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L S+ +  +++N  +  D  +G++     +L +V+ + ++  +  LT  LFG++L 
Sbjct: 74  VAGLLCSVCVGYLKENSRIKEDTAMGIVFSGMFALGIVLFTKIE-TDQHLTHILFGNLLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  ++L    I  +  +++F   K  L    +   AK  G+ P  +    +++ +L I 
Sbjct: 133 VSDAEMLQTLVISAVIFLVVFLRRKDFLLYCFDATQAKIVGLSPRLLHYSLLILLALTIV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G+ L+ ++LI P +TA   +   + M  +A +  I   I+G   S   D  +GP
Sbjct: 193 SAMQVVGVILVVAMLISPGITAFILTKRFDYMIAIALVTSISTSILGTIVSYHIDGATGP 252

Query: 243 SIIITSLFLFILSFFYKK 260
            II+    +F+++  Y K
Sbjct: 253 CIILLQAAVFLIALVYSK 270


>gi|90408803|ref|ZP_01216947.1| putative iron transport system membrane ABC transporter protein
           [Psychromonas sp. CNPT3]
 gi|90310106|gb|EAS38247.1| putative iron transport system membrane ABC transporter protein
           [Psychromonas sp. CNPT3]
          Length = 292

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              + I A+F    +      L  +++ +  +  GD ++HS + GVA + +  LP ++  
Sbjct: 10  QYHYMINAIFVSALVGAVCAFLSVYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGA 69

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F    L +  +L +Q++  L  DAI+G+I  S   L L ++S +   + ++ + + G+IL
Sbjct: 70  FFSGGLAATTMLFLQRHSKLKEDAIIGLIFTSFFGLGLFMVS-LSPTSVNIQTIVLGNIL 128

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A+   D + +  IGF+ ++IL   WK  +    +   A + G+ P  +K++F  + S   
Sbjct: 129 AITPDDTIQLMIIGFVTLLILTCKWKDFMVLFFDENHAVSIGLNPTYLKILFFTLLSAST 188

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  L+ ++++ P  +A   S    ++ I++ +IG    + G Y S   D  +G
Sbjct: 189 VAALQTVGAFLVIAMVVTPGASAYLLSDKFSHVIIISVLIGTFSSLFGAYLSYFVDGATG 248

Query: 242 PSIIITSLFLFILSFFY 258
             II+    +F+L F +
Sbjct: 249 GVIILLQTLVFLLCFVF 265


>gi|157371015|ref|YP_001479004.1| high-affinity zinc transporter membrane protein [Serratia
           proteamaculans 568]
 gi|157322779|gb|ABV41876.1| ABC-3 protein [Serratia proteamaculans 568]
          Length = 261

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVLLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +LVL+ +++   LS D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLVLALVLVWLERRPQLSVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TDI +I     + ++IL+  W+ LL+ TV+ ELA  +G+   + + + +++T+L I +
Sbjct: 123 TLTDIWMIGIGVTVVLLILWWQWRNLLSMTVSPELAHVDGVNLVRARTVLMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA  A ++GIL +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGYAVLVGILAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++++  LF+LS   K+
Sbjct: 243 VVLSAAVLFVLSLSKKQ 259


>gi|78484920|ref|YP_390845.1| hypothetical protein Tcr_0575 [Thiomicrospira crunogena XCL-2]
 gi|78363206|gb|ABB41171.1| ATP-binding cassete (ABC) superfamily transporter, permease
           component [Thiomicrospira crunogena XCL-2]
          Length = 268

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 103/255 (40%), Positives = 169/255 (66%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   A   GI I L   PLG F++WQ+ +YFG  +AHSALLGV+  L+ +L LT+ + +I
Sbjct: 11  FIQLAFLGGILIALIAAPLGVFMVWQKQSYFGAALAHSALLGVSFGLLIELNLTLAVVLI 70

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           +   +L +  +++   LSSD +LG++ HST+++ L+ILS    V  D+ S+LFGDIL+++
Sbjct: 71  SLGVALGIHFLKEKTRLSSDTLLGILAHSTLAIGLIILSLQSHVQIDIFSYLFGDILSID 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           + D+  I  +G L  +  +  W  LL TT+N ELA+ EG+  +K++L ++++ +L+I+V+
Sbjct: 131 SMDLNFILLLGGLVSLFFWFHWHDLLNTTLNAELAQIEGIPTQKVQLYYVLLLALLIAVA 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+ LITSLLI+P   AR+FS SPE M   + + G + ++ GL  S+ +D P+GPSI
Sbjct: 191 MKIVGVLLITSLLIIPAAAARKFSNSPERMLTFSMVFGFISVLFGLLSSIFWDLPTGPSI 250

Query: 245 IITSLFLFILSFFYK 259
           +  +  +F++S F K
Sbjct: 251 VAIATVIFLVSLFKK 265


>gi|327478655|gb|AEA81965.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri DSM
           4166]
          Length = 261

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 117/259 (45%), Positives = 185/259 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+AL GVAL L+  + LT+ +
Sbjct: 1   MPDFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALFGVALGLMLDVNLTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +L+L+ +Q+ + L+SD +LG++ HST+SL LV LSFMK V  DL  +LFGD+L
Sbjct: 61  TVGCVLLALLLVTLQQRQPLASDTLLGILAHSTLSLGLVSLSFMKDVRVDLMGYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  +D+  I G   L +++L  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I
Sbjct: 121 AVGPSDLAWIIGGSALVLLMLIPLWRPLLAITVHEELAKVEGLPVAGIRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + +PE MA+ A+I+GI+ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARTPEQMALGASILGIVAVCLGLTLSWYEDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF + K
Sbjct: 241 PSIVVSAAALFLLSFAWPK 259


>gi|330814341|ref|YP_004358580.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487436|gb|AEA81841.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 261

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 127/260 (48%), Positives = 199/260 (76%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FFIRAL +G+GI L TGPLGCF+IW+R+++FGDT++H+ALLGV  S+ F + +++ 
Sbjct: 1   MIDDFFIRALIAGVGIALVTGPLGCFVIWRRLSFFGDTLSHAALLGVTFSISFDINISLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+++++ +++L+++QKN  L+ DA+LG++ HS++++ LV+L F+ ++  D+   LFGDI
Sbjct: 61  VFIVSSIVAIILIRLQKNTNLAGDALLGLLAHSSLAIGLVVLGFLSFIRFDIMGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V  +D+L+IW  G + I+IL  IWKPL A+TVNYE+A+AEG+ PEK  ++F ++ + +
Sbjct: 121 LSVTLSDLLIIWIGGAVIILILSLIWKPLFASTVNYEIAEAEGLSPEKYNILFTILMAAI 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++SIK +G+ LIT ++I+P   AR  S SP+ M I++ I G+L ++IGLY SL  +TPS
Sbjct: 181 IAISIKMVGLLLITGMMIIPAAAARNLSNSPKQMVIISIIFGLLSVLIGLYASLEINTPS 240

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSII TSL  FILS F  K
Sbjct: 241 GPSIITTSLLFFILSLFRLK 260


>gi|254425098|ref|ZP_05038816.1| ABC 3 transport family [Synechococcus sp. PCC 7335]
 gi|196192587|gb|EDX87551.1| ABC 3 transport family [Synechococcus sp. PCC 7335]
          Length = 308

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/254 (24%), Positives = 120/254 (47%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F IRAL+    +      L C+I  +  +  GD ++H+ + GV ++    LP  +  F+ 
Sbjct: 30  FMIRALWVSSFVGTVCAVLSCYITLKGWSLMGDAVSHAVVPGVVVAYALGLPFALGAFVF 89

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               ++ +  ++    L  DA++GVI     +  LV+ + +   N DL   LFG++L ++
Sbjct: 90  GFGATVAIGYVKAKTRLKEDAVIGVIFTGFFAFGLVLATKIP-SNIDLFHILFGNVLGIS 148

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI+     GFL + I+    K LL    +   AKA G+  + +    + + +L I  +
Sbjct: 149 PQDIIQTLIAGFLTLAIILFRRKDLLLFCFDPNHAKAIGLNTQAMYYTLLSVLALTIVTA 208

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++  GI L+ ++L+ P  TA   S   + M +++    +L    G Y S   D  +G  I
Sbjct: 209 LQTAGIVLVVAMLVTPGATAYLLSDRFDRMLMISVATSVLSCFFGTYLSYHLDASTGGCI 268

Query: 245 IITSLFLFILSFFY 258
           ++     F+++  +
Sbjct: 269 VVLMTIFFVMAMLF 282


>gi|294629246|ref|ZP_06707806.1| ABC zinc/manganese transport system permease [Streptomyces sp. e14]
 gi|292832579|gb|EFF90928.1| ABC zinc/manganese transport system permease [Streptomyces sp. e14]
          Length = 300

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/253 (19%), Positives = 125/253 (49%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F  RAL + + + ++   +G +++ +R    GD I H A+ GV L  +          
Sbjct: 6   HAFMQRALLAAVLVGVTGPAIGIYLVQRRQPLMGDGIGHVAMTGVGLGFLLNTSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
            ++ L ++++  I+       D  L ++ +  ++  ++ ++      N +L+S+LFG + 
Sbjct: 66  AVSALGAVLMELIRWYGRTRGDIALAMLFYGGMAGGVMFVNLAPGGSNANLSSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V   D+  I  +    + +   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVAPEDVTAISVLAAFVVAVTLGLRRQLFAVSQDEEFARVTGLPVRTLNLLVAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ + S      +A  +G+   + G   S   D P G
Sbjct: 186 TVAMRVVGLILVSALMVVPVAAAQQLTRSFAATFAIAVALGLGSTVGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFIL 254
           P+I++ ++  F++
Sbjct: 246 PTIVLLTIAAFLV 258


>gi|308235018|ref|ZP_07665755.1| anchored repeat-type ABC transporter, permease subunit [Gardnerella
           vaginalis ATCC 14018]
 gi|311114194|ref|YP_003985415.1| ABC transporter membrane protein [Gardnerella vaginalis ATCC 14019]
 gi|310945688|gb|ADP38392.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Gardnerella vaginalis ATCC 14019]
          Length = 290

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 135/255 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F ++AL       +  G +GC+++ + +A+ GD +AHS   G+A++ + Q  L     + 
Sbjct: 18  FLLKALIVACLSSVICGVVGCYVVLRGMAFIGDAVAHSVFPGLAIAFVLQGNLLFGGALA 77

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
              T+L++    +N  L  D+ +GV   S  +L +V++S        L SFLFG I  + 
Sbjct: 78  GVATALIVSIFSQNRRLREDSFIGVFFVSAFALGIVVISKASGYAGSLESFLFGSITGIP 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI ++   G + + +L    K L+  +++ E ++A G+    +  +  ++ ++ + VS
Sbjct: 138 DSDIAVVAITGLIIVTLLMMFHKELVCVSMDRETSRAMGLPVAWLDGMLYVLVAIAVVVS 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LLI P  TAR  +     M ILA  IG    I+G+Y S   DT +G +I
Sbjct: 198 VQIIGNVLVLALLITPAATARLLTDRLGKMMILAPAIGCASSILGMYLSWSLDTATGGTI 257

Query: 245 IITSLFLFILSFFYK 259
           ++ + F+F+L++   
Sbjct: 258 VLVATFMFVLAWVCS 272


>gi|183598803|ref|ZP_02960296.1| hypothetical protein PROSTU_02235 [Providencia stuartii ATCC 25827]
 gi|188021011|gb|EDU59051.1| hypothetical protein PROSTU_02235 [Providencia stuartii ATCC 25827]
          Length = 288

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 117/257 (45%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +A+ + I        L CF++ +  +  GD I+H+ L G+ ++ +  +PL I  F+
Sbjct: 15  PFMQKAIITAIVTGAVCAILSCFLVLKGWSLMGDAISHAVLPGIVIASVAGIPLAIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +     +++N  +  D ++G++     ++ LV+ + +      LT  LFGDIL +
Sbjct: 75  SGLFCAFATGYLKENSRIKEDTVMGIVFSGMFAVGLVMFAKI-DTEQHLTHILFGDILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +         + I I+    K  +    +   A+  G+  + I    + + +L I  
Sbjct: 134 TDAEFKQNLWFAGITIAIILLKRKDFMLYCFDPNQARVIGLPVKLIHYGLLSLLALTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P + A     S   M  +A I  +   +IG   S   D  +GP 
Sbjct: 194 SLQAVGIILVIAMLISPGIIAFVLCRSFGWMLFVAVIASVTSSVIGTIVSFHIDGATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I+IT    FI++  Y K
Sbjct: 254 IVITQAIYFIIALLYSK 270


>gi|159899363|ref|YP_001545610.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892402|gb|ABX05482.1| ABC-3 protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 281

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 69/252 (27%), Positives = 138/252 (54%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF   + + + I    G LG +I+ + ++Y G  ++H+   G  +S +      +   + 
Sbjct: 12  FFRYGILAALLIGSLCGLLGVYIVLRGMSYIGHGLSHAIFGGAVVSFVLAWNFYLGAGLW 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               ++++ Q  +   +++DA +GVIT ++ ++ + ++S  +       + LFG+IL V 
Sbjct: 72  GFAAAVLINQTARRTKINADAAIGVITTASFAVGVALISRYRNFTRSFDAALFGNILGVT 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           + D+  I G+  +  +++F  +K LL  T N ++A+  G++   +  +F ++ +  + VS
Sbjct: 132 SDDLWAIGGVCIMVGLVVFFSYKQLLFMTFNNDVAQVYGVRTNWLDTLFSLMLAATLIVS 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+TLI + L++P +TAR  + S   M  L+T+IG L   IG+Y S  FD  SG +I
Sbjct: 192 MKILGVTLIAAALVIPPITARLLTDSFHRMLGLSTLIGGLTGCIGMYLSYFFDLASGATI 251

Query: 245 IITSLFLFILSF 256
           ++T    F+L+ 
Sbjct: 252 VLTQTSCFVLAL 263


>gi|72161261|ref|YP_288918.1| ABC zinc/manganese transport system permease [Thermobifida fusca
           YX]
 gi|71914993|gb|AAZ54895.1| ABC zinc/manganese transport system permease protein [Thermobifida
           fusca YX]
          Length = 297

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 132/253 (52%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F +RA  +   + ++   +G F++ +R+A  GD I H AL GV L  +      +   +
Sbjct: 8   DFMVRAFITSALVGMTAPVIGVFLVQRRLALLGDGIGHVALTGVGLGFLTHTSPVLTALV 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           ++ + ++++  ++ +   S D  L ++ +  I+  + +        + DLTSFLFG +  
Sbjct: 68  VSAVGAVLIELVRTHTRTSGDLALALLFYGGIAGGVFLTGLAPGATSADLTSFLFGSVST 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D++L+  +    + +L    + L     + ELA+  G+    +  +  ++ ++ + 
Sbjct: 128 VSPQDVVLVALLAVAVLAVLGYFGRELFVLCQDEELARVHGIPVRFLSTVLAVVAAVTVV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++++ +G+ L+++L+++P   A++ + S      LA ++G+L  + GL  +   DT  G 
Sbjct: 188 LAMRVVGVLLVSALMVVPVAAAQQLTRSFRATVRLAVLLGVLAALTGLSTAYYTDTAPGA 247

Query: 243 SIIITSLFLFILS 255
           +I++ ++ LF+ +
Sbjct: 248 AIVLVAIALFVTA 260


>gi|123968194|ref|YP_001009052.1| ABC transporter [Prochlorococcus marinus str. AS9601]
 gi|123198304|gb|ABM69945.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. AS9601]
          Length = 290

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 125/249 (50%), Gaps = 1/249 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + ++F  +ALF    +    G L  ++  +  A  GD ++HS + GV ++    LP ++ 
Sbjct: 17  LTHDFMRKALFMSSLVAAVCGFLSSYLTLKGWALMGDAVSHSVMPGVVVAYALGLPFSLG 76

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  I++   +  D ++G++     +L +V++S +K  N DL S LFG  
Sbjct: 77  AFIFGVGSVALIGFIKQKSRVKEDTVIGLVFTGFFALGIVLVSKIK-SNIDLHSILFGSP 135

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I  L +++L    K L+    +   AK  G+    +  + +   SL 
Sbjct: 136 LGISLSDVKQTIFISILVVILLSVFRKDLMLYCFDPRHAKTVGINVFFLHYLLLTCLSLA 195

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +   +NM +++ +  I+  +IG+Y S  FD  +
Sbjct: 196 AVVGLQSVGIILVVAMLITPGATAYLLTDKFDNMTVISVLSAIISSLIGIYVSFWFDLET 255

Query: 241 GPSIIITSL 249
           G SI++   
Sbjct: 256 GGSIVLAQT 264


>gi|21674913|ref|NP_662978.1| ABC 3 transport family protein [Chlorobium tepidum TLS]
 gi|21648140|gb|AAM73320.1| ABC 3 transport family protein [Chlorobium tepidum TLS]
          Length = 290

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 134/256 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A  + I   ++ G +G +++ +R+ +    IAH+A  G+ LS    L     I  
Sbjct: 26  EFMRNAFLAAILSSVACGIIGTYVVIRRLGFISGGIAHTAFGGIGLSYYLGLNPLTGIIP 85

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            +   ++ +  + +   ++ D  +G    + +S+ ++++        +L S+LFG+IL V
Sbjct: 86  FSLAAAIGIGLLSRKAKVAEDTAIGAFWAAGMSIGVILIGLTPGYAPNLFSYLFGNILTV 145

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ LI G+  L I +++   K  LA + + E A+  G++   + L+ + + +L + +
Sbjct: 146 PDSDLQLILGLDCLIIAVVWLFDKEFLAISFDEEYARISGLKTLALDLLMLCLIALTVVI 205

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +GI ++ +LL +P   AR FS +   + ++  ++  L  I GL+ S +F+  SG +
Sbjct: 206 MVRIVGIVMVIALLTIPAAVARSFSHNLYRIMVIGALLAALFSIAGLWLSWVFNLASGAT 265

Query: 244 IIITSLFLFILSFFYK 259
           II+ +  +F+++  + 
Sbjct: 266 IILVAALVFLVNALFG 281


>gi|117926459|ref|YP_867076.1| ABC transporter [Magnetococcus sp. MC-1]
 gi|117610215|gb|ABK45670.1| ABC-3 protein [Magnetococcus sp. MC-1]
          Length = 272

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 128/256 (50%), Positives = 190/256 (74%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+N+F + A  +G+G+ L +GPLGCF++W+R+AYFGDT+AH ALLGVAL LI  L LT+ 
Sbjct: 1   MWNDFMLLAWVAGVGVALVSGPLGCFVVWRRMAYFGDTMAHGALLGVALGLIMALNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           + ++    +L+LL +Q N  +S D +LG+++HS +SL LV LSFM  +  DL ++LFGDI
Sbjct: 61  VVLVCIAIALILLMLQSNSRVSGDTLLGILSHSALSLGLVGLSFMSGLRVDLMAYLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+  I+G G L +++L++IW PLLA T++  LA+AEG+   +I+LIF+++ +++
Sbjct: 121 LAVSWQDLGWIYGGGALVLLLLWRIWNPLLALTLHEGLARAEGVPVTQIRLIFMLLIAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+V++K +GI LITSLLI+P   AR  S SPE MA  A ++G+L +  GL+GSL +DTPS
Sbjct: 181 IAVAMKIVGILLITSLLIVPAAAARNLSRSPEQMAGWAVVVGVLAVSGGLWGSLNWDTPS 240

Query: 241 GPSIIITSLFLFILSF 256
           GPSI++  L LF+LS 
Sbjct: 241 GPSIVVVGLGLFLLSL 256


>gi|315640431|ref|ZP_07895541.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus italicus DSM 15952]
 gi|315483791|gb|EFU74277.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus italicus DSM 15952]
          Length = 284

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 142/257 (55%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+HS L GVA++ +  + + I   
Sbjct: 14  YDFLQSALITAIMVGIMSGIIGSFIILRGMSLMGDAISHSVLPGVAVAYMLGINILIGAS 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L ++++  +  +  +  D  +GV+     +L  +++S  +  +T+L   LFG+ILA
Sbjct: 74  IFGVLAAMLIGYVASHSKIKVDTAIGVVFSFFYALGFILISMAE-SSTNLHHILFGNILA 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++    +  + I+ +   +K LL T+ +   AK  G+  + I    +++ +L+  
Sbjct: 133 VSNSDMITTAIVLGIVIIFVQVFYKELLITSFDQTFAKTYGLNTQLIHYSLMLVLTLVTV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++     M + + I G++  I GLY S  F+  SGP
Sbjct: 193 SALQTVGIILVVAMLITPAATAYFWTDRLSVMLVFSAIFGVVASICGLYFSYTFNWASGP 252

Query: 243 SIIITSLFLFILSFFYK 259
           +I+I +  LF++SF + 
Sbjct: 253 AIVIVAAGLFLISFIFS 269


>gi|254425894|ref|ZP_05039611.1| ABC 3 transport family [Synechococcus sp. PCC 7335]
 gi|196188317|gb|EDX83282.1| ABC 3 transport family [Synechococcus sp. PCC 7335]
          Length = 290

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 127/257 (49%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  +AL +G+ + +    +G ++I QR+A  GD +AH+ L G+A++     PL I  F
Sbjct: 20  YEFMRQALTAGVLMGILCPIIGTYLIVQRMALLGDVVAHAVLPGLAIANFLNFPLLIGAF 79

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     + V   I+    +  DA + +   S  SL + +L+ ++    DL   LFGDIL+
Sbjct: 80  ISGMFGTFVTSWIRAQSKVKVDAAMAITFSSFFSLGIALLTSLR-SRLDLEELLFGDILS 138

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+  I  +    ++ +   +K LL  T +   A+A G+    I    +   +L I 
Sbjct: 139 IAPADVWEISFVTLAVLVGVKVFYKELLFFTFDQLGAEAIGLPVAAINAGLMAAITLTIV 198

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            SIK +G+ L+ +L++ P  TA   +     M  +   +G+   + G+Y S   +TPSGP
Sbjct: 199 ASIKAVGVILVVALMVNPAATAYLLTKELHWMMAVGAGLGVFSCLTGMYISYYLNTPSGP 258

Query: 243 SIIITSLFLFILSFFYK 259
           +I +T    F+ +  + 
Sbjct: 259 AIALTLFVCFLSALLFS 275


>gi|290960575|ref|YP_003491757.1| binding-protein-dependenet metal ABC transporter transmembrane
           protein [Streptomyces scabiei 87.22]
 gi|260650101|emb|CBG73217.1| putative binding-protein-dependenet metal transporter transmembrane
           subunit [Streptomyces scabiei 87.22]
          Length = 318

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 127/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGVTAPAIGVYLVQRRQALMGDGIGHVAMTGVGLGFMLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +++ + ++++  I+       D  L ++ +  ++  +++++      N +L SFLFG + 
Sbjct: 66  LVSVVGAVLMELIRWYGKTRGDIALAMLFYGGMAGGVMLINLAPGGTNANLMSFLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  DI  I  +    I++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSQEDITAICVLAAFVIVMTLALRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ + S      +A  IG+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLTRSFAATFAVAVAIGVTVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++  F+L
Sbjct: 246 ATIVLLAIAAFML 258


>gi|295839016|ref|ZP_06825949.1| zinc ABC transporter, permease [Streptomyces sp. SPB74]
 gi|295827288|gb|EFG65332.1| zinc ABC transporter, permease [Streptomyces sp. SPB74]
          Length = 316

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/250 (21%), Positives = 125/250 (50%), Gaps = 1/250 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
              RAL + + + ++   +G +++ +R A  GD I H AL GV L  +           +
Sbjct: 8   IMQRALLAAVLVGITAPAIGIYLVQRRQALMGDGIGHVALTGVGLGFLLSASPLWTAAAV 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILAV 123
           +   ++V+  I+       D  L ++ +  ++  +V+ +      N +LTS+LFG +  V
Sbjct: 68  SVGGAIVMELIRWYGRTRGDVALAMLFYGGMAGGVVLTNLAPAGSNANLTSYLFGSLSTV 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D++ +  +    +++   + + L A + + E A+  G+    + L+  +  +  ++V
Sbjct: 128 SPSDVVAVCVLAAFVVLVTVGLRRQLFAVSQDEEYARVTGLPVRLLNLLVAVTAAATVTV 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+++L+++P   A++ + S       A  IG+L  + G   S   D P G +
Sbjct: 188 AMRIVGLLLVSALMVIPVAAAQQLTRSFALTFAGAVAIGVLTTLGGTTLSYYQDLPPGGT 247

Query: 244 IIITSLFLFI 253
           I++ ++ +F+
Sbjct: 248 IVLLAIAVFV 257


>gi|146280438|ref|YP_001170591.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri A1501]
 gi|145568643|gb|ABP77749.1| zinc ABC transporter, permease protein [Pseudomonas stutzeri A1501]
          Length = 261

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 115/259 (44%), Positives = 184/259 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+AL GVAL L+  + LT+ +
Sbjct: 1   MPDFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALFGVALGLMLDVNLTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +L+L+ +Q+ + L+SD +LG++ HST+SL LV LSFM  V  DL  +LFGD+L
Sbjct: 61  TVGCVLLALLLVTLQQRQPLASDTLLGILAHSTLSLGLVSLSFMDDVRIDLMGYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  +D+  I G   L +++L  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I
Sbjct: 121 AVGPSDLAWIIGGSALVLLMLIPLWRPLLAITVHEELAKVEGLPVAGIRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + +PE MA+ A+++GI+ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARTPEQMALGASVLGIVAVCLGLTLSWYEDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF + K
Sbjct: 241 PSIVVSAAALFLLSFAWPK 259


>gi|238899152|ref|YP_002924834.1| chelated iron ABC transporter, permease protein [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466912|gb|ACQ68686.1| chelated iron ABC transporter, permease protein [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 276

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 62/259 (23%), Positives = 121/259 (46%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F  RAL   +   +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL+I  
Sbjct: 13  IYPFMQRALMIAVVTGMVCAVLSCYLVLKGWSLMGDAISHAVLPGIVLAFLSGIPLSIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F      +     I++N  +  D ++G++     +L LV+ S +   +  L+  LFG IL
Sbjct: 73  FASGIFCAFATGYIKENSRVKQDTVMGIVFSGMFALGLVLFSTV-DTDQHLSHILFGHIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ ++      I  +   ++    K  +    +   AK  G+    +    + + SL I
Sbjct: 132 GVSISEFHQTLWISGVTFFVMLLKRKDFMLYCFDNNHAKVIGLPVTLLHYGLLCLLSLTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S + +G+ L+ ++LI P +TA         M I+A+++ ++  + G+  S   D  +G
Sbjct: 192 VASFQAVGVILVIAMLIAPGMTALMLCQQFHQMLIIASLVSVISCVSGILLSFHIDGATG 251

Query: 242 PSIIITSLFLFILSFFYKK 260
           P I+I    +F+ S  YK+
Sbjct: 252 PCIVIVQAVIFMTSLIYKQ 270


>gi|254361650|ref|ZP_04977788.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mannheimia haemolytica PHL213]
 gi|153093168|gb|EDN74184.1| zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mannheimia haemolytica PHL213]
          Length = 261

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  +L   + +  
Sbjct: 3   DILFPAWLAGVLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLELDPYLAVIG 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ +++    S D +LG+I H+++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTILLALLLVWLEQKTNYSVDTVLGIIAHTSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N +D++ I     L  +IL   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 123 NFSDVVFIGIGATLICLILMLFWKRLLSITISPELAQIEGLNVARLRLLLMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE M ++A    I+ +  GL  S   DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPEKMVLIAIFFSIIAVSGGLLLSSWKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I +  +F+LS F K
Sbjct: 243 VVICAGLIFLLSLFKK 258


>gi|294056276|ref|YP_003549934.1| ABC-3 protein [Coraliomargarita akajimensis DSM 45221]
 gi|293615609|gb|ADE55764.1| ABC-3 protein [Coraliomargarita akajimensis DSM 45221]
          Length = 450

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 119/264 (45%), Gaps = 15/264 (5%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP----------LTIC 60
              + +  + G +G F++ ++ +  GDT++H+ L GV ++ I  +           L + 
Sbjct: 22  LCTLLLGCACGLMGGFLLLRKRSLMGDTLSHATLPGVGIAFILAVHFGGDGKSLPLLLVG 81

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFL 116
             +   L  + +L I+    +  DA +G++      L +VIL F++         L SF+
Sbjct: 82  ATVSGVLGVMTVLFIRNRSRIKDDAAMGIVLSVFFGLGVVILGFIQTMPQGSAAGLESFI 141

Query: 117 FGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMI 176
           +G   ++  +D  L+  +    +++   ++K       +   A A+G   + + ++ + +
Sbjct: 142 YGKTASMVRSDFDLLVLVTAGVLVLSVLLFKEFKLLCFDESFAAAQGWPVKWLDILLLAL 201

Query: 177 TSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF 236
            + +    ++ +G+ LI + LI P   AR ++   + M  L+ +IG L    G   S + 
Sbjct: 202 VTAVTVAGLQAVGLILIIAFLITPAAAARFWTEKLDRMLCLSALIGGLSGWFGASLSALA 261

Query: 237 D-TPSGPSIIITSLFLFILSFFYK 259
              P+G  I++ +   F+ S  + 
Sbjct: 262 PRLPAGAVIVLVAAGAFLFSLLFG 285


>gi|298490207|ref|YP_003720384.1| ABC-3 protein ['Nostoc azollae' 0708]
 gi|298232125|gb|ADI63261.1| ABC-3 protein ['Nostoc azollae' 0708]
          Length = 280

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 140/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + L    +G +++ QR+A  GD I+HS L G+A++ +    +   
Sbjct: 9   LQYGFMQRSLIIAILVGLLCAVVGSYLMVQRLALLGDAISHSVLPGLAIAFMIGANIFAG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+   L+++ +  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFIAGILSTMAIAFIKTRSPIKEDAAMGIVFSAFFALGVTLITVIQKSNKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL+V   ++     I  + ++++  ++K LL  T +   A+A G+   ++    +++ +L
Sbjct: 129 ILSVTVDEVRDTSIIATIVLIVVVALYKELLFYTFDPLGAQAAGLPVNRLNFGLMLLIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ SLLI P  TA         + IL  +IG++  I G+Y S  ++ P
Sbjct: 189 TIVASMKAVGVILVLSLLITPGATAYLLVKRLHEVMILGAVIGVISSISGMYLSYFYNLP 248

Query: 240 SGPSIIITSLFLFILSFFY 258
           SGP+I++    LFIL+  +
Sbjct: 249 SGPAIVLVVSGLFILALLF 267


>gi|319775773|ref|YP_004138261.1| putative ABC-type chelated iron transport system, permease
           [Haemophilus influenzae F3047]
 gi|319896689|ref|YP_004134882.1| abc-type chelated iron transport system, permease component
           [Haemophilus influenzae F3031]
 gi|317432191|emb|CBY80543.1| putative ABC-type chelated iron transport system,permease component
           [Haemophilus influenzae F3031]
 gi|317450364|emb|CBY86580.1| putative ABC-type chelated iron transport system, permease
           component [Haemophilus influenzae F3047]
          Length = 271

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ LLG+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLLGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LVI + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVIFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A I  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIISSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|222086277|ref|YP_002544809.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
 gi|221723725|gb|ACM26881.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84]
          Length = 275

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 141/257 (54%), Positives = 212/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTI+HSALLGVALSL+FQL LT+ 
Sbjct: 1   MFDDFFLRAVVAGVGLALTTGPLGCFIIWRRMAYFGDTISHSALLGVALSLLFQLNLTLS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +Q+ +ALS+DA+LG+++H+T+++ LVI++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSILLLFLQRRQALSADALLGILSHATLAIGLVIVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +IWG G   +  +  +W+PLLA+TVN ELA+AEG++PE+ KL F+++ +++
Sbjct: 121 LAVSRADIAMIWGGGLFVLAAIAWLWRPLLASTVNPELAEAEGLRPERAKLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LIT+LLI+P  TARRF+ +PE MA+ A+++G + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGILLITALLIIPAATARRFAATPEMMAVFASLVGAVAVVGGLFGSLRYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFI S  
Sbjct: 241 GPSIVVAALILFIFSLL 257


>gi|296330068|ref|ZP_06872551.1| manganese ABC transporter (permease) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675659|ref|YP_003867331.1| manganese ABC transporter permease [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152793|gb|EFG93659.1| manganese ABC transporter (permease) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413903|gb|ADM39022.1| manganese ABC transporter (permease) [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 438

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/261 (21%), Positives = 124/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIAT 66
              L   + +  ++G LG F++ ++ +  GD +AHSAL GV L+ +F    ++  F++  
Sbjct: 18  QWVLAGTLLLGAASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFLFTGQKSLPFFLLGA 77

Query: 67  LT-----SLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLF 117
                  +  +  I +      D+ +G++      + +++L++++       + L SFLF
Sbjct: 78  ALAGLLGTWCIQLISRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQQGAGSQSGLDSFLF 137

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++   DI+LI GI    +++    +K     T ++  AK  G+    +  +   + 
Sbjct: 138 GQAASLVRQDIILIAGISAALLLLCIVFFKEFTLITFDFAFAKGLGLPVRFLNGLLACLI 197

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF- 236
              + + ++ +G+ L+ ++LI P + AR ++     M ++A + G +  + G   S    
Sbjct: 198 VCAVVIGLQTVGVILMAAMLITPAIAARYWTERLTGMMVIAGVTGGVSGVSGTLLSTTMK 257

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP +I+++  +F+ S  
Sbjct: 258 GMATGPLMILSATLIFLFSMI 278


>gi|226366464|ref|YP_002784247.1| manganese ABC transporter permease protein [Rhodococcus opacus B4]
 gi|226244954|dbj|BAH55302.1| manganese ABC transporter permease protein [Rhodococcus opacus B4]
          Length = 295

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F +RAL + +   +    L C+++    +  GD ++H+ L GV L+ I   P  I   
Sbjct: 13  YDFMVRALITTLIAAVVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFAIGAV 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L   ++  ++    +  DA +G++  +  +L LV++S      TDL   +FG++L 
Sbjct: 73  IFGFLAVALIGLVRDTSRVKEDAAIGIVFSTLFALGLVLVSVTP-SQTDLNHIIFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++ I  +G    + L    +       +   A A G+ P  +    + + +L   
Sbjct: 132 VSRSDLVQIAILGAFVFVALIVKRRDFTLYAFDPTHAHAIGLNPRMLGAALLGLLALTAV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   + S   M ++A  I     +IGLY S   DT SG 
Sbjct: 192 VALQAVGVILVVAMLIIPGATAYLLTDSFHRMLVIAPAISASCAVIGLYLSYHLDTASGG 251

Query: 243 SIIITSLFLFILSFFY 258
            ++++   +F L + +
Sbjct: 252 MVVLSQGAVFALVYLF 267


>gi|311696414|gb|ADP99287.1| zinc ABC transporter, permease protein [marine bacterium HP15]
          Length = 270

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 110/255 (43%), Positives = 181/255 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++FF RAL  G+G+ L  GPLGCF++W+R+AYFGDT+AHSALLG+ALS +  +PL + +
Sbjct: 8   LDDFFWRALIGGLGVALVAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLISVPLNLGV 67

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   + ++ L+ + +   L++D +LG++ HS +++ LV LSFM  V  DLT  LFGD+L
Sbjct: 68  IITCVVLAMALVLLSRTRTLATDTLLGILAHSALAIGLVTLSFMPDVRVDLTGLLFGDLL 127

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+L I+G   L I++L  +W+ LL +T++ ELA+ EG+  E+++L+ +++ SL+I
Sbjct: 128 AMSREDLLWIYGGAALIIILLAVLWQGLLMSTIHEELARVEGVAVERLRLVLMLMFSLVI 187

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LIT+LLI+P  TARR + +PE MA +A   G + +  GL  S   DTP+G
Sbjct: 188 AVAMKIVGVLLITALLIIPAATARRLAHNPEIMAAMAVGFGFVAVSGGLSLSWHLDTPAG 247

Query: 242 PSIIITSLFLFILSF 256
           PS+++T+  +F+L +
Sbjct: 248 PSVVVTAFAVFLLVY 262


>gi|312951188|ref|ZP_07770091.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|310630853|gb|EFQ14136.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|315152674|gb|EFT96690.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0031]
          Length = 289

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + L +G +G FII + ++  GD I+H+ L GVA+S +F         
Sbjct: 12  YQFLQNALLTSIIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYMFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|332288367|ref|YP_004419219.1| ABC zinc/manganese transporter protein, membrane component
           [Gallibacterium anatis UMN179]
 gi|330431263|gb|AEC16322.1| ABC zinc/manganese transporter protein, membrane component
           [Gallibacterium anatis UMN179]
          Length = 279

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 67/258 (25%), Positives = 128/258 (49%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   +L + + I      L C+++ +  A  GD I+H+ L G+ L+ IF LPLT+  F
Sbjct: 11  YPFMQVSLITALMIATICAVLSCYLVLKGWALMGDAISHAILPGIVLAFIFNLPLTLGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +  +  ++ +  L  D I+G++     +  LV+   ++  N  LT  LFGDIL 
Sbjct: 71  LAGIGCASSIGFLKNHARLKEDTIMGIVFSGMFAFGLVLFGQVQ-TNQHLTHILFGDILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++   +  +  +G   +++++  W+ LL    +   AK  G+    +    + + SL I 
Sbjct: 130 IDRQQMWQMLAVGAAILVLIYSKWRDLLLYCFDPVQAKVMGLNATFLHYGLLSLLSLSIV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++++ +G+ L+ ++LI P +TA   S     M ++A    +L  I G+  S   D+ +G 
Sbjct: 190 LAMQIVGVILVVAMLISPGITAYLLSKRFSTMLLIAIGSALLSNIGGIIISYHLDSATGA 249

Query: 243 SIIITSLFLFILSFFYKK 260
           +I++T   LFI +    K
Sbjct: 250 TIVLTQAVLFIFAVMINK 267


>gi|302545519|ref|ZP_07297861.1| zinc ABC transporter, permease [Streptomyces hygroscopicus ATCC
           53653]
 gi|302463137|gb|EFL26230.1| zinc ABC transporter, permease [Streptomyces himastatinicus ATCC
           53653]
          Length = 295

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 130/253 (51%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H AL GVAL  +          
Sbjct: 7   YAFMQRALLAAVLVGITAPAVGIYLVQRRQAIMGDGIGHVALTGVALGFLTGTNPVWTAV 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  +++++      N +LT++LFG I 
Sbjct: 67  LVSALGAVLMELIRWYGKTRGDLALAMLFYGGMAGGVLLINLSPTGSNANLTTYLFGSIT 126

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  D+++I  +    ++I   + + L A   + E A+  G+    + L+  +  ++ +
Sbjct: 127 TVSEQDVVVISLLAAFVVLITLGLRRQLFAVCQDEEFARVTGLPVRTLNLLLAITAAVTV 186

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ +        LA  IG++  + G   S   + P G
Sbjct: 187 TVAMRVVGLLLVSALMVVPVAAAQQATRGFAMTLALAVGIGVVVTLSGTVFSFYKNVPPG 246

Query: 242 PSIIITSLFLFIL 254
            SI++ ++ +F +
Sbjct: 247 ASIVVLAIGVFAV 259


>gi|257082165|ref|ZP_05576526.1| ABC transporter, permease [Enterococcus faecalis E1Sol]
 gi|256990195|gb|EEU77497.1| ABC transporter, permease [Enterococcus faecalis E1Sol]
          Length = 289

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + + + L +G +G FII + ++  GD I+H+ L GVA+S IF         
Sbjct: 12  YQFLQNALLTSVIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYIFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|114567404|ref|YP_754558.1| ABC transporter [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338339|gb|ABI69187.1| ABC 3 transport family protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 266

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 136/257 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL +GI   ++ G +G +++ +RI +    I+H+A  G+ L     +   +    
Sbjct: 7   DFLRHALATGILASIACGVVGSYVVIKRIVFISGGISHTAYGGIGLGYFLGINPILGAVF 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +++L +  + +      D ++G+I    ++L ++ +       +DL S+LFG+ILAV
Sbjct: 67  FTVISALGMGILVERTRQREDTLIGIIWAVGMALGVIFVKLSPGYTSDLMSYLFGNILAV 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++LI  +  + + ++   ++ L A   + E A+  G+      L+ +++ +L + V
Sbjct: 127 PFQDLILISILDVIIVAVVCFYFEELKAVAFDEEFAQVAGISTRFFNLLLLLLIALTVVV 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            I+ +GI L+ +L+ +P   A + S S   M +LA I+GI+    G++ S +FD PSG +
Sbjct: 187 MIRAVGIILVIALMSIPPAIAGQSSKSLRGMMVLAIILGIVFNSGGIFLSYVFDLPSGAT 246

Query: 244 IIITSLFLFILSFFYKK 260
           II+ +   FI+S   K+
Sbjct: 247 IILLAAAGFIISIASKQ 263


>gi|322835623|ref|YP_004215649.1| ABC transporter [Rahnella sp. Y9602]
 gi|321170824|gb|ADW76522.1| ABC-3 protein [Rahnella sp. Y9602]
          Length = 284

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 120/253 (47%), Gaps = 1/253 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL +     +      CF++ +  +  GD I+H+ L GV L+ +  +PL I  F 
Sbjct: 15  DFMQRALLTAAATSIVCAMFSCFLVLKGWSLMGDAISHAVLPGVVLAYLAGIPLVIGAFG 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    I+++  +  D+++G++     +  LV+ S +      L+  LFG++L V
Sbjct: 75  SGLFCAVATGFIKEHCRVKEDSVMGIVFSGMFAGGLVLFSRVN-TEQHLSHILFGNVLGV 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +++L    I  +  + +   +K L+    +   AK  G+         + + +L I  
Sbjct: 134 TDSEMLQTLIIAAVVTLAIILKFKDLMLFCFDPVQAKVIGLPVRFYHYALLCMLALTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA     +   M +++    +   I G + S   D  +GP+
Sbjct: 194 ALQAVGVVLVVAMLITPGITAFLLCKTLTKMLVVSVTTSLFAAISGTFISFYIDAATGPT 253

Query: 244 IIITSLFLFILSF 256
           I++    +F+L+ 
Sbjct: 254 IVLVQAAIFLLAL 266


>gi|330445474|ref|ZP_08309126.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489665|dbj|GAA03623.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 261

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 108/256 (42%), Positives = 189/256 (73%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALIAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFNINLNLALVI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL ++LFGD+LAV
Sbjct: 63  CCLVLAVILVTLQKQRYVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            TTDIL I+  G + + +L  +W+PLL+ T++ E+A+ EG+  + ++LI +++  ++I+V
Sbjct: 123 TTTDILWIYCGGAIVLGLLIFLWRPLLSMTISEEMAQVEGVNVDLMRLILMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE+MA+LA+++G + + +GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPESMAVLASVLGAIAVCLGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  +F+LS   +
Sbjct: 243 VVVSAAAMFMLSQLKR 258


>gi|330448498|ref|ZP_08312146.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492689|dbj|GAA06643.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 287

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/254 (26%), Positives = 130/254 (51%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +A +  I + + T  L CF++ +  +  GD I+H+ L G+ L+ +F +P  I  F+ 
Sbjct: 16  FMQQAFYIVILVAIPTALLSCFLVLKGWSLMGDAISHAVLPGIVLAYVFSIPFIIGAFIA 75

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               +L    +++N  +  D I+GV+  +  +L +V+++ +   N  L   ++GD L  +
Sbjct: 76  GMFCALATGYLKENSRIKEDTIMGVVFSAMFALGIVLITKI-HSNIHLDHIIYGDPLGAS 134

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             +I+    I  L + +     K LL    + + A+A G+  + +    + + SL I  +
Sbjct: 135 WQEIIEAGVIALLVVTLCLLKGKDLLLFIFDPQHAQAIGLPTKVLHYGLLSLLSLAIVTA 194

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+ L+ S+LI P  TA   +   ++M I++ +I +   ++GLY S   D+  GP+I
Sbjct: 195 LKAVGMILVISMLIAPGATAFMLTRQFQSMLIISLLIAVFNSVLGLYLSFFIDSAPGPTI 254

Query: 245 IITSLFLFILSFFY 258
           I+     FI  F Y
Sbjct: 255 ILLLTANFIGVFIY 268


>gi|302868512|ref|YP_003837149.1| ABC-3 protein [Micromonospora aurantiaca ATCC 27029]
 gi|302571371|gb|ADL47573.1| ABC-3 protein [Micromonospora aurantiaca ATCC 27029]
          Length = 312

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 67/255 (26%), Positives = 135/255 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +GC+++ + +A+ GD +AH+   G+AL+ + Q  L +   +
Sbjct: 16  AFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIALAFVLQGSLVLGGAV 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L++    +N  +  D+I+GV      +L +VI+S        L  FLFG I  +
Sbjct: 76  AGVATALLIAIFAQNRRVKEDSIIGVFLVGAFALGIVIISQAPGYAGSLQQFLFGSITGI 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G G + + ++  + K  +A  ++ E+++A G+    + ++  ++ +L + +
Sbjct: 136 PDRDLYVVGGAGLVILGLVLALHKEFVAVCLDREMSRAMGLPVFLLDIVLYVLVTLAVVI 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LLI P   AR  +     M +LA +IG     +GLY S  +DTP G +
Sbjct: 196 SLQTIGTILVLALLITPAAAARLLTDRLGVMMLLAPMIGGTSATVGLYLSWSYDTPVGGT 255

Query: 244 IIITSLFLFILSFFY 258
           I++ +  +F+ ++  
Sbjct: 256 IVLVATTVFLAAWLI 270


>gi|269127436|ref|YP_003300806.1| ABC-3 protein [Thermomonospora curvata DSM 43183]
 gi|268312394|gb|ACY98768.1| ABC-3 protein [Thermomonospora curvata DSM 43183]
          Length = 289

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 130/259 (50%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  +F   AL   + I L+   +G FI+ +R+A  GD I H AL G+ L L+      + 
Sbjct: 5   LQYDFMRIALALAVLIGLTAPAIGTFIVQRRLALLGDGIGHIALTGIGLGLLTGSSPVLG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              I+ L +  +  ++       D  L ++ +  ++  +++ S        L S+LFG I
Sbjct: 65  ALAISVLGAAAIEVLRARSRTGGDVALALLFYGGLAGGVLLTSRAGGGAG-LQSYLFGSI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
            +V   D+ L+  +    + ++    + L     + ELA+A G+    + L+  +  ++ 
Sbjct: 124 TSVTERDLYLVAVLAAGVLAVVVLFGRELFLLCQDEELARASGLPARALSLLIAVTAAVT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + ++++ IG+ L+++L+++P   A++ +    +  + A  IG+L  + GL G+  +D P 
Sbjct: 184 VVIAMRAIGLLLVSALMVVPVAAAQQLTRGFRDTMLAAMGIGVLSAVSGLLGAFQYDLPP 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           GPSI++ +L +++    ++
Sbjct: 244 GPSIVLLALAVYLTLVLWR 262


>gi|330806694|ref|YP_004351156.1| Zinc ABC transporter permease [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374802|gb|AEA66152.1| Zinc ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 262

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 180/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +   + +
Sbjct: 1   MADFLLYALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPAVAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L ++VL+ +Q  + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVVLVTLQHRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G     +++L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +++I
Sbjct: 121 AISPTDLSWILGGSAAVLLLLVALWRPLLAVTVHEELARVEGLPVLGLRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G+L +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGMLAVCGGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|261344028|ref|ZP_05971673.1| metal ion ABC transporter, permease protein [Providencia
           rustigianii DSM 4541]
 gi|282568421|gb|EFB73956.1| metal ion ABC transporter, permease protein [Providencia
           rustigianii DSM 4541]
          Length = 288

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 119/257 (46%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL + I        L CF++ +  +  GD I+H+ L G+ ++ +  +PL I  F 
Sbjct: 15  PFMQKALLTAIVTGTVCAILSCFLVLKGWSLMGDAISHAVLPGIIIASLIGIPLAIGAFA 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +++N  +  D ++G++     ++ LV+ + +      LT  LFGDIL +
Sbjct: 75  SGLFCAVATGYLKENSRIKEDTVMGIVFSGMFAIGLVMFAKI-DTEQHLTHILFGDILGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +   I     + + ++    K  +    +   A+  G+  + +    + + +L I  
Sbjct: 134 TNEEFKQILVFAGITVAVILLKRKDFMLYCFDPNQARVIGLPVKLLHYGLLSLLALTIVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +GI L+ ++LI P + A     S   M ++A I  +   +IG   S   +  +GP+
Sbjct: 194 SLQAVGIILVIAMLISPGIIAFVLCRSFGWMLVVAIIASVTSSVIGTVLSFHINATTGPT 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+++  Y K
Sbjct: 254 IVVIQAGYFVIALLYSK 270


>gi|15613953|ref|NP_242256.1| hypothetical protein BH1390 [Bacillus halodurans C-125]
 gi|20455070|sp|Q9KD29|MNTC_BACHD RecName: Full=Manganese transport system membrane protein mntC
 gi|10174006|dbj|BAB05109.1| BH1390 [Bacillus halodurans C-125]
          Length = 292

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 77/257 (29%), Positives = 148/257 (57%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             +  +AL + I + +  G +GCFII + +A  GD I+H+ L GV ++ +      I   
Sbjct: 14  YSYLQQALTAAILVGIICGVIGCFIILRGMALMGDAISHAVLPGVVIAYMIGASFFIGAV 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   +T+L +  + +N  +  D+ +G++  +  +L +V+++ M+    DL   LFG++LA
Sbjct: 74  ITGVITALAIGYVSQNSRVKEDSAIGILFTAAFALGIVLITGMRGTGVDLWHILFGNVLA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ TD+ +  GIG   ++I+   ++PLL +T +  +A+A G+  + I  + +++ SL+  
Sbjct: 134 VSRTDLWVTLGIGLFVLLIIILFYRPLLLSTFDPVMAQATGIPVQMIHYLLMLLLSLVTV 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA   +     M  LA + G++  I G+Y S+I+D  SG 
Sbjct: 194 AALQTVGIVLVVAMLITPGATAYLLTNRLPVMLCLAAMFGVISAIAGIYFSVIYDVASGA 253

Query: 243 SIIITSLFLFILSFFYK 259
           SI++ +  LF L+FF+ 
Sbjct: 254 SIVLVASTLFALAFFFS 270


>gi|307329108|ref|ZP_07608275.1| ABC-3 protein [Streptomyces violaceusniger Tu 4113]
 gi|306885303|gb|EFN16322.1| ABC-3 protein [Streptomyces violaceusniger Tu 4113]
          Length = 290

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 127/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H AL GVAL  +          
Sbjct: 7   YAFMQRALLAAVLVGITAPAVGIYLVQRRQAIMGDGIGHVALTGVALGFLTGANPVWTAV 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
            ++ L ++ +  I+       D  L ++ +  ++  +++++      N +LT++LFG I 
Sbjct: 67  AVSALGAIAMELIRWYGKTRGDLALAMLFYGGMAGGVLLINLSPTGSNANLTTYLFGSIT 126

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  D++ I  +    ++I   + + L A   + E A+  G+    + L+  +  ++ +
Sbjct: 127 TVSPEDVVAISLLAAFVVVITLGLRRQLFAVCQDEEFARVTGLPVRTLNLLLAITAAVTV 186

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ +        LA  IG++  + G   S   + P G
Sbjct: 187 TVAMRVVGLLLVSALMVVPVAAAQQATRGFAMTLALAITIGVVVTLSGTVFSFYKNVPPG 246

Query: 242 PSIIITSLFLFIL 254
            SI++ ++ +F +
Sbjct: 247 ASIVVLAIGVFAV 259


>gi|256853589|ref|ZP_05558954.1| ABC transporter [Enterococcus faecalis T8]
 gi|256961493|ref|ZP_05565664.1| ABC-3 [Enterococcus faecalis Merz96]
 gi|256963418|ref|ZP_05567589.1| ABC-3 [Enterococcus faecalis HIP11704]
 gi|257090351|ref|ZP_05584712.1| ABC transporter permease [Enterococcus faecalis CH188]
 gi|293385183|ref|ZP_06631003.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|293388185|ref|ZP_06632707.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|307272731|ref|ZP_07553978.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|307277741|ref|ZP_07558827.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|307287830|ref|ZP_07567866.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0109]
 gi|307295650|ref|ZP_07575485.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
 gi|312900836|ref|ZP_07760130.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
 gi|312902852|ref|ZP_07762056.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0635]
 gi|312908269|ref|ZP_07767233.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|312910659|ref|ZP_07769500.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|256710532|gb|EEU25575.1| ABC transporter [Enterococcus faecalis T8]
 gi|256951989|gb|EEU68621.1| ABC-3 [Enterococcus faecalis Merz96]
 gi|256953914|gb|EEU70546.1| ABC-3 [Enterococcus faecalis HIP11704]
 gi|256999163|gb|EEU85683.1| ABC transporter permease [Enterococcus faecalis CH188]
 gi|291077556|gb|EFE14920.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|291082425|gb|EFE19388.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|306496362|gb|EFM65939.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
 gi|306501164|gb|EFM70470.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0109]
 gi|306505620|gb|EFM74804.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|306510345|gb|EFM79368.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|310625683|gb|EFQ08966.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|310633906|gb|EFQ17189.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0635]
 gi|311289035|gb|EFQ67591.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|311291935|gb|EFQ70491.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
 gi|315028595|gb|EFT40527.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4000]
 gi|315031103|gb|EFT43035.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0017]
 gi|315143345|gb|EFT87361.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2141]
 gi|315146242|gb|EFT90258.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4244]
 gi|315161326|gb|EFU05343.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0645]
 gi|315164722|gb|EFU08739.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1302]
 gi|315173197|gb|EFU17214.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1346]
 gi|315576627|gb|EFU88818.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0630]
 gi|323481208|gb|ADX80647.1| manganese/zinc transport system ATP-binding protein [Enterococcus
           faecalis 62]
 gi|327535531|gb|AEA94365.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis OG1RF]
          Length = 289

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + + + L +G +G FII + ++  GD I+H+ L GVA+S +F         
Sbjct: 12  YQFLQNALLTSVIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYMFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|157413020|ref|YP_001483886.1| ABC transporter [Prochlorococcus marinus str. MIT 9215]
 gi|157387595|gb|ABV50300.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9215]
          Length = 291

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 62/249 (24%), Positives = 122/249 (48%), Gaps = 1/249 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + + F  +AL     +    G L  ++  +  A  GD ++HS + GV ++    LP ++ 
Sbjct: 17  LTHNFMRKALLMSSLVAAVCGFLSSYLTLKGWALMGDAVSHSVMPGVVVAYALGLPFSLG 76

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  I++   +  D ++G++     +L +V++S +K  N DL S LFG  
Sbjct: 77  AFIFGVGSVALIGFIKQKSRVKEDTVIGLVFTGFFALGIVLVSKIK-SNIDLHSILFGSP 135

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I  L +++L    K L+    +   AK  G+    +  + +   SL 
Sbjct: 136 LGISLSDVKQTIFISLLVVILLSIFRKDLMLYCFDPRHAKTVGINVLFLHYLLLTCLSLA 195

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +    NM +++ +  I+  +IG+Y S  FD  +
Sbjct: 196 AVVGLQSVGIILVVAMLITPGATAYLLTDKFNNMTVISVLSAIISSLIGIYVSFWFDLET 255

Query: 241 GPSIIITSL 249
           G SI++   
Sbjct: 256 GGSIVLAQT 264


>gi|298206996|ref|YP_003715175.1| zinc ABC transporter, permease protein [Croceibacter atlanticus
           HTCC2559]
 gi|83849630|gb|EAP87498.1| zinc ABC transporter, permease protein [Croceibacter atlanticus
           HTCC2559]
          Length = 370

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 59/259 (22%), Positives = 119/259 (45%), Gaps = 10/259 (3%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-----PLTICIFMIA 65
                +    G LG F + ++ +  GD I+H+AL G+AL+ +         L +   +  
Sbjct: 17  LGTAILGAICGMLGSFAVLRKESLLGDAISHAALPGIALAFLITGAKDTYTLLLGALVSG 76

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLFGDIL 121
            L +  +  I     L SD  LG+I        +++L+F++         L  +LFG   
Sbjct: 77  LLGTWWIRGITSKTHLKSDTALGLILSLFFGFGMLLLTFIQKMPNANQAGLDKYLFGQAA 136

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +  +DI L+ GI  ++++IL   WK +     + +  K  G   + + ++      L I
Sbjct: 137 TLLESDIWLMAGITGVSLIILLLFWKEIKLLLFDADYTKTLGFNTKFLDVLITSFIVLAI 196

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL-IFDTPS 240
            V ++ +G+ L++++L+ P   AR+++     M +L+ I G+   + G   S    +  +
Sbjct: 197 VVGLQTVGVVLMSAMLLAPAAAARQWTNKLSVMVLLSAIFGLCSGVFGTAISASQNNLST 256

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP I++ +    ++SF + 
Sbjct: 257 GPVIVLVAGVFVLISFIFS 275


>gi|328882345|emb|CCA55584.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Streptomyces venezuelae ATCC 10712]
          Length = 297

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 128/251 (50%), Gaps = 1/251 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          +
Sbjct: 7   AFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLNSSPVWMATL 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           +A   S+ +  I+       D  L ++ +  ++  +++++      N +L+S+LFG +  
Sbjct: 67  VAVAGSVAMELIRAYGKTRGDLALALLFYGGMAGGVLLINLSPTGSNANLSSYLFGSLST 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+T DI  I  +    I++   + + L A + + E A+  G+    + L+  +  ++ ++
Sbjct: 127 VSTEDITAIGILAAFVILVTVGLRRQLFAVSQDEEFARVTGLPVRALNLLIAVTAAVTVT 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+++L+++P   A++ S S     +LA + GI   + G   S   D P G 
Sbjct: 187 VAMRVVGLLLVSALMVVPVAAAQQLSKSFRATFVLAVVTGITVTLAGTVTSYYQDVPPGA 246

Query: 243 SIIITSLFLFI 253
           +I++ ++ +F+
Sbjct: 247 TIVLYAIGVFV 257


>gi|29376584|ref|NP_815738.1| ABC transporter, permease protein [Enterococcus faecalis V583]
 gi|227520193|ref|ZP_03950242.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227555373|ref|ZP_03985420.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|229545342|ref|ZP_04434067.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|229549587|ref|ZP_04438312.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|256956527|ref|ZP_05560698.1| ABC transporter [Enterococcus faecalis DS5]
 gi|257079450|ref|ZP_05573811.1| ABC-3 [Enterococcus faecalis JH1]
 gi|257087275|ref|ZP_05581636.1| ABC-3 protein [Enterococcus faecalis D6]
 gi|257416454|ref|ZP_05593448.1| ABC transporter [Enterococcus faecalis AR01/DG]
 gi|257419696|ref|ZP_05596690.1| ABC-3 type transporter [Enterococcus faecalis T11]
 gi|257422145|ref|ZP_05599135.1| ABC transporter [Enterococcus faecalis X98]
 gi|294780352|ref|ZP_06745721.1| ABC 3 transport family protein [Enterococcus faecalis PC1.1]
 gi|300861046|ref|ZP_07107133.1| putative Manganese transport system membrane protein MntB
           [Enterococcus faecalis TUSoD Ef11]
 gi|307270237|ref|ZP_07551550.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|29344048|gb|AAO81808.1| ABC transporter, permease protein [Enterococcus faecalis V583]
 gi|227072365|gb|EEI10328.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227175487|gb|EEI56459.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|229305252|gb|EEN71248.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|229309549|gb|EEN75536.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|256947023|gb|EEU63655.1| ABC transporter [Enterococcus faecalis DS5]
 gi|256987480|gb|EEU74782.1| ABC-3 [Enterococcus faecalis JH1]
 gi|256995305|gb|EEU82607.1| ABC-3 protein [Enterococcus faecalis D6]
 gi|257158282|gb|EEU88242.1| ABC transporter [Enterococcus faecalis ARO1/DG]
 gi|257161524|gb|EEU91484.1| ABC-3 type transporter [Enterococcus faecalis T11]
 gi|257163969|gb|EEU93929.1| ABC transporter [Enterococcus faecalis X98]
 gi|294452616|gb|EFG21049.1| ABC 3 transport family protein [Enterococcus faecalis PC1.1]
 gi|300850085|gb|EFK77835.1| putative Manganese transport system membrane protein MntB
           [Enterococcus faecalis TUSoD Ef11]
 gi|306513453|gb|EFM82072.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|315025821|gb|EFT37753.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2137]
 gi|315034641|gb|EFT46573.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0027]
 gi|315157181|gb|EFU01198.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0043]
 gi|315159478|gb|EFU03495.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0312]
 gi|315167552|gb|EFU11569.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1341]
 gi|315171614|gb|EFU15631.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1342]
 gi|315575067|gb|EFU87258.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0309B]
 gi|315582494|gb|EFU94685.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0309A]
 gi|329568356|gb|EGG50165.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1467]
          Length = 289

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + L +G +G FII + ++  GD I+H+ L GVA+S +F         
Sbjct: 12  YQFLQNALLTSIIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYMFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|29832175|ref|NP_826809.1| metal transport system ABC transporter permease [Streptomyces
           avermitilis MA-4680]
 gi|29609293|dbj|BAC73344.1| putative zinc/manganese transport system ABC transporter permease
           [Streptomyces avermitilis MA-4680]
          Length = 298

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 127/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
            ++ L ++++  I+       D  L ++ +  ++  +++++      NT+L S+LFG + 
Sbjct: 66  AVSVLGAVLMELIRWYGKTRGDIALAMLFYGGMAGGVMLINLAPGGSNTNLMSYLFGSLT 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSQEDVTAICLLAAFVLLVTLGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ S S      +A  IG+   I G   +   + P G
Sbjct: 186 TVAMRIVGLLLVSALMVVPVAAAQQLSRSFAATFAIAVAIGVSVTIGGTVTTYYRNVPPG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++  FIL
Sbjct: 246 ATIVLLAIGAFIL 258


>gi|161502091|ref|YP_001569203.1| hypothetical protein SARI_00108 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863438|gb|ABX20061.1| hypothetical protein SARI_00108 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 282

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 66/256 (25%), Positives = 117/256 (45%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVSIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    + +N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDENSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIMQTAIIALGIALIIGLKWKDLLLYAFDPHQAKACGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S  FD+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYFDSAPAPT 251

Query: 244 IIITSLFLFILSFFYK 259
           I++    +FI +F Y 
Sbjct: 252 IVVLFAIVFIAAFIYS 267


>gi|91773014|ref|YP_565706.1| ABC transporter, inner membrane subunit [Methanococcoides burtonii
           DSM 6242]
 gi|91712029|gb|ABE51956.1| Zinc ABC transporter permease subunit [Methanococcoides burtonii
           DSM 6242]
          Length = 275

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/260 (25%), Positives = 137/260 (52%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF I A+ +GI   ++ G +G +++ +RIA     IAH++  G+ +S    +   + 
Sbjct: 5   LQYEFMINAITAGILASIACGMIGVYVVVKRIALISGGIAHASFGGIGISYFLGINPIMG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +   + L++L +    K   ++ D I+G++    +++ ++ +        DL ++LFG+I
Sbjct: 65  VLPFSLLSALTIGTFSKRTDVAEDTIIGILWSMGMAIGIIFIGLTPGYAPDLMTYLFGNI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V  +DI ++  +  + I++++ ++K  +A   + E +   G+  EK+ L+ + + +L 
Sbjct: 125 LTVPQSDITMMLALDAIIILVVYALYKEFMALCYDEEFSTVVGIPVEKLYLLLLCLIALT 184

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           + V I+ +G+ L+ +LL +P   +R F+     M  L+   G    IIGL  S  FD  S
Sbjct: 185 VVVMIRVVGLILVIALLTIPAALSREFTNDMRKMMFLSIFFGAAFTIIGLMLSYYFDIAS 244

Query: 241 GPSIIITSLFLFILSFFYKK 260
           G +II+     ++L+   KK
Sbjct: 245 GATIILVMSSFYLLNIIIKK 264


>gi|159038195|ref|YP_001537448.1| ABC-3 protein [Salinispora arenicola CNS-205]
 gi|157917030|gb|ABV98457.1| ABC-3 protein [Salinispora arenicola CNS-205]
          Length = 312

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 134/254 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +GC+++ + +A+ GD +AH+   G+A++ + Q  L +   +
Sbjct: 16  AFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFVLQGSLVVGGAV 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L++    +N  +  D+I+GV      +L +VI+S        L  FLFG I  +
Sbjct: 76  AGVATALLIAIFAQNRRIKEDSIIGVFLVGAFALGIVIISQAPGYAGSLQQFLFGSITGI 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G G + + ++  + K  +A  ++ E++++ G+    + ++  ++ +L + +
Sbjct: 136 PDRDLYVVGGTGLVILGVVLALHKEFVAVCLDREMSRSMGLSVFWLDIVLYVLVTLAVVI 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LLI P   AR  +     M +LA  IG     +GLY S  +DTP G +
Sbjct: 196 SLQTIGNILVLALLITPAAAARLLTDRLGVMMLLAPAIGGSSATVGLYLSWSYDTPVGGT 255

Query: 244 IIITSLFLFILSFF 257
           I++ +   F++++ 
Sbjct: 256 IVLVATATFLIAWL 269


>gi|315605530|ref|ZP_07880567.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312797|gb|EFU60877.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 306

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/255 (26%), Positives = 132/255 (51%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L +   +
Sbjct: 36  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVLGGAL 95

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 96  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 155

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   +P++A T++ E A+A G+      L   +  +L + +
Sbjct: 156 PASDVPVVLVGALFVLLMLFLAHRPIVAVTLDRESARAAGVHVLAADLSLYVAVALAVVI 215

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 216 SVQTIGNVLVLALLVTPAATARLLCDRLATMMILSPTLGAAGGLVGLYLSWALDVPTGAT 275

Query: 244 IIITSLFLFILSFFY 258
           I++     F+L++ +
Sbjct: 276 IVLVLTACFVLAWVF 290


>gi|304394935|ref|ZP_07376819.1| ABC-3 protein [Pantoea sp. aB]
 gi|304357188|gb|EFM21551.1| ABC-3 protein [Pantoea sp. aB]
          Length = 286

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 134/254 (52%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F+ 
Sbjct: 12  YMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAFLS 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L  DAI+G+I  S   L L ++S +     ++ + + G+ILA+ 
Sbjct: 72  GGLAAGSMLLLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTAVNIQTIVLGNILAIA 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DIL +  IG L+I+IL   WK L+ T  +   A+A G++PE++K++F  + ++    +
Sbjct: 131 PADILQLALIGGLSIIILLFKWKDLMVTFFDENHARAIGLRPERLKVLFFTLLAVSTVAA 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G  I
Sbjct: 191 LQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSITSFLGAWVSYYLDGATGGII 250

Query: 245 IITSLFLFILSFFY 258
           ++    LF+L+F +
Sbjct: 251 VVAQTLLFLLAFVF 264


>gi|167630484|ref|YP_001680983.1| abc 3 transport family protein [Heliobacterium modesticaldum Ice1]
 gi|167593224|gb|ABZ84972.1| abc 3 transport family protein [Heliobacterium modesticaldum Ice1]
          Length = 286

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 134/244 (54%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + ++F +RAL +G+ + +    +G F++ +R++  GDTI+H +L GVA  ++  L   + 
Sbjct: 5   LQHDFMVRALLAGVMVAVICPAIGLFLVLRRLSLIGDTISHVSLAGVAGGMLLGLYPPLM 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
               + +  L L ++++     ++  + V     ++LA+++LS  K  ++D+ S+LFG I
Sbjct: 65  ALGFSIVAVLGLERLRRRFQNYAEISIAVFLSGGVALAVILLSMKKSASSDILSYLFGSI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           +AV   D+ ++  +    ++I+   +      T+N E A+  G+    + L+ +++T+L+
Sbjct: 125 VAVTDRDLTILAVVTITVLLIVGLFYHRFFYITLNEEKARLSGLPVNGLNLMIMVLTALV 184

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++ S++ +GI L++S+L+LP   + + + S      LA +  +  + +GL  S   D   
Sbjct: 185 VAASMRIVGILLVSSMLVLPVAASLQAANSFRKAFWLALLYALAEVSVGLTASYYLDLAP 244

Query: 241 GPSI 244
           G +I
Sbjct: 245 GGTI 248


>gi|293190871|ref|ZP_06609033.1| anchored repeat-type ABC transporter, permease subunit [Actinomyces
           odontolyticus F0309]
 gi|292820770|gb|EFF79732.1| anchored repeat-type ABC transporter, permease subunit [Actinomyces
           odontolyticus F0309]
          Length = 304

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/255 (26%), Positives = 131/255 (51%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L     +
Sbjct: 34  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVFGGAL 93

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 94  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 153

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   +P++A T++ E A+A G+      L   +  +L + +
Sbjct: 154 PASDVPVVLAGALFVLLMLFLAHRPIVAVTLDRESARAAGVHVLLADLSLYVAVALAVVI 213

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 214 SVQTIGNVLVLALLVTPAATARLLCDRLGTMMILSPALGASGGLVGLYLSWALDVPTGAT 273

Query: 244 IIITSLFLFILSFFY 258
           I++     F+L++ +
Sbjct: 274 IVLVLTACFVLAWVF 288


>gi|262276210|ref|ZP_06054019.1| zinc ABC transporter permease protein ZnuB [Grimontia hollisae CIP
           101886]
 gi|262220018|gb|EEY71334.1| zinc ABC transporter permease protein ZnuB [Grimontia hollisae CIP
           101886]
          Length = 261

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 179/257 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF    L +GI I  + GPLG F++W+++AYFGDT+AH +LLG+ L  + Q+ L + + +
Sbjct: 3   EFIAIPLVAGILIAATVGPLGSFVVWRKMAYFGDTLAHGSLLGLTLGFMLQVNLNMALIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +Q+   +S+D +LG+I H+++SL LV +SF+  +  DL ++LFGD+L+V
Sbjct: 63  TCVVMAILLVSLQRKSNVSTDTLLGIIAHTSLSLGLVTISFVDDLRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  I     L +  ++++W PLLA TV+ E+A+ +G   +++KLI +++  ++I+V
Sbjct: 123 SGPDVGWIAVGCALVLAAIYRLWNPLLAITVDEEMARVDGYNVDRLKLILMLLVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSL+I+P  TARRFS SPE MA+ A+ IG+L ++ G+  S   DTP+GPS
Sbjct: 183 AMKFVGALIITSLMIIPAATARRFSRSPEQMAMFASGIGVLAVLGGIALSWFKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LF LS FY++
Sbjct: 243 VVVAAAVLFFLSQFYRQ 259


>gi|330719067|ref|ZP_08313667.1| manganese ABC transporter, membrane-spanning subunit [Leuconostoc
           fallax KCTC 3537]
          Length = 287

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 142/247 (57%), Gaps = 1/247 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + L I  
Sbjct: 13  QYNFLQTALITSILVGIMSGLVGSFIILRGMSLMGDAISHAVLPGVAVAYMLGVNLLIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   + +L++  +  +  L +D  +G++  S  +L  +++S  +   T+L   LFG++L
Sbjct: 73  SVFGIVAALLIGFVSTHSKLKNDTAIGIVFSSFFALGFILISMAE-STTNLHHILFGNVL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+ +D++    +G L ++ +   +K LL ++ +   A++ G++ + +    +++ +L+ 
Sbjct: 132 AVSDSDLITTVIVGALVVLFVVVFFKELLISSFDETFARSYGLKTQWLHYGLMIVLTLVT 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI LI ++LI P  TA  ++   + M +L+ I+ ++  ++GLY S  F+  SG
Sbjct: 192 VSALQTVGIILIVAMLITPAATAFLWTNKLKFMLVLSAILSVIASVVGLYLSYTFNWASG 251

Query: 242 PSIIITS 248
           PSI++T+
Sbjct: 252 PSIVLTA 258


>gi|256619549|ref|ZP_05476395.1| ABC transporter [Enterococcus faecalis ATCC 4200]
 gi|307276009|ref|ZP_07557142.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
 gi|256599076|gb|EEU18252.1| ABC transporter [Enterococcus faecalis ATCC 4200]
 gi|295113319|emb|CBL31956.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Enterococcus sp. 7L76]
 gi|306507339|gb|EFM76476.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
          Length = 289

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + L +G +G FII + ++  GD I+H+ L GVA+S +F         
Sbjct: 12  YQFLQNALLTSIIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYMFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VVDTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|189502391|ref|YP_001958108.1| hypothetical protein Aasi_1031 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497832|gb|ACE06379.1| hypothetical protein Aasi_1031 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 415

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 123/268 (45%), Gaps = 10/268 (3%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-----L 55
           + +      +   + +  S   +G F + ++ A  GD  AH+A  G+ ++ +       +
Sbjct: 10  LTDPNIRYVVLGTMLLTSSAAIVGTFTLLKKKALLGDATAHAAFPGICIAFMLTGTKHPI 69

Query: 56  PLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTD---- 111
            L I  F    +  L++  + K+  +  D    ++   T  +  ++LS ++  +      
Sbjct: 70  YLAIGAFTTGWIALLLIDILIKHSKIKEDIATALLLSVTFGIGTLLLSIIQNTSNAAQLG 129

Query: 112 LTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKL 171
           L ++LFG   A+   D+L++  +    ++ +  ++K       +   A++  M+   ++ 
Sbjct: 130 LNNYLFGKAAALLGEDLLVLGILSIAILLTVVGLFKEFTLIAFDKAFAESIHMRVNLLEF 189

Query: 172 IFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLY 231
           +F  +  L I + I+ +GI L+ ++LI P   AR ++     M  LA + G +  ++G +
Sbjct: 190 VFTSLIVLAIVIGIRAVGIVLMAAMLITPAAAARFWTDRLTKMIGLAALFGAISGLLGSF 249

Query: 232 GSLIF-DTPSGPSIIITSLFLFILSFFY 258
            S +F   P+GP I++    +  +SF +
Sbjct: 250 VSYLFPGMPTGPWIVLIVTAIAYISFLF 277


>gi|325274009|ref|ZP_08140167.1| hypothetical protein G1E_12797 [Pseudomonas sp. TJI-51]
 gi|324100862|gb|EGB98550.1| hypothetical protein G1E_12797 [Pseudomonas sp. TJI-51]
          Length = 260

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 178/259 (68%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVA+     +   + +
Sbjct: 1   MADFLLYALLAGLSLAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVAMGFALDVSPALAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++TTD+  I G   L +++L  +W+PLLA TV+ ELA  EG+    ++L  +++ +++I
Sbjct: 121 AISTTDLAWILGGSALVLLLLGVLWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++GI  +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGITAVCGGLAMSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++ +  LF+LS    K
Sbjct: 241 PSIVVCAAVLFLLSLALPK 259


>gi|270262221|ref|ZP_06190493.1| hypothetical protein SOD_b04290 [Serratia odorifera 4Rx13]
 gi|270044097|gb|EFA17189.1| hypothetical protein SOD_b04290 [Serratia odorifera 4Rx13]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 99/257 (38%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVLLAGAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +LVL+ +++   LS D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLALALVLVWLERRPQLSVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +DI +I     + ++IL+  W+ LL+ T++ ELA  +G+   + + + +++T+L I +
Sbjct: 123 TFSDIWMIGIGVSIVLLILWWQWRNLLSMTISPELAHVDGVNLVRARTVLMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA  A ++G+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGYAVLVGMLAVTGGLAFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++++  LF+LS F K+
Sbjct: 243 VVLSAAVLFVLSLFRKQ 259


>gi|21220968|ref|NP_626747.1| metal transport ABC transporter [Streptomyces coelicolor A3(2)]
 gi|6752350|emb|CAB69728.1| putative metal transport ABC transporter [Streptomyces coelicolor
           A3(2)]
          Length = 300

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/252 (20%), Positives = 127/252 (50%), Gaps = 1/252 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAIGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  ++ ++      N +LTS+LFG + 
Sbjct: 66  LVSVLGAVLMELIRWYGKTRGDIALAMLFYGGMAGGVMFINLAPGGSNANLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSESDVTAICVLAAFVVLVTVGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ + S      ++  +G+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLTRSFAATFAISVALGVSVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFI 253
            +I++ ++  FI
Sbjct: 246 ATIVLLTIGAFI 257


>gi|219871290|ref|YP_002475665.1| chelated iron ABC transporter permease [Haemophilus parasuis
           SH0165]
 gi|219691494|gb|ACL32717.1| chelated iron ABC transporter, permease [Haemophilus parasuis
           SH0165]
          Length = 279

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 123/257 (47%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL  G+ + L    L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F+
Sbjct: 15  PFIQQALVIGVVVALICAVLSCYLVLKGWSLMGDAISHAVLPGIVIAYLLAIPLAIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  +  D ++G++     +L LV+ + ++  +  L   LFGD+L +
Sbjct: 75  SGIFCAVAVGYLKENSRIKEDTVMGIVFSGMFALGLVMFAKVE-TDQHLMHILFGDLLGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +      I  + + ++    +  L    +   A+  G   + +    +++ +L+I  
Sbjct: 134 TDNEFYQTLAISLVVLFVILVKRRDFLLYCFDASHARTVGFNIKVLHYSLLVLLALVIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +T    +   + M ++A    +     G++ S  FD  +GP 
Sbjct: 194 AMQVVGVILVVAMLITPGITGYTLAKRFDRMLLIAIFTAVNSAFWGVFLSFHFDVATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+ +    K
Sbjct: 254 IVLLQAVGFLGALGINK 270


>gi|257084782|ref|ZP_05579143.1| ABC transporter, permease [Enterococcus faecalis Fly1]
 gi|256992812|gb|EEU80114.1| ABC transporter, permease [Enterococcus faecalis Fly1]
 gi|315149266|gb|EFT93282.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0012]
          Length = 289

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/245 (30%), Positives = 133/245 (54%), Gaps = 1/245 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + + + L +G +G FII + ++  GD I+H+ L GVA+S +F         
Sbjct: 12  YQFLQNALLTSVIVGLISGVIGSFIILRGMSLMGDAISHAVLPGVAVSYMFGFNYIFGAS 71

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +L +  I +   L +D  +GV+  S  +L ++ +SF K  +TDL   LFG++LA
Sbjct: 72  IFGLLAALSIGFITQKSPLKNDTAIGVVFSSFFALGIIFISFAK-SSTDLYHILFGNVLA 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDIL+   +G + ++ +   +K L  T+ +  +A+A G+  +      + + +L+  
Sbjct: 131 VADTDILITCVVGVIVLIFVALFYKELQLTSFDPTMAQAYGLNIQFFHYALMFLLTLVAV 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G  L+ ++LI P  TA   +     M  LA+  GIL  +IGL+ S  ++  SG 
Sbjct: 191 SSLQTVGTILVIAMLITPAATAYLLTNHLPTMIGLASTFGILSSVIGLFFSYSYNLASGA 250

Query: 243 SIIIT 247
           +I++T
Sbjct: 251 TIVLT 255


>gi|86358316|ref|YP_470208.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CFN
           42]
 gi|86282418|gb|ABC91481.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CFN
           42]
          Length = 270

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 147/257 (57%), Positives = 211/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RA+ +G+G+ L+TGPLGCFIIW+R+AYFGDTIAHSALLGVALSL+F+L LT+ 
Sbjct: 1   MLDDFFVRAILAGVGLALTTGPLGCFIIWRRMAYFGDTIAHSALLGVALSLLFELNLTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F +A L S++LL +QK +ALS+DA+LG+++H+T+++ LV+++FM WV  DL +FLFGDI
Sbjct: 61  VFAVAALVSVLLLFLQKRQALSADALLGILSHATLAIGLVMVAFMSWVRIDLIAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+TTDI LIWG G   +  +  +W+PLLA TVN ELA+AEG++PE  +L F+++ +++
Sbjct: 121 LAVSTTDIALIWGGGLFVLAAIAWLWRPLLAATVNAELAEAEGLRPEGARLFFMLLMAVV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P   ARRFS +PE MA+LA++IG   ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAARRFSVTPEIMAVLASLIGAAAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LFILS  
Sbjct: 241 GPSIVVAALILFILSLL 257


>gi|329123615|ref|ZP_08252175.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
 gi|327469814|gb|EGF15279.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
          Length = 271

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ LLG+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLLGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LVI + ++     LT  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVIFTKIQ-TEQHLTHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCMIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A I  I   +IG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIISSITSSLIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|261407250|ref|YP_003243491.1| ABC-3 protein [Paenibacillus sp. Y412MC10]
 gi|261283713|gb|ACX65684.1| ABC-3 protein [Paenibacillus sp. Y412MC10]
          Length = 288

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 70/258 (27%), Positives = 140/258 (54%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  RA ++G  I +    LG F++ +R     DT++H +L GVAL    +L   +  F
Sbjct: 6   YEFMQRAFWAGGLIGVIGPVLGVFLMLRRQVLMADTLSHVSLAGVALGSFLKLNPALSGF 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +A + +LV+ Q+++     ++  + +I  S ++L++V++S  + ++   +S+LFG I+A
Sbjct: 66  AMAMIGALVIEQLRRVYRTYTEVPVAIIMTSGLALSVVLMSLNQNLSKSFSSYLFGSIVA 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ T + LI  +  + ++    + +PL     + E A A GM+   +  +F + T + ++
Sbjct: 126 VSDTQLRLIAVVAAVGMIFFVGLRRPLYNFAFDEETAAASGMRVSLLSFLFAVFTGMTVA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++  +G+ L+++L++LP   A R +T       +A  +G+ G+  GL  S   +TP G 
Sbjct: 186 AAMPVVGVLLVSALIVLPASIALRMATGFLAAMGIAVFVGLSGVFSGLAASYYLNTPPGG 245

Query: 243 SIIITSLFLFILSFFYKK 260
           +I +  L   IL+  ++K
Sbjct: 246 TIALILLGFLILAVIFQK 263


>gi|56807849|ref|ZP_00365687.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Streptococcus pyogenes M49 591]
          Length = 283

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 147/259 (56%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 9   MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 69  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 128 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 188 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNIAA 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 248 GSSIVLTSAMMFLISFFVS 266


>gi|281491860|ref|YP_003353840.1| manganese ABC transporter permease [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375571|gb|ADA65077.1| Manganese ABC transporter, permease protein [Lactococcus lactis
           subsp. lactis KF147]
          Length = 284

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   +   + 
Sbjct: 14  FLQNALVTAVVIGVVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFVGAIIF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L+S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLSSIIITFIKNNSIIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  L  G+  + ++++   +K LL T+ +  +A+A GM+      + +++ +L+   +
Sbjct: 133 DIDKWLTIGVSGIVLIVIILFFKELLITSFDPLMARAIGMKVNFYHYLLMVLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S   M IL++ +G +  ++GL+    F+   G SI
Sbjct: 193 MQSVGTILIVALLITPAATAYLYTNSLRKMIILSSSLGAVSSVLGLFIGYSFNIAVGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           +ITS  +F +SF   
Sbjct: 253 VITSAIIFAISFLVS 267


>gi|284990136|ref|YP_003408690.1| ABC-3 protein [Geodermatophilus obscurus DSM 43160]
 gi|284063381|gb|ADB74319.1| ABC-3 protein [Geodermatophilus obscurus DSM 43160]
          Length = 339

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 126/242 (52%), Gaps = 1/242 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL + + + L    +G F++ +R++  GD + H AL GVA+ ++          + 
Sbjct: 8   FMQRALLASLMVGLVAPAVGVFLVQRRLSLLGDGLGHVALTGVAVGVLTSTAPVGTALVA 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLTSFLFGDILAV 123
           A L ++++  ++     S D  L V+ +  I+  +V+LS       T+L ++LFG I   
Sbjct: 68  AVLGAVLIELVRARGRTSGDVALAVLFYGGIAGGVVLLSLAPQGQATNLEAYLFGAITTT 127

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D+ +   I  + + +++ + + L A + + E A+A G+    + ++   + +  + +
Sbjct: 128 TTADVAVFGVITVVVLGVVWLLGQRLYAVSDDEEYARAVGLPVLALNVVLAALVAATVVL 187

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ LI++L+I+P+  A++ + S      LA  IG++  + G   S    TPSG +
Sbjct: 188 SMRVVGLLLISALMIVPSAVAQQLARSFRQTLYLACGIGLVTSVAGTTASYYTGTPSGGT 247

Query: 244 II 245
           I+
Sbjct: 248 IV 249


>gi|294085792|ref|YP_003552552.1| zinc ABC transporter membrane spanning protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665367|gb|ADE40468.1| ABC transporter, membrane spanning protein, zinc [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 285

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 131/257 (50%), Positives = 198/257 (77%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+  GIG+ L  GPLGCFIIW+++AYFGDT++HSALLGVAL+L+F++ +T+ 
Sbjct: 1   MFDDFFVRAVIGGIGVALVAGPLGCFIIWRKLAYFGDTLSHSALLGVALALLFEVNVTLA 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F+++   SL+L+ +Q+  +LSSDA+LG++ HS +++ LV L+FM WV  DL  FLFGDI
Sbjct: 61  VFVVSVAVSLMLVFLQRRASLSSDALLGLLAHSALAVGLVTLAFMTWVRVDLMGFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L++ T D+ +IWG G   +++L  IW+ L A TV+YELA AEG +P+ + +IF+++ + +
Sbjct: 121 LSITTFDLAIIWGGGMSVLVVLMVIWRALFAATVSYELALAEGAKPDHVNIIFMILMAGV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I+VS+K +G+ LIT+LLI+P  TARR S+SPE MA  A +IG++ +  GL+GSL  DTP+
Sbjct: 181 IAVSLKIVGVLLITALLIIPAATARRLSSSPEQMAFFAILIGVISVWFGLFGSLELDTPA 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L  FILS  
Sbjct: 241 GPSIVVAALICFILSLM 257


>gi|255324588|ref|ZP_05365705.1| ABC-3 protein [Corynebacterium tuberculostearicum SK141]
 gi|311740545|ref|ZP_07714372.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|255298494|gb|EET77794.1| ABC-3 protein [Corynebacterium tuberculostearicum SK141]
 gi|311304065|gb|EFQ80141.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 302

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 67/255 (26%), Positives = 138/255 (54%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RA+   +   +  G +GC+++ + +A+ GD ++H+   G+A++   Q  + +   +
Sbjct: 19  DFLARAVGISLLAAIVCGVIGCYVVLRGMAFIGDAVSHAVFPGLAIAFALQTSVLVGGAV 78

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L++    +   + +D+I+G+   +  +L +VI+S     +  LTSFLFG +  V
Sbjct: 79  AGAVVALLIAAFSQRRHVRADSIIGIFFAAAFALGMVIISRTDGYSASLTSFLFGSLTGV 138

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TDI++   +  + + I+      L AT ++ E A+A G+    + +I  +  +  + +
Sbjct: 139 SRTDIIVAGCVCAVVVAIVIAFGPQLNATCLDRETARAMGLPVFVLDIILYLCVTAAVVI 198

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+  IG  L+ +LLI P  TAR  ST+ + M  L+ +IG L   +G+Y +   D P+G +
Sbjct: 199 SVSTIGNILVLALLITPAATARLLSTNLKTMMCLSALIGALSSFLGIYLAWAIDLPAGAT 258

Query: 244 IIITSLFLFILSFFY 258
           I++T   +F++ +  
Sbjct: 259 IVLTLTAIFLVVWAI 273


>gi|183599003|ref|ZP_02960496.1| hypothetical protein PROSTU_02447 [Providencia stuartii ATCC 25827]
 gi|188021218|gb|EDU59258.1| hypothetical protein PROSTU_02447 [Providencia stuartii ATCC 25827]
          Length = 261

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 173/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIT 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L SL+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLSLILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  DI+ I+    +   +L   W+ LL+ TVN ELA  +G+  ++++L+ +++T+L I +
Sbjct: 123 NYEDIITIFIGVIVVCGLLCWRWRALLSMTVNQELAFVDGVNIQRLRLLLMLVTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA++A +IG+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFAKTPEQMALIAILIGMLSVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++T+  LF  S   K
Sbjct: 243 VVLTAAILFAFSLLVK 258


>gi|319441665|ref|ZP_07990821.1| manganese ABC transport system, permease protein [Corynebacterium
           variabile DSM 44702]
          Length = 298

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 129/258 (50%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF  RAL       ++ G L C+++    +  GD ++H+ L GV +S I   P  I 
Sbjct: 2   LTYEFVQRALLVSTVTAVTAGLLSCWLVLIGWSLMGDAVSHAVLPGVVISYIVGWPFAIG 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + A +   ++  + +   L  D  +GV+  +  +L LV++S      T+L   LFG++
Sbjct: 62  ALIAALIAVALVGTVGERTTLKGDTAIGVVFTALFALGLVLVSVTP-AGTNLQEILFGNL 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++   ++ +   G + ++++  + + +     +   A+A G+    I+   ++  +L+
Sbjct: 121 LGISRDALVQVLLFGAIALVVMLVLRRNITVWAFHPAHARAVGVPTGLIRGAVMVCLALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           +  +++ +G+ L+ ++LI P  TA   +     M ++A ++  +  + G+  S  +D  +
Sbjct: 181 VVAAMQAVGVILVVAMLITPGATAYLLTRRINRMLVIAPLVAWVSSVAGITLSYRYDVSA 240

Query: 241 GPSIIITSLFLFILSFFY 258
           G +I++    LF+L++ +
Sbjct: 241 GGTIVLFQAGLFVLAYLF 258


>gi|317049470|ref|YP_004117118.1| ABC-3 protein [Pantoea sp. At-9b]
 gi|316951087|gb|ADU70562.1| ABC-3 protein [Pantoea sp. At-9b]
          Length = 290

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F
Sbjct: 10  YQYMLNAMWVSALVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   L L ++S +     ++ + + G+ILA
Sbjct: 70  LSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTAVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG ++I +LF  WK LL T  +   A+A G+ P+++KL+F  + +L   
Sbjct: 129 IAPADILQLTLIGAVSISVLFFKWKDLLVTFFDENHARAIGLHPQRLKLLFFTLLALSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +  +A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLAIAVTIGSVTSFLGAWASYYLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFIF 264


>gi|94993768|ref|YP_601866.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10750]
 gi|94547276|gb|ABF37322.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10750]
          Length = 284

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M + F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSHHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|317048518|ref|YP_004116166.1| ABC-3 protein [Pantoea sp. At-9b]
 gi|316950135|gb|ADU69610.1| ABC-3 protein [Pantoea sp. At-9b]
          Length = 261

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     + +
Sbjct: 3   ELLLPGWLGGVFLALAAGPLGAFVVWRRMSYFGDTLAHASLLGVAFGLLFNVNPYYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMSGVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + + ++   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L I V
Sbjct: 123 TPQDLWMMGGGVTIVLAVMAWQWRSLLSMTISPELAQVDGVNIQRTRLMLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA  A IIGIL +  GL  S ++DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRSPEQMAGFAVIIGILAVTGGLSFSALYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI+S   K
Sbjct: 243 VVLCAAVLFIISMAKK 258


>gi|50955577|ref|YP_062865.1| ABC-type Mn2+/Zn2+ transport systems, permease protein [Leifsonia
           xyli subsp. xyli str. CTCB07]
 gi|50952059|gb|AAT89760.1| ABC-type Mn2+/Zn2+ transport systems, permease protein [Leifsonia
           xyli subsp. xyli str. CTCB07]
          Length = 308

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 127/256 (49%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +      G +G  ++ + +A+ G  ++H+   G+A++ +    L +    
Sbjct: 18  AFLPKALAVAVISSTVCGIVGAHVVLRGMAFIGGAVSHAVFPGLAIAFVLSGDLVLGGVF 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T++++     N  L+  +I+GV      +L +V++S        L  FLFG I  +
Sbjct: 78  AGVATAVLVAVFSHNRRLNESSIIGVFFVVAFALGVVVISQTPGYAGSLEQFLFGSITGI 137

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ +    G   +  +F + K  +  +++ E A+A G+    + L+  ++ +L + +
Sbjct: 138 PDRDLYVASITGVAVLGAMFLLHKEFVTISLDRESARALGVPVFLLDLVLYVLVTLAVVI 197

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR  +     M  L+ +IG LG  IGLY S  +D P+G +
Sbjct: 198 SVQTIGNILVLALLVTPAATARMLTDRLGVMMSLSPVIGGLGTFIGLYLSWSWDIPTGGT 257

Query: 244 IIITSLFLFILSFFYK 259
           I++     F++++F+ 
Sbjct: 258 IVLVLTAAFLVAWFFS 273


>gi|209558942|ref|YP_002285414.1| Integral membrane protein MtsC, ABC transporter [Streptococcus
           pyogenes NZ131]
 gi|209540143|gb|ACI60719.1| Integral membrane protein MtsC, ABC transporter [Streptococcus
           pyogenes NZ131]
          Length = 284

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 147/259 (56%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITYSSFLALGVILIGAAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|327542181|gb|EGF28674.1| ABC-3 protein [Rhodopirellula baltica WH47]
          Length = 444

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 124/265 (46%), Gaps = 15/265 (5%)

Query: 10  LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI---------- 59
           +F    + L+ G +GCF + +R A  GD +AH+AL G+A++ ++   +            
Sbjct: 20  IFGAAMLGLAAGLVGCFTLLRRRALVGDALAHAALPGIAIAFLWVTAMGGDGRSLPVLLA 79

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSF 115
              +        +L I++   +  DA LG++      L L +L   +         L SF
Sbjct: 80  GATVSGMFGIASILIIRRGTRIKEDAALGIVLSVFFGLGLELLGIAQQMKNGNKAGLESF 139

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           ++G   ++  +D  LI     + ++I   ++K       +   A + G     +    + 
Sbjct: 140 IYGKTASMVASDAWLIAIASLICVVICVGLFKEFKLLCFDEAFAGSRGYPVVLLDAALMS 199

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           +  ++  + ++ +G+ L+ +LL++P  +AR ++     M +L++ IG++G ++G   S +
Sbjct: 200 VVVVITIIGLQAVGLVLVIALLVIPAASARFWTDRLVWMMVLSSAIGMVGCLVGAAASAM 259

Query: 236 FD-TPSGPSIIITSLFLFILSFFYK 259
               PSG  I++T+   F++SFF  
Sbjct: 260 LPRLPSGAMIVLTTGVGFLISFFVG 284


>gi|256787871|ref|ZP_05526302.1| metal transport ABC transporter [Streptomyces lividans TK24]
 gi|289771755|ref|ZP_06531133.1| metal transport ABC transporter [Streptomyces lividans TK24]
 gi|289701954|gb|EFD69383.1| metal transport ABC transporter [Streptomyces lividans TK24]
          Length = 300

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 52/252 (20%), Positives = 127/252 (50%), Gaps = 1/252 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAIGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  ++ ++      N +LTS+LFG + 
Sbjct: 66  LVSVLGAVLMELIRWYGKTRGDIALAMLFYGGMAGGVMFINLAPGGSNANLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSESDVTAICVLAAFVVLVTVGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ + S      ++  +G+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLTRSFAATFAISVALGVSVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFI 253
            +I++ ++  FI
Sbjct: 246 ATIVLLTIGAFI 257


>gi|197119982|ref|YP_002140409.1| bifunctional metal ABC transporter membrane protein/metal-binding
           helix-turn-helix transcriptional repressor [Geobacter
           bemidjiensis Bem]
 gi|197089342|gb|ACH40613.1| metal ABC transporter membrane protein and metal-binding
           helix-turn-helix transcriptional repressor [Geobacter
           bemidjiensis Bem]
          Length = 441

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/265 (21%), Positives = 124/265 (46%), Gaps = 11/265 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLI----------FQ 54
           +F +AL  G  + L +G +G  ++ +R+A+ GD ++H+ + GVA   +          + 
Sbjct: 16  YFQKALIGGCAVALVSGAVGSLVVLRRMAFLGDALSHAMIAGVAGGYLAMKLLFGVEAYA 75

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLT 113
             + +   + A +T  ++  + K   +  D ++G++     +L +V++S  +   + DL 
Sbjct: 76  PAMLLGSLIAAIITVALIGVVSKVSRVKEDTVIGIMYTGVFALGVVVVSIFRQYIHIDLM 135

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            F+ GDIL V  TD+     +    + IL   ++     + +  +A + G+    +    
Sbjct: 136 HFIMGDILGVADTDLWASAIVSASVLTILVLFFRHFQLASFDPIMAASTGLPVLLLDYAL 195

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
               S+++  ++  +G+ L+  LLI P  TA   S   + M  LA++ G+  +I GLY  
Sbjct: 196 TGCVSMVVVSAVSMVGVILVVGLLITPAATAYLLSDRLDKMMALASLFGVTSVIGGLYLC 255

Query: 234 LIFDTPSGPSIIITSLFLFILSFFY 258
           +  D+  G ++++     F+     
Sbjct: 256 VWLDSAGGGAVMLFCTLQFLAVLVV 280


>gi|295096665|emb|CBK85755.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 283

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 66/256 (25%), Positives = 137/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  LSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DI+ +  IG ++I+IL   WK L+ T  +   A+A G++PE++K++F  + ++   
Sbjct: 129 IAPEDIVQLAIIGVVSIVILLFKWKDLMVTFFDENHARAIGLRPERLKILFFTLLAVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSITSFLGAWASYYLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|172036155|ref|YP_001802656.1| Mn2+ ABC transporter permease [Cyanothece sp. ATCC 51142]
 gi|171697609|gb|ACB50590.1| Mn2+ ABC transporter, permease protein [Cyanothece sp. ATCC 51142]
          Length = 293

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/258 (24%), Positives = 124/258 (48%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F ++A++    + L    L C+I  +  +  GD I+HS + GV ++    +P  I 
Sbjct: 11  LQYGFLVQAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHSVVPGVVVAYALNIPFAIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+     ++ +  I     L  DA++G++     +  LV+++ +   N DL   LFG++
Sbjct: 71  AFLFGFGATVAIGYITSMTRLKEDAVIGIVFTGFFAFGLVLVTKIP-SNIDLFHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++  DI+     G + ++++    K LL    +   A A G+  + +    + + +L 
Sbjct: 130 LGISQQDIIQSLMAGIITLVVILLRRKDLLLFCFDPNHATAIGLNTQVMYYTLLSVLALT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I  +++  GI L+ S+L+ P       S   + M ++A I  +L  ++G Y S   D  +
Sbjct: 190 IVAALQTAGIILVISMLVTPGSIGYLLSDRFDYMLVVAVISSVLSCVLGTYLSYYLDVST 249

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++    LFIL+  +
Sbjct: 250 GGSIVVLLTALFILTMIF 267


>gi|325292920|ref|YP_004278784.1| High-affinity zinc uptake system membrane protein znuB
           [Agrobacterium sp. H13-3]
 gi|325060773|gb|ADY64464.1| High-affinity zinc uptake system membrane protein znuB
           [Agrobacterium sp. H13-3]
          Length = 272

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 138/257 (53%), Positives = 212/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +GIG+ L+ GPLGCF++W+R+AYFGDT+AHSALLGVALSL+ Q+ L + 
Sbjct: 1   MFDDFFVRAMIAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLLLQINLIVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++L+ +Q+ +ALS+DA+LG+++HS +++ LVI++FM WV  DL SFLFGDI
Sbjct: 61  VFLVASAVSILLIFLQRRQALSADALLGILSHSALAIGLVIVAFMSWVRIDLVSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +DI LIWG G + ++ +  +W+ LLA+TVN ELA+AEG+ PE+ KLIF ++ +L+
Sbjct: 121 LAVTRSDIALIWGGGLVVLVSMVFLWRSLLASTVNTELAEAEGLNPERAKLIFTLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MA++A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGIMLITSLLIIPAATARRFSSTPEVMAVVASLIGAVAVVGGLFGSLSYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ ++ LF++S  
Sbjct: 241 GPSIVVAAVILFVISLL 257


>gi|87124117|ref|ZP_01079967.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           RS9917]
 gi|86168686|gb|EAQ69943.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           RS9917]
          Length = 280

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/248 (23%), Positives = 118/248 (47%), Gaps = 1/248 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           ++F +RAL     +    G L C++  +  A  GD ++H+ L GV L+    LP ++  F
Sbjct: 10  HDFMVRALVVSGLVGAVCGLLSCYMTLKGWALMGDAVSHAVLPGVVLAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DI     I  +   +L  + + LL    +   A++ G+    +  + + I SL   
Sbjct: 129 ISAADIQQTLLISAVVTAVLLLLRRDLLLFCFDPTHARSIGINTGVLHYLLLSILSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   +   + M  LA    ++  + G+Y S   D+ +  
Sbjct: 189 AGLQTVGIILVVAMLVTPGATAYLLTDRFDRMTWLAVGSSVVSSLFGVYLSYWSDSSTAG 248

Query: 243 SIIITSLF 250
            I++    
Sbjct: 249 CIVLVQTG 256


>gi|170078340|ref|YP_001734978.1| ABC 3 transport family protein [Synechococcus sp. PCC 7002]
 gi|169886009|gb|ACA99722.1| ABC 3 transport family protein [Synechococcus sp. PCC 7002]
          Length = 287

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 60/258 (23%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F ++A++    + L    L C+I  +  +  GD ++H+ + GV ++    +P  I 
Sbjct: 11  LQYGFLVKAIWVSAFVGLVCAVLSCYITLKGWSLMGDAVSHAVVPGVVVAYALNIPFAIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+     ++ +  ++    L  DA++GVI     +  LV+++ +   N DL   LFG++
Sbjct: 71  AFIFGFGATVAIGYVKSKTRLKEDAVIGVIFTGFFASGLVLITKIP-SNIDLFHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +DI+     G L ++++    K LL    +   AKA G+    +    + + +L 
Sbjct: 130 LGISNSDIVQTLIAGTLTLVVILIQRKDLLLFCFDPNHAKAIGLNTRLMYYTLLSVLALT 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I  +++  GI L+ ++L+ P   A   +   ++M  ++    I   + G Y S  FD  +
Sbjct: 190 IVTALQTAGIILVIAMLVTPGSIAYLLTDRFDHMLWISAASSIFSCVFGTYLSYHFDVST 249

Query: 241 GPSIIITSLFLFILSFFY 258
           G +I++    +F+L+ F+
Sbjct: 250 GGAIVVLLTIVFVLAMFF 267


>gi|297160645|gb|ADI10357.1| metal transport system ABC transporter permease [Streptomyces
           bingchenggensis BCW-1]
          Length = 309

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 127/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H AL GVAL  +          
Sbjct: 7   YAFMQRALIAAVLVGITAPAVGIYLVQRRQAIMGDGIGHVALTGVALGFLTGTNPVWTAV 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
            ++ L ++++  I+       D  L ++ +  ++  +++++      N +LT++LFG I 
Sbjct: 67  AVSALGAILMELIRWYGKTRGDLALAMLFYGGMAGGVLLINLSPTGSNANLTTYLFGSIT 126

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  D+  I  +    ++I   + + L A   + E A+  G+    + L+  +  ++ +
Sbjct: 127 TVSREDVTAISCLAAFVVLITLGLRRQLFAVCQDEEFARVTGLPVRTLNLLLAITAAVTV 186

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ +        LA  IG++  + G   S   D P G
Sbjct: 187 TVAMRVVGLLLVSALMVVPVAAAQQATRGFAMTLALAVAIGVVVTLSGTVFSFYEDVPPG 246

Query: 242 PSIIITSLFLFIL 254
            SI++ ++ +F +
Sbjct: 247 ASIVVLAIGVFAV 259


>gi|229548537|ref|ZP_04437262.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|293382676|ref|ZP_06628602.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|293386732|ref|ZP_06631304.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|307269169|ref|ZP_07550525.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|307277655|ref|ZP_07558744.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
 gi|312905682|ref|ZP_07764705.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|312950992|ref|ZP_07769901.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|312978614|ref|ZP_07790349.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|229306317|gb|EEN72313.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis ATCC 29200]
 gi|291079931|gb|EFE17295.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           R712]
 gi|291083846|gb|EFE20809.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           S613]
 gi|306505680|gb|EFM74861.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2134]
 gi|306514491|gb|EFM83050.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX4248]
 gi|310628263|gb|EFQ11546.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 512]
 gi|310631032|gb|EFQ14315.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0102]
 gi|311288553|gb|EFQ67109.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           DAPTO 516]
 gi|315032533|gb|EFT44465.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0017]
 gi|315036656|gb|EFT48588.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0027]
 gi|315157401|gb|EFU01418.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0043]
 gi|315163183|gb|EFU07200.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0645]
 gi|315577983|gb|EFU90174.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0630]
          Length = 292

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 26  FLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 85

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 86  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 144

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 145 DIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVTA 204

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 205 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSSI 264

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 265 VLTAAFLFVISFLIS 279


>gi|171915995|ref|ZP_02931465.1| chelated iron transport system membrane protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 277

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 119/256 (46%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F + A+  G  +      L C+++ +  +  GD I+H+ L GV  + +  LPL +  F
Sbjct: 9   YSFMVDAMLIGALVGTVCAVLSCYLVLKGWSLMGDAISHAVLPGVVGAYLLGLPLAVGAF 68

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +     +     ++ N  +  D ++G+I     +L LV+ + ++  +  L   LFG+IL 
Sbjct: 69  VTGLFCATATGWVKANTRIKEDTVMGIIFTGLFALGLVMFTKVQ-TDIHLNHILFGNILG 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  +  +       L + ++  + K LL    +   A+  G+  + +  + + + +  I 
Sbjct: 128 IERSSKIQTLVAAVLTLGVVLTLRKDLLLYCFDPTHARTIGLNTQALYYVLLALLAGTIV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P   A   +   + M I+A +  ++  + G+Y S   +   G 
Sbjct: 188 AALQAVGILLVVAMLITPGCIAHLLTDRFDRMLIVAALSSVISCVTGVYVSFFLNAAPGA 247

Query: 243 SIIITSLFLFILSFFY 258
            +++    +F ++F +
Sbjct: 248 CMVLVQALIFAIAFVF 263


>gi|325280807|ref|YP_004253349.1| ABC-3 protein [Odoribacter splanchnicus DSM 20712]
 gi|324312616|gb|ADY33169.1| ABC-3 protein [Odoribacter splanchnicus DSM 20712]
          Length = 266

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 64/258 (24%), Positives = 130/258 (50%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +FF  AL S + I +S G +G +I+ +R+ +    I H++  G+ LS    L   +   
Sbjct: 7   YDFFQNALISTLLIGISCGLVGTYIVAKRMVFISGGITHASFGGLGLSYYLGLSPMLGAT 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
             + L++L +L +  ++ L  D+++G+   + +++ ++ +        +L S+LFG+IL 
Sbjct: 67  AFSILSALGILFLSDSKKLKEDSLIGIFWSAGMAIGILFIYLTPGYAPNLMSYLFGNILT 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V    I+L   +    I+   + ++PL     + E ++   +   +I +   +I +L I 
Sbjct: 127 VTREQIILSVVLCLGIILFFARFYRPLFYIAFDKEYSRTHHVHVNRIDIAITLIIALCIV 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S+K  GI L+ S L +P   A  F  + +   + + ++   G I GL+ S   + P+G 
Sbjct: 187 LSLKLAGIILVISYLTIPQAIAGIFYKNFKQQLLASALVSTAGSITGLFLSAFLNIPTGA 246

Query: 243 SIIITSLFLFILSFFYKK 260
           +I+I  L  F++S+   K
Sbjct: 247 TIVICFLLFFLISWLINK 264


>gi|229546423|ref|ZP_04435148.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|307290103|ref|ZP_07570026.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
 gi|229308440|gb|EEN74427.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX1322]
 gi|306498822|gb|EFM68317.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0411]
          Length = 292

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 26  FLQNALITSVVIGVVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 85

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 86  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 144

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 145 DIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVTA 204

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 205 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSSI 264

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 265 VLTAAFLFVISFLIS 279


>gi|312899242|ref|ZP_07758579.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
 gi|311293597|gb|EFQ72153.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0470]
          Length = 292

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 26  FLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 85

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 86  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 144

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++ +   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 145 DIDKWITIGVSVLVLVTVVLFFKELLITSFDPLMAKAMGMNVSFYHYLLMILLTLVAVTA 204

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 205 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGACSSLLGLFIGYSFNIAAGSSI 264

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 265 VLTAAFLFVISFLIS 279


>gi|297194486|ref|ZP_06911884.1| metal transport ABC transporter [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197718704|gb|EDY62612.1| metal transport ABC transporter [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 302

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 54/255 (21%), Positives = 135/255 (52%), Gaps = 1/255 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + + F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +        
Sbjct: 6   LQSPFMQRALLAALLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLMSTNPIWM 65

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNT-DLTSFLFGD 119
             +++ L ++++  I+       D  L ++ +  ++  ++++      +T +LTS+LFG 
Sbjct: 66  ATLVSVLGAVLMELIRIYGRTRGDIALAMLFYGGMAGGVLLIELSDSGSTANLTSYLFGS 125

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           +  V+ +D++ I  +    +++   + + L A + + E A+  G+    + L+  +  ++
Sbjct: 126 LSTVSDSDVVAILLLAAFVVLVSLGLRRQLFAVSQDEEFARVTGLPVRALNLLVAVTAAV 185

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            +SV+++ +G+ L+++L+++P   A++ S S +    LA  IG++  + G   S   + P
Sbjct: 186 TVSVAMRVVGLLLVSALMVVPVAAAQQISRSFKATYALAVAIGVVVALAGTTTSYFHEVP 245

Query: 240 SGPSIIITSLFLFIL 254
            G +I++ ++ +F++
Sbjct: 246 PGATIVMLAITVFVV 260


>gi|32477515|ref|NP_870509.1| manganese ABC transporter permease protein [Rhodopirellula baltica
           SH 1]
 gi|32448069|emb|CAD77586.1| manganese ABC transporter permease protein [Rhodopirellula baltica
           SH 1]
          Length = 444

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 123/265 (46%), Gaps = 15/265 (5%)

Query: 10  LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI---------- 59
           +F    + L+ G +GCF + +R A  GD +AH+AL G+A++ ++   +            
Sbjct: 20  IFGAAMLGLAAGLVGCFTLLRRRALVGDALAHAALPGIAIAFLWVTAMGGDGRSLPVLLA 79

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSF 115
                       +L I++   +  DA LG++      L L +L   +         L SF
Sbjct: 80  GATASGMFGIASILIIRRGTRIKEDAALGIVLSVFFGLGLELLGIAQQMKNGNKAGLESF 139

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           ++G   ++  +D  LI     + ++I   ++K       +   A + G     +    + 
Sbjct: 140 IYGKTASMVASDAWLIAIASLICVVICVGLFKEFKLLCFDEAFAGSRGYPVVLLDAALMS 199

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           +  ++  + ++ +G+ L+ +LL++P  +AR ++     M +L++ IG++G ++G   S +
Sbjct: 200 VVVVITIIGLQAVGLVLVIALLVIPAASARFWTDRLVWMMVLSSAIGMVGCLVGAAASAM 259

Query: 236 FD-TPSGPSIIITSLFLFILSFFYK 259
               PSG  I++T+   F++SFF  
Sbjct: 260 LPRLPSGAMIVLTTGVGFLISFFVG 284


>gi|24112750|ref|NP_707260.1| Iron transport protein [Shigella flexneri 2a str. 301]
 gi|30063296|ref|NP_837467.1| Iron transport protein [Shigella flexneri 2a str. 2457T]
 gi|74312255|ref|YP_310674.1| iron transport protein inner membrane component [Shigella sonnei
           Ss046]
 gi|82544179|ref|YP_408126.1| iron transport protein, inner membrane component [Shigella boydii
           Sb227]
 gi|82776738|ref|YP_403087.1| iron transport protein, inner membrane component [Shigella
           dysenteriae Sd197]
 gi|187732346|ref|YP_001880200.1| iron/manganese transport system inner membrane protein SitC
           [Shigella boydii CDC 3083-94]
 gi|194431911|ref|ZP_03064201.1| iron/manganese transport system inner membrane protein SitC
           [Shigella dysenteriae 1012]
 gi|221218516|ref|YP_002527474.1| ABC transport system, inner membrane component SitC [Escherichia
           coli]
 gi|300922993|ref|ZP_07139064.1| ABC 3 transport family protein [Escherichia coli MS 182-1]
 gi|301020544|ref|ZP_07184626.1| ABC 3 transport family protein [Escherichia coli MS 69-1]
 gi|307138022|ref|ZP_07497378.1| ABC transport system, inner membrane component SitC [Escherichia
           coli H736]
 gi|309788922|ref|ZP_07683517.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 1617]
 gi|331641945|ref|ZP_08343080.1| iron transport protein, inner membrane component [Escherichia coli
           H736]
 gi|24051674|gb|AAN42967.1| Iron transport protein [Shigella flexneri 2a str. 301]
 gi|29367045|gb|AAM95576.1| inner membrane permease [Shigella flexneri]
 gi|30041548|gb|AAP17276.1| Iron transport protein [Shigella flexneri 2a str. 2457T]
 gi|73855732|gb|AAZ88439.1| iron transport protein inner membrane component [Shigella sonnei
           Ss046]
 gi|81240886|gb|ABB61596.1| iron transport protein, inner membrane component [Shigella
           dysenteriae Sd197]
 gi|81245590|gb|ABB66298.1| iron transport protein, inner membrane component [Shigella boydii
           Sb227]
 gi|187429338|gb|ACD08612.1| iron/manganese transport system inner membrane protein SitC
           [Shigella boydii CDC 3083-94]
 gi|194419819|gb|EDX35898.1| iron/manganese transport system inner membrane protein SitC
           [Shigella dysenteriae 1012]
 gi|215252844|gb|ACJ63503.1| ABC transport system, inner membrane component SitC [Escherichia
           coli]
 gi|281600783|gb|ADA73767.1| Inner membrane permease [Shigella flexneri 2002017]
 gi|300398650|gb|EFJ82188.1| ABC 3 transport family protein [Escherichia coli MS 69-1]
 gi|300420722|gb|EFK04033.1| ABC 3 transport family protein [Escherichia coli MS 182-1]
 gi|308923193|gb|EFP68705.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 1617]
 gi|313649310|gb|EFS13743.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri 2a str. 2457T]
 gi|315300063|gb|EFU59301.1| ABC 3 transport family protein [Escherichia coli MS 16-3]
 gi|320178014|gb|EFW52996.1| Manganese ABC transporter, inner membrane permease protein SitC
           [Shigella boydii ATCC 9905]
 gi|320187633|gb|EFW62313.1| Manganese ABC transporter, inner membrane permease protein SitC
           [Shigella flexneri CDC 796-83]
 gi|323172837|gb|EFZ58469.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli LT-68]
 gi|323942223|gb|EGB38395.1| ABC 3 transporter [Escherichia coli E482]
 gi|331038743|gb|EGI10963.1| iron transport protein, inner membrane component [Escherichia coli
           H736]
 gi|332091181|gb|EGI96270.1| chelated iron transport system membrane protein yfeC [Shigella
           boydii 5216-82]
 gi|332098346|gb|EGJ03319.1| chelated iron transport system membrane protein yfeC [Shigella
           dysenteriae 155-74]
 gi|332757083|gb|EGJ87424.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri 2747-71]
 gi|332757727|gb|EGJ88057.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-671]
 gi|333003124|gb|EGK22674.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri VA-6]
 gi|333003585|gb|EGK23124.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-218]
 gi|333004548|gb|EGK24073.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-272]
 gi|333018096|gb|EGK37400.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-227]
 gi|333018466|gb|EGK37763.1| chelated iron transport system membrane protein yfeC [Shigella
           flexneri K-304]
          Length = 285

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLIIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|197284902|ref|YP_002150774.1| iron ABC transporter [Proteus mirabilis HI4320]
 gi|227355304|ref|ZP_03839705.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Proteus mirabilis ATCC 29906]
 gi|194682389|emb|CAR42235.1| iron ABC transporter, membrane protein [Proteus mirabilis HI4320]
 gi|227164528|gb|EEI49399.1| iron ABC superfamily ATP binding cassette transporter, membrane
           protein [Proteus mirabilis ATCC 29906]
          Length = 285

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 126/256 (49%), Gaps = 1/256 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F  RA+ + + I ++   L C+++ +  +  GD I+H+ L GV L+ +  +PLTI  
Sbjct: 13  QYPFMQRAIIAAVIIGIACAILSCYMVLKGWSLMGDAISHAVLPGVVLAYVTAIPLTIGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F+     S     ++++  +  D ++G++     ++ LVI + +   +  L   LFG+IL
Sbjct: 73  FLSGLFCSFATGYLKEHSRIKEDTVMGIVFSGMFAVGLVIFASV-DTDQHLMHILFGNIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +    ++ I  I  + I I+    K  +    +   A+  G+    +    + I +L I
Sbjct: 132 GITPDVLIQISAICLITITIMLVKQKDFMLYCFDPNQARIVGLPVALLHYGLLSILALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P +TA   + S   M  LA +  ++  +IG + S   D  +G
Sbjct: 192 VASMQAVGIILVVAMLISPGITAYLLTRSFSRMITLAILFSVISSVIGTFISFHIDGATG 251

Query: 242 PSIIITSLFLFILSFF 257
           PSI++T    FI++  
Sbjct: 252 PSIVLTQAVFFIIALL 267


>gi|330448497|ref|ZP_08312145.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492688|dbj|GAA06642.1| fecCD transport family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 297

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 128/256 (50%), Gaps = 1/256 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              + + A++    I      L C+++ +  +  GD ++HS + GVA + +  LP +   
Sbjct: 9   QYSYMLNAMWVSALIGGVCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMIGLPFSFGA 68

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F+   L +  +L + +   L  DAI+G+I  S   L L ++S     + ++ + + G+IL
Sbjct: 69  FLSGGLAAAGMLFLSQQSKLKEDAIIGLIFTSFFGLGLFLISLFP-TSVNIQTIVMGNIL 127

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A+  TD L I  IG  ++++L   W+  +    +   AK  G+ P  +K++F  I S   
Sbjct: 128 AITPTDTLQIVLIGCTSLLLLIIKWRDFMVVFFDENHAKTIGLSPNLLKILFFSILSACT 187

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  L+ +++++P  TA   S     + IL+  IG++  ++G Y S   +  +G
Sbjct: 188 VAALQTVGAFLVIAMVVIPGATAYLLSDRFSTVIILSMFIGVISALLGAYLSYFINGATG 247

Query: 242 PSIIITSLFLFILSFF 257
             I++     FI +FF
Sbjct: 248 GIIVLLQTVFFISAFF 263


>gi|87303310|ref|ZP_01086103.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           WH 5701]
 gi|87282205|gb|EAQ74166.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           WH 5701]
          Length = 280

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 62/255 (24%), Positives = 128/255 (50%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F +RAL   I +    G L CF+  +  A  GD ++H+ + GV ++    LP  +  F+
Sbjct: 15  DFMVRALLVSILVSCVCGLLSCFMTLKGWALMGDAVSHAVMPGVVIAYALNLPFAVGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               +  V+  I++   +  D ++G++     +L L ++S ++    DL+  LFG++L +
Sbjct: 75  FGVGSVAVIGYIKQMTRIKEDTVIGLVFTGFFALGLTLISKVR-STIDLSHILFGNVLGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +++DIL    I  L + +L    + L+    +   A++ G+    +  + + + SL    
Sbjct: 134 SSSDILQTVVISLLVLTVLMVFRRDLILFCFDPTHARSIGINTGVLHYLLLSMLSLAAVA 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            ++ +GI L+ ++L+ P  TA   +   + M  +A +  +L  ++G+Y S   D  +   
Sbjct: 194 GLQTVGIILVVAMLVTPGATAYLLTDRFDRMVWIAILSAVLSSVLGIYWSYWMDASTAGC 253

Query: 244 IIITSLFLFILSFFY 258
           I++    LF+LSF +
Sbjct: 254 IVLVQTGLFLLSFLF 268


>gi|19745582|ref|NP_606718.1| integral membrane protein MtsC [Streptococcus pyogenes MGAS8232]
 gi|94989882|ref|YP_597982.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10270]
 gi|19747706|gb|AAL97217.1| integral membrane protein MtsC [Streptococcus pyogenes MGAS8232]
 gi|94543390|gb|ABF33438.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10270]
          Length = 284

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 147/259 (56%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + ++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|145628714|ref|ZP_01784514.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 22.1-21]
 gi|144979184|gb|EDJ88870.1| iron (chelated) ABC transporter permease protein [Haemophilus
           influenzae 22.1-21]
          Length = 271

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 128/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + + + +    L C+++ +  +  GD I+H+ L G+ L+ +  +PL I  F 
Sbjct: 12  EFMQNALLTALIVSIICALLSCYLVLKGWSLMGDAISHAVLPGIVLAYLAGIPLAIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                SL +  +++N  +  D  +G++     ++ LV+ + ++     L+  LFG++L V
Sbjct: 72  SGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFAIGLVMFTKIQ-TEQHLSHILFGNVLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  +++    I  +   ++    K  L    +   A+  G+ P+ +    +M+ +L I  
Sbjct: 131 SHQELIQSAVISAIIFCLIVFKRKDFLLYCFDPNHARVAGLSPKILHYGLLMLLALTIVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   + S + M  +A I  I   IIG+  S  FD  +G  
Sbjct: 191 TMQVVGVILVVAMLIAPGITALTLTKSFDKMLWIAIISSITSSIIGVILSYHFDASTGAC 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+     F+++  Y K
Sbjct: 251 IILLQAAFFVIALAYSK 267


>gi|268592557|ref|ZP_06126778.1| metal ion ABC transporter, permease protein [Providencia rettgeri
           DSM 1131]
 gi|291311969|gb|EFE52422.1| metal ion ABC transporter, permease protein [Providencia rettgeri
           DSM 1131]
          Length = 296

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 130/256 (50%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F I+A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YDFMIKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  I+    L  DA++G I  +  +   +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGILAALAMTLIKHLTRLREDAVIGFIFSTFFAAG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  +D+L +  I  ++ ++L  +WK LLA   +   A++ G+ P ++K+IF  + S    
Sbjct: 130 IADSDVLQVEIIIGISFIVLLCLWKDLLAVFFDESHARSIGLNPLRLKIIFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +   + + I++  IG +   +G Y S   +  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDQFKRLLIISVTIGTVTSAVGAYISYFLNGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 LIVTLQTIIFLLAFFF 265


>gi|154508220|ref|ZP_02043862.1| hypothetical protein ACTODO_00714 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797854|gb|EDN80274.1| hypothetical protein ACTODO_00714 [Actinomyces odontolyticus ATCC
           17982]
          Length = 304

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 131/255 (51%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   L  G +G  ++ + +A+ GD +AHS   G+A++ +    L +   +
Sbjct: 34  AFLPRALLIAVVAALVCGSVGVHVVLRGMAFIGDAVAHSVFPGLAIAFVCGGSLVLGGAL 93

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++  + +N  L  D+++GV+     +L + I++        L  FLFG I  +
Sbjct: 94  AGVVTAVLVALLAQNRRLKEDSVIGVLFVGAFALGVAIIARAPGYAGSLQDFLFGSITGI 153

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ ++       +++LF   + ++A T++ E A+A G+      L   +  +L + +
Sbjct: 154 PASDVPVVLAGALFVLLMLFLAHRAIVAVTLDRESARAAGVHVLLADLSLYVAVALAVVI 213

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P  TAR        M IL+  +G  G ++GLY S   D P+G +
Sbjct: 214 SVQTIGNVLVLALLVTPAATARLLCDRLGTMLILSPALGASGGLVGLYLSWALDVPTGAT 273

Query: 244 IIITSLFLFILSFFY 258
           I++     F+L++ +
Sbjct: 274 IVLVLTACFVLAWVF 288


>gi|315647083|ref|ZP_07900196.1| ABC-3 protein [Paenibacillus vortex V453]
 gi|315277285|gb|EFU40614.1| ABC-3 protein [Paenibacillus vortex V453]
          Length = 288

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 67/258 (25%), Positives = 136/258 (52%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF  RA ++G  I +    LG F++ +R     DT++H +L GVAL    +L   +  F
Sbjct: 6   YEFMQRAFWAGGLIGIIGPVLGVFLMLRRQVLMADTLSHVSLAGVALGSFLKLNPALSGF 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            IA + +LV+ Q+++     S+  + +I  S ++LA+V++S  + ++   +S+LFG I+A
Sbjct: 66  AIAIMGALVIEQLRRVYRTYSEVPVAIIMTSGLALAVVLMSLNQNLSKSFSSYLFGSIVA 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+   + LI  +  + ++    + +PL     + E A   G +   +  +F + T + ++
Sbjct: 126 VSDMQLRLIAVVAAVGVLFFVGLRRPLYTFAFDEETAAVSGTRVSLLSFLFAVFTGMTVA 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++  +G+ L+++L++LP   A R +        +A  +G+ G+  GL  S   +TP G 
Sbjct: 186 AAMPVVGVLLVSALIVLPASIALRIAPGFIAAMGIAVAVGLSGVFSGLTASYYLNTPPGG 245

Query: 243 SIIITSLFLFILSFFYKK 260
           +I +  L   +++  ++K
Sbjct: 246 TIALILLGFLMIAVIFQK 263


>gi|227517532|ref|ZP_03947581.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227554654|ref|ZP_03984701.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|307274242|ref|ZP_07555447.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|307278332|ref|ZP_07559411.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|227075004|gb|EEI12967.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis TX0104]
 gi|227176227|gb|EEI57199.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecalis HH22]
 gi|306505083|gb|EFM74274.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0860]
 gi|306509067|gb|EFM78132.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX0855]
 gi|315025640|gb|EFT37572.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX2137]
 gi|315168480|gb|EFU12497.1| metal ion ABC transporter, permease protein [Enterococcus faecalis
           TX1341]
          Length = 292

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 26  FLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 85

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 86  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 144

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 145 DIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAMGMNVNFYHYLLMVLLTLVAVTA 204

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 205 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSSI 264

Query: 245 IITSLFLFILSFFYK 259
           ++T+  LF++SF   
Sbjct: 265 VLTAASLFVISFLIS 279


>gi|159184796|ref|NP_354525.2| ABC transporter, membrane spanning protein (zinc) [Agrobacterium
           tumefaciens str. C58]
 gi|159140084|gb|AAK87310.2| ABC transporter, membrane spanning protein (zinc) [Agrobacterium
           tumefaciens str. C58]
          Length = 272

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 141/257 (54%), Positives = 212/257 (82%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M+++FF+RA+ +GIG+ L+ GPLGCF++W+R+AYFGDT+AHSALLGVALSL+ QL L + 
Sbjct: 1   MFDDFFVRAMVAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLLLQLNLIVS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A+  S++L+ +Q+ +ALSSDA+LG+++HS +++ LVI++FM WV  DL SFLFGDI
Sbjct: 61  VFLVASAVSILLIFLQRRQALSSDALLGILSHSALAIGLVIVAFMSWVRIDLVSFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +DI LIWG G + I+ +  +W+ LLA+TVN ELA+AEG+ PE+ KLIF ++ +L+
Sbjct: 121 LAVTRSDIALIWGGGLVVIVSMVFLWRSLLASTVNTELAEAEGLNPERSKLIFTLLMALV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P  TARRFS++PE MA++A++IG + ++ GL+GSL +DTPS
Sbjct: 181 IAIAMKVVGIMLITSLLIIPAATARRFSSTPEVMAVVASLIGAVAVVGGLFGSLTYDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ ++ LF++S  
Sbjct: 241 GPSIVVAAVILFVISLL 257


>gi|89072901|ref|ZP_01159458.1| hypothetical protein SKA34_05340 [Photobacterium sp. SKA34]
 gi|89051423|gb|EAR56878.1| hypothetical protein SKA34_05340 [Photobacterium sp. SKA34]
          Length = 296

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 66/257 (25%), Positives = 124/257 (48%), Gaps = 1/257 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              + I A++    I      L C+++ +  +  GD ++HS + GVA + +  LP +   
Sbjct: 9   LYSYMINAMWVSALIGGVCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMIGLPFSFGA 68

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F    L +  +L + +   L  DAI+G+I  +   L L ++S       ++ + + G+IL
Sbjct: 69  FFSGGLAAAGMLFLSQRSKLKEDAIIGLIFTAFFGLGLFLVSLYP-SAVNIQTIVMGNIL 127

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A+   D L I  IGFL+++IL   W+  +    +   AK  G+ P  +K++F  I S   
Sbjct: 128 AITPIDTLQIVIIGFLSLLILCVKWRDFMVVFFDENHAKTIGLSPTFLKIVFFSILSAST 187

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             ++K +G  L+ +++++P  TA   S     + I +  IG+    +G Y S   +  +G
Sbjct: 188 VAALKTVGAFLVIAMVVIPGATAYLLSDRFSIVIIYSVFIGVFSAFLGAYLSYFINGATG 247

Query: 242 PSIIITSLFLFILSFFY 258
             I++     F L+F +
Sbjct: 248 GIIVLLQTVFFALAFIF 264


>gi|37679220|ref|NP_933829.1| zinc ABC transporter, permease protein [Vibrio vulnificus YJ016]
 gi|37197963|dbj|BAC93800.1| zinc ABC transporter, permease protein [Vibrio vulnificus YJ016]
          Length = 275

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 177/254 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI L  GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 17  EFLLPSLLAGLGIALIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYLALIV 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + ++SD +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 77  CCLALAVILVTLQKQQLVASDTLLGILAHSALSIGLVAVSFLDNVRVDLMSYLFGDLLAV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L I+         L+  W+PLL+TTVN ELA  EG   + I+LI +++  ++I+V
Sbjct: 137 SPQDLLFIYAGVAAVGATLYLFWRPLLSTTVNEELAAVEGTNIDLIRLILMLMVGIVIAV 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P   ARRF+ SPE MA  A++IG+L ++ GL  S  FDTP+GPS
Sbjct: 197 GMKFVGALIMTSLLIIPAAAARRFAQSPEQMAGFASLIGVLAVLGGLTLSWHFDTPAGPS 256

Query: 244 IIITSLFLFILSFF 257
           ++I++  +F+L+  
Sbjct: 257 VVISATAIFMLAQL 270


>gi|254526155|ref|ZP_05138207.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9202]
 gi|221537579|gb|EEE40032.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9202]
          Length = 290

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 62/249 (24%), Positives = 123/249 (49%), Gaps = 1/249 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + + F  +AL     +    G L  ++  +  A  GD ++HS + GV ++    LP ++ 
Sbjct: 17  LTHNFMRKALLMSSLVAAVCGFLSSYLTLKGWALMGDAVSHSVMPGVVVAYALGLPFSLG 76

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  I++   +  D ++G++     +L +V++S +K  N DL S LFG  
Sbjct: 77  AFIFGVGSVALIGFIKQKSRVKEDTVIGLVFTGFFALGIVLVSKIK-SNIDLHSILFGSP 135

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I  L +++L    K L+    +   AK  G+    +  + +   SL 
Sbjct: 136 LGISLSDVKQTIFISLLVVILLSIFRKDLMLYCFDPRHAKTVGINVLFLHYLLLTCLSLA 195

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             V ++ +GI L+ ++LI P  TA   +   +NM +++ +  I+  +IG+Y S  FD  +
Sbjct: 196 AVVGLQSVGIILVVAMLITPGATAFLLTDKFDNMTVISVLSAIISSLIGIYVSFWFDLET 255

Query: 241 GPSIIITSL 249
           G SI++   
Sbjct: 256 GGSIVLAQT 264


>gi|159903588|ref|YP_001550932.1| ABC transporter [Prochlorococcus marinus str. MIT 9211]
 gi|159888764|gb|ABX08978.1| ABC transporter component, possibly Mn transport [Prochlorococcus
           marinus str. MIT 9211]
          Length = 289

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 63/258 (24%), Positives = 129/258 (50%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + +EF  +AL     +    G L C++  +  A  GD ++H+ + GV ++    LP ++ 
Sbjct: 18  LTHEFMRKALMVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYALGLPFSLG 77

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  +++   +  D ++G++     +L LV++S +K  N DL   LFG  
Sbjct: 78  AFVFGVGSVALIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKIK-SNIDLMHILFGSP 136

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++ +D+     I FL + IL    + L+    +   A++ G+    +  + + + SL 
Sbjct: 137 LGISNSDVTQTIIISFLVVAILLIFRRDLMLYCFDATHARSIGINTGLLHYLLLSVLSLA 196

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
               ++ +GI L+ ++LI P  TA   +   + M +LA I   +  I+G+Y S   D  +
Sbjct: 197 AVAGLQTVGIILVVAMLITPGATAYLLTDRFDRMTLLAVISSSISSILGVYISYWSDIET 256

Query: 241 GPSIIITSLFLFILSFFY 258
           G SI++    +F+++F +
Sbjct: 257 GGSIVLVQTLIFLIAFLF 274


>gi|15674575|ref|NP_268749.1| ABC transporter permease [Streptococcus pyogenes M1 GAS]
 gi|71903025|ref|YP_279828.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS6180]
 gi|71910183|ref|YP_281733.1| manganese transporter membrane protein [Streptococcus pyogenes
           MGAS5005]
 gi|94988004|ref|YP_596105.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS9429]
 gi|94991887|ref|YP_599986.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS2096]
 gi|5932386|gb|AAD56938.1|AF180520_3 integral membrane protein MtsC [Streptococcus pyogenes]
 gi|13621683|gb|AAK33470.1| ABC transporter (permease protein) [Streptococcus pyogenes M1 GAS]
 gi|71802120|gb|AAX71473.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS6180]
 gi|71852965|gb|AAZ50988.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS5005]
 gi|94541512|gb|ABF31561.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS9429]
 gi|94545395|gb|ABF35442.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS2096]
          Length = 284

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|139474303|ref|YP_001129019.1| metal cation ABC transporter membrane protein [Streptococcus
           pyogenes str. Manfredo]
 gi|134272550|emb|CAM30816.1| metal cation ABC transporter membrane protein [Streptococcus
           pyogenes str. Manfredo]
          Length = 284

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|312882122|ref|ZP_07741872.1| ABC-type Mn2+/Zn2+ transport system, permease component [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370258|gb|EFP97760.1| ABC-type Mn2+/Zn2+ transport system, permease component [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 261

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 107/252 (42%), Positives = 177/252 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +LF+G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSLFAGLGIACIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDINLYLALTI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK   +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVILVTLQKQRLVATDTLLGILAHSALSLGLVSVSFLDDVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I+    +   ++   W+ LL+TTVN ELA  EG   + ++LI +++  L+I++
Sbjct: 123 TPGDLIYIYLGAAVIGFVMLIFWRSLLSTTVNEELAAVEGHNTDLMRLILMLMVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TARRF+ +PE MA+LA+ +G L +I+GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARRFANTPEQMALLASALGSLSVILGLALSWHFDTPAGPS 242

Query: 244 IIITSLFLFILS 255
           +++++  LF+LS
Sbjct: 243 VVLSAAALFLLS 254


>gi|239630272|ref|ZP_04673303.1| ABC-type Mn2//Zn2/ transport system protein [Lactobacillus
           paracasei subsp. paracasei 8700:2]
 gi|239527884|gb|EEQ66885.1| ABC-type Mn2//Zn2/ transport system protein [Lactobacillus
           paracasei subsp. paracasei 8700:2]
          Length = 294

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 140/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 10  YDFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGAS 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + +L++  +  N  + +D  +GV+  +  +L  +++S  +   T+L   LFG+ILA
Sbjct: 70  VFGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILISMAE-SATNLHHILFGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +DI+    +  + I+ +   +K LL T+ +   AK  G+    I    +++ +L+  
Sbjct: 129 VSDSDIVTTAVVLGIVILFVVLFYKELLITSFDNTFAKTYGLNTTMIHYALMLVLTLVTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++   E   I +  +G+   I GLY S  F+  SGP
Sbjct: 189 SALQTVGIILVVAMLITPAATAFLWTDRLETTLITSASVGVFSAITGLYFSFTFNWASGP 248

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF +SF + 
Sbjct: 249 AIVLVAAVLFAISFVFS 265


>gi|50913740|ref|YP_059712.1| manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10394]
 gi|50902814|gb|AAT86529.1| Manganese transport system membrane protein [Streptococcus pyogenes
           MGAS10394]
          Length = 284

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I ++   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILRVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIVFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|296111109|ref|YP_003621490.1| manganese ABC transporter, permease protein [Leuconostoc kimchii
           IMSNU 11154]
 gi|295832640|gb|ADG40521.1| manganese ABC transporter, permease protein [Leuconostoc kimchii
           IMSNU 11154]
          Length = 281

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 70/259 (27%), Positives = 143/259 (55%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + + 
Sbjct: 12  MQYNFLQTALITSILVGIMSGIIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINILLG 71

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L +L++  +     L +D  +G++  +  +L  +++S +    T+L   LFG++
Sbjct: 72  ASVFGILAALLIGLVTLKSKLKNDTAIGIVFSAFFALGFILIS-LAESATNLHHILFGNV 130

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D++    +  + ++ +   +K LL T+ +   AKA G++ + +    +++ +L+
Sbjct: 131 LAVSDNDLITTAIVLAIVLIFVVVFYKELLITSFDNTFAKAYGLKTQLMHYALMLVLTLV 190

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI LI ++LI P  TA   +    +M I+A I  ++  +IGLY S  F+  S
Sbjct: 191 TVTALQTVGIILIVAMLITPAATAYLLTNRLSHMMIVAAIFSVISSVIGLYMSYTFNWAS 250

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP+I++T+   F L+F + 
Sbjct: 251 GPAIVLTAAVFFSLAFLFS 269


>gi|146309512|ref|YP_001189977.1| ABC-3 protein [Pseudomonas mendocina ymp]
 gi|145577713|gb|ABP87245.1| ABC-3 protein [Pseudomonas mendocina ymp]
          Length = 262

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 107/245 (43%), Positives = 175/245 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F I AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL L+  +  T+ +
Sbjct: 1   MPDFLINALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGLMLDVNPTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++ HST+SL LV+LSFM+ V  DL  +LFGD+L
Sbjct: 61  TVGCVLLAVLLVTLQQRQPLASDTLLGILAHSTLSLGLVVLSFMQEVRIDLMGYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+ +D+  I G   L + +L  +W+PLLA TV+ ELA+ EG+    I+L  +++ +++I
Sbjct: 121 AVSPSDLAWIIGGSALVLALLTWLWRPLLAITVHEELARVEGLPVAAIRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + +PE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARTPEQMAVGASLLGLVAVCAGLAMSWYQDTPAG 240

Query: 242 PSIII 246
           PSI++
Sbjct: 241 PSIVV 245


>gi|16766170|ref|NP_461785.1| permease [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|167994172|ref|ZP_02575264.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230929|ref|ZP_02655987.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194469128|ref|ZP_03075112.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197251687|ref|YP_002147763.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|5231097|gb|AAD41068.1|AF128999_4 SitD [Salmonella enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|16421410|gb|AAL21744.1| fur regulated Salmonella iron transporter [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|194455492|gb|EDX44331.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197215390|gb|ACH52787.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205327933|gb|EDZ14697.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334567|gb|EDZ21331.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|261248000|emb|CBG25833.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267994990|gb|ACY89875.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159424|emb|CBW18942.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312913882|dbj|BAJ37856.1| chelated iron ABC transporter permease protein YfeD [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321223413|gb|EFX48479.1| Manganese ABC transporter, inner membrane permease protein SitD
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323131216|gb|ADX18646.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332989736|gb|AEF08719.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 282

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 115/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI +F Y
Sbjct: 252 IVVLFAIVFIAAFIY 266


>gi|82702359|ref|YP_411925.1| hypothetical protein Nmul_A1230 [Nitrosospira multiformis ATCC
           25196]
 gi|82410424|gb|ABB74533.1| ABC-3 protein [Nitrosospira multiformis ATCC 25196]
          Length = 301

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 75/257 (29%), Positives = 140/257 (54%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EFF   L + + +  S G +G  +I + ++Y G  ++H+A  G  +  I  L       
Sbjct: 11  YEFFWHGLLATLMVGASCGLIGALVILRGMSYVGHGLSHAAFGGAVVGFILNLNFYAGAG 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +  L  L++ +I ++  +  DA +G++T++  +L + I+S ++  +    + LFG+IL 
Sbjct: 71  AMGLLAVLLINRITRSGTIKLDAAIGIVTNAMFALGVAIISQVRAFSQSFEAALFGNILG 130

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+LLI  +    +  +F +++PLL +T + E A+  G++   ++LIF ++ +L+I 
Sbjct: 131 ITEGDLLLIGFVSLSTLTTMFLMYRPLLFSTFDQEAARVFGIRTASVQLIFSLLLTLIII 190

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+  +G+T+I + LI P  TAR  +     M I A IIG    + G+Y S IF+T SG 
Sbjct: 191 ASMNVVGVTMIAATLITPAATARLMTDCFSRMLIYALIIGGTTGVAGMYLSYIFNTASGA 250

Query: 243 SIIITSLFLFILSFFYK 259
           +I++    L+ LS+   
Sbjct: 251 TIVLFGASLYCLSWLIN 267


>gi|298346280|ref|YP_003718967.1| iron (Fe3+) ABC transporter membrane protein [Mobiluncus curtisii
           ATCC 43063]
 gi|304389955|ref|ZP_07371912.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315657206|ref|ZP_07910090.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|298236341|gb|ADI67473.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mobiluncus curtisii ATCC 43063]
 gi|304326848|gb|EFL94089.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315492309|gb|EFU81916.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 297

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 122/255 (47%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F +R +            L C+++    +  GD ++H+ L G+ +S +   P  I   +
Sbjct: 14  QFMLRGIIVTGVAAAVCAVLSCWLVLIGWSLLGDALSHAILPGIVVSYLLGTPFAIGALV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   ++  ++    +  D  +GV+  +  +  LV++S     + DL   LFGD+L +
Sbjct: 74  AALLVVGLIGAVRGRGRVKEDTAIGVVFTTMFASGLVLISLFP-SHIDLHHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+  +  +  L +++L    + L+    +   A A G+    +  + ++  SL + V
Sbjct: 133 TRADMWQVLILSPLALVLLLYKKRDLVLYAFDKTHAHAIGISTSWLATLLLVALSLTVVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +L+I P  TAR  +     M  +A ++ +  +++G Y S  FDT SG +
Sbjct: 193 AMQAVGAILIVALVITPGATARLLTNRFNAMLWIAPLLSVSCVVLGAYISYWFDTASGAT 252

Query: 244 IIITSLFLFILSFFY 258
           +++    LF++ +  
Sbjct: 253 VVLLEGVLFLIVWLV 267


>gi|253702313|ref|YP_003023502.1| ABC transporter [Geobacter sp. M21]
 gi|251777163|gb|ACT19744.1| ABC-3 protein [Geobacter sp. M21]
          Length = 441

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 57/265 (21%), Positives = 124/265 (46%), Gaps = 11/265 (4%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLI----------FQ 54
           +F +AL  G  + L +G +G  ++ +R+A+ GD ++H+ + GVA   +          + 
Sbjct: 16  YFQKALIGGCAVALVSGAVGSLVVLRRMAFLGDALSHAMIAGVAGGYLAMKLLFGVEAYA 75

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV-NTDLT 113
             + +   + A +T  ++  + K   +  D ++G++     +L +V++S  +   + DL 
Sbjct: 76  PAMLLGSLIAAIITVALIGVVSKVSRVKEDTVIGIMYTGVFALGVVVVSIFREYIHIDLM 135

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            F+ GDIL V  TD+     +    + +L   ++     + +  +A + G+    +    
Sbjct: 136 HFIMGDILGVADTDLWASAIVSASVLTVLILFFRHFQVASFDPIMAASTGLPVLLLDYAL 195

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
               S+++  ++  +G+ L+  LLI P  TA   S   + M  LA++ G+  +I GLY  
Sbjct: 196 TGCVSMVVVSAVSMVGVILVVGLLITPAATAYLLSDRLDKMMALASLFGVTSVIGGLYLC 255

Query: 234 LIFDTPSGPSIIITSLFLFILSFFY 258
           +  D+  G ++++     F+     
Sbjct: 256 VWLDSAGGGAVMLFCTLQFLAVLVV 280


>gi|191639351|ref|YP_001988517.1| Hydrophobic membrane protein [Lactobacillus casei BL23]
 gi|190713653|emb|CAQ67659.1| Hydrophobic membrane protein [Lactobacillus casei BL23]
 gi|327383439|gb|AEA54915.1| ABC-3 protein [Lactobacillus casei LC2W]
 gi|327386627|gb|AEA58101.1| ABC-3 protein [Lactobacillus casei BD-II]
          Length = 298

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 14  YDFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGAS 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + +L++  +  N  + +D  +GV+  +  +L  +++S  +   T+L   LFG+ILA
Sbjct: 74  VFGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILISMAE-SATNLHHILFGNILA 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +DI+    +  + I+ +   +K LL T+ +   AK  G+    I    +++ +L+  
Sbjct: 133 VSDSDIVTTAVVLGIVILFVVLFYKELLITSFDNTFAKKYGLNTTMIHYALMLVLTLVTV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++   E M I +  +G+   I GLY S  F+  SGP
Sbjct: 193 SALQTVGIILVVAMLITPAATAFLWTDRLETMLITSASVGVFSAITGLYFSFTFNWASGP 252

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF +SF + 
Sbjct: 253 AIVLVAAVLFAISFVFS 269


>gi|229587651|ref|YP_002869770.1| high-affinity zinc ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229359517|emb|CAY46358.1| high-affinity zinc ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 262

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 110/259 (42%), Positives = 181/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVA+  +  +  TI +
Sbjct: 1   MADFLLYALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVAMGFLLDVSPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G     +++L  +W+PLLA TV+ ELA  EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSAAVLVLLVALWRPLLAITVHEELATVEGLPVPSLRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MAI A+++G+L +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAIGASLLGMLAVCGGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++T+  LF+LSF   +
Sbjct: 241 PSIVVTAAALFLLSFVLPR 259


>gi|317491789|ref|ZP_07950224.1| ABC 3 transporter [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920223|gb|EFV41547.1| ABC 3 transporter [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 261

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 174/257 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G  + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIAGALLALTAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFFAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L ++ L+ +++   L  D +LG++ HS +SL LV+++ M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLAIGLVWLERRPTLGVDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI++I     + + IL+  W+PLL+ T++ ELA  +G+  E++++I +++T+L I +
Sbjct: 123 TYNDIVMIAIGVAIVLGILWWQWRPLLSVTISPELAHVDGVNLERVRMILMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS +PE MA +A IIGIL +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRTPEQMASIAVIIGILAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  +FILS   K+
Sbjct: 243 VVLCATAMFILSLSKKQ 259


>gi|238909631|ref|ZP_04653468.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
          Length = 282

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 115/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL +  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAVGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI +F Y
Sbjct: 252 IVVLFAIVFIAAFIY 266


>gi|289208872|ref|YP_003460938.1| ABC transporter [Thioalkalivibrio sp. K90mix]
 gi|288944503|gb|ADC72202.1| ABC-3 protein [Thioalkalivibrio sp. K90mix]
          Length = 273

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 184/256 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F  RA+ +G+ +    GPLG F++W+R+AYFGDTI+HSALLGVAL  +    L + +
Sbjct: 6   LDDFLFRAVLAGLMVAAVAGPLGAFVVWRRMAYFGDTISHSALLGVALGFLLGTNLNLMV 65

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            ++    +++L+ +Q+ + L+SD +LG++ HS +SL +V ++F++ +  DL ++LFGDIL
Sbjct: 66  TIVCVAIAVLLVILQRRQELASDTLLGILAHSALSLGIVAVTFIEGLRVDLMAYLFGDIL 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV T D+L I   G + +++L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +L+I
Sbjct: 126 AVGTNDLLAIAIGGGIALLLLVLLWRPLLALTVHEELARVEGVPVLAVRLGLMLLIALVI 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + +++ +G+ LIT+L+I+P  +ARRF+++PE MA LA +IG+L +++G++GS  +DTP+G
Sbjct: 186 AAAMQVVGVLLITALMIIPAASARRFASTPEQMAFLAGVIGMLAVLVGVWGSFQYDTPTG 245

Query: 242 PSIIITSLFLFILSFF 257
           P+I++ ++  FIL   
Sbjct: 246 PTIVVAAMLGFILIHL 261


>gi|62181367|ref|YP_217784.1| iron transporter: fur regulated [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615771|ref|YP_001589736.1| hypothetical protein SPAB_03562 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168235899|ref|ZP_02660957.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194442214|ref|YP_002042108.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194736525|ref|YP_002115818.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|198242089|ref|YP_002216836.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200387136|ref|ZP_03213748.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204928322|ref|ZP_03219522.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|224584643|ref|YP_002638441.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|62129000|gb|AAX66703.1| iron transporter: fur regulated [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365135|gb|ABX68903.1| hypothetical protein SPAB_03562 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400877|gb|ACF61099.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194712027|gb|ACF91248.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197290661|gb|EDY30015.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197936605|gb|ACH73938.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199604234|gb|EDZ02779.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204322644|gb|EDZ07841.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|224469170|gb|ACN47000.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322614317|gb|EFY11248.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322621618|gb|EFY18471.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322624479|gb|EFY21312.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322628810|gb|EFY25593.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322633463|gb|EFY30205.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322635961|gb|EFY32669.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322639669|gb|EFY36354.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322646851|gb|EFY43354.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650619|gb|EFY47024.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322654768|gb|EFY51087.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658988|gb|EFY55241.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664445|gb|EFY60639.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322668306|gb|EFY64463.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322673714|gb|EFY69815.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322677775|gb|EFY73838.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322681395|gb|EFY77427.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322683797|gb|EFY79807.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322715851|gb|EFZ07422.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323193814|gb|EFZ79017.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323200284|gb|EFZ85366.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203213|gb|EFZ88242.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323205540|gb|EFZ90505.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323210051|gb|EFZ94954.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323216354|gb|EGA01081.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323221102|gb|EGA05533.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323226923|gb|EGA11105.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230793|gb|EGA14911.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323234856|gb|EGA18942.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323238895|gb|EGA22945.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323241595|gb|EGA25626.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323248258|gb|EGA32194.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251158|gb|EGA35031.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256042|gb|EGA39780.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323263176|gb|EGA46714.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264320|gb|EGA47826.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323271146|gb|EGA54574.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326624595|gb|EGE30940.1| iron transporter: fur regulated [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 282

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 114/255 (44%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI  F Y
Sbjct: 252 IVVLFAIVFIAVFIY 266


>gi|83643430|ref|YP_431865.1| Mn2+/Zn2+ ABC transporter permease [Hahella chejuensis KCTC 2396]
 gi|83631473|gb|ABC27440.1| ABC-type Mn2+/Zn2+ transport system, permease components [Hahella
           chejuensis KCTC 2396]
          Length = 263

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 106/253 (41%), Positives = 172/253 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  I AL  GIG+   TGPLGCF++W+R++YFGDT++HSAL+GVAL L+ ++ +++ I  
Sbjct: 3   DILIPALLGGIGLAFITGPLGCFVVWRRMSYFGDTLSHSALMGVALGLMLEVNVSLAITA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L  L L  +Q+ + +++D +LG++ HS++SL LV LSFM+    DL S+LFGD+LA+
Sbjct: 63  GCVLMGLTLALMQRQKHIATDTLLGILAHSSLSLGLVALSFMRDQQVDLMSYLFGDLLAL 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D++ I+      I++L  +W+ LL  T+N +LA  EG    + +L+ +++ SL+I++
Sbjct: 123 NYQDVIWIFAGAVAAIVMLKLLWRSLLMMTLNEDLAAVEGYNILRTQLLLMLMMSLVIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ L+TSLLI+P   AR FS +PE MA LA   G+  ++ GL  S  +DTP+GPS
Sbjct: 183 AMKVVGVLLVTSLLIIPAAAARPFSDTPEKMAALAIASGVFAVVAGLSLSWWWDTPAGPS 242

Query: 244 IIITSLFLFILSF 256
           +++ +  LF+ S 
Sbjct: 243 VVVAAFVLFLSSM 255


>gi|332686920|ref|YP_004456694.1| manganese ABC transporter inner membrane permease SitD
           [Melissococcus plutonius ATCC 35311]
 gi|332370929|dbj|BAK21885.1| manganese ABC transporter, inner membrane permease protein SitD
           [Melissococcus plutonius ATCC 35311]
          Length = 280

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 81/255 (31%), Positives = 144/255 (56%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 14  FLQNALITAIVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISFILGINFFIGAILF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITYIRGNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            TD  +  G+  + ++++F  +K LL T+ +  +AKA GM+      + +++ +L+   +
Sbjct: 133 DTDKWITIGVSIVVLLLIFLFFKELLITSFDPLMAKAMGMKVNFYHYLLMILLTLVAVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  L+  +G L  IIGL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPASTAYLYTNSLKVMIFLSATLGALASIIGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++TS   F++SFF  
Sbjct: 253 VLTSAVFFVISFFVS 267


>gi|168820445|ref|ZP_02832445.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205342921|gb|EDZ29685.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|320087268|emb|CBY97033.1| probable iron transport system membrane protein HI0359 [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 282

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 115/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALALAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI +F Y
Sbjct: 252 IVVLFAIVFIAAFIY 266


>gi|309791464|ref|ZP_07685969.1| ABC-3 protein [Oscillochloris trichoides DG6]
 gi|308226500|gb|EFO80223.1| ABC-3 protein [Oscillochloris trichoides DG6]
          Length = 275

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 59/257 (22%), Positives = 133/257 (51%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F    L +   + ++   LG +++ +R+A+ GD +AH+ L G+ ++ +    L     
Sbjct: 11  YSFMQTGLIAATLVGITCAVLGTYVVLRRMAFIGDALAHTVLPGLVVAYLGGWSLFGGAI 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   LT+L +  + +   +  D  +GV+  +  +L ++++S ++     L+  LFG+IL 
Sbjct: 71  IAGLLTALGIGWVSRRGTVREDTAIGVLFTAMFALGILLMSKVRSFRD-LSHILFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D++ I  I    +  L+ + K L  T+ +   A+  G++ ++++++ +++ +L + 
Sbjct: 130 VRPEDLIQISLISAGVLGTLWLLHKELELTSYDPTYAEVIGLKADRMRMLLLILLALTVV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             I+ +G+ L ++LL+ P   A   +T    M  +A +I +   ++GLY S   D  SG 
Sbjct: 190 TCIQVVGVILTSALLVTPAAAAALLTTRLPRMMFIAAMIAVGSALVGLYASYYADVASGA 249

Query: 243 SIIITSLFLFILSFFYK 259
           +I++T    F +++ + 
Sbjct: 250 AIVLTCTTCFGIAWGFN 266


>gi|284029968|ref|YP_003379899.1| ABC-3 protein [Kribbella flavida DSM 17836]
 gi|283809261|gb|ADB31100.1| ABC-3 protein [Kribbella flavida DSM 17836]
          Length = 288

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 62/254 (24%), Positives = 127/254 (50%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RA    +   +  G +G  +  + +A+ GD +AH+   G+A++ + Q  L +   + 
Sbjct: 13  FMQRAFLVVLMSGVVCGVIGSHVALRGMAFIGDAVAHAVFPGIAIAFVLQTSLVVGGVVA 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             +T+L +  + +N  L  D ++GV   +   L +V++S        L SFLFG +L ++
Sbjct: 73  GLITALAIAVVSQNRRLKEDTVIGVFFAAAFGLGIVVMSTAPGYGGSLESFLFGSVLGIS 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D++ +   G   ++I   + K  +   ++ E A++ G+    + +    + ++ I +S
Sbjct: 133 DRDVVTVAVAGAALLLISGALHKEFVTVGLDRETARSVGLPIFWLDMALYAMVTIAIVIS 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           I+ +G  L+ +LLI P   AR  +     M ++A  IG +  + GLY S  F+  +G  I
Sbjct: 193 IQAVGNILVLALLITPAACARLLTDRIGVMMLIAPAIGAVSGLTGLYLSYAFNLAAGGLI 252

Query: 245 IITSLFLFILSFFY 258
           ++T+  +F+  + +
Sbjct: 253 VLTATAVFVTCWVF 266


>gi|152986214|ref|YP_001351613.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PA7]
 gi|150961372|gb|ABR83397.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PA7]
          Length = 262

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 113/259 (43%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ +
Sbjct: 1   MADFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+L
Sbjct: 61  TVGCVLLAVLLVTLQQRQPLAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+ TD+L I     L + ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I
Sbjct: 121 AVSATDLLWIIAGSALVLALICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MAI A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAIGASLLGLVAVCAGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAGLFLLSFVLPR 259


>gi|302392293|ref|YP_003828113.1| ABC transporter [Acetohalobium arabaticum DSM 5501]
 gi|302204370|gb|ADL13048.1| ABC-3 protein [Acetohalobium arabaticum DSM 5501]
          Length = 282

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 135/258 (52%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RA   G  I +    +G F++ +R+A  G T++H AL G+AL +   +       
Sbjct: 7   YSFMQRAFIVGNIIGVICPLIGTFLVLKRLALIGHTLSHVALAGIALGMFLGVYPLYMAL 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +I+ + +L + ++++N    ++  L +I  + + +A +++  +   N+ + S+LFG I  
Sbjct: 67  IISIMAALSIEKLRQNYKDYAELSLSIILAAGLGIATILIGLIN-GNSGIFSYLFGSISL 125

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+  +  +G + I I+   +    A   N E A+  G+  + + ++F+++ S+ +S
Sbjct: 126 VTNQDLFTVLPLGIIIIGIIIYFYYGFFAIAFNEEEARLAGIPVKGLNILFMILVSVTVS 185

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +S++ IG  L++SL+ LP  T  + +TS ++    + I  +L + +GL  S   D   G 
Sbjct: 186 LSMRIIGGLLVSSLITLPVATGLQLATSFKDTIKYSIIFSLLAVNLGLIISFYQDLAPGG 245

Query: 243 SIIITSLFLFILSFFYKK 260
           +II+ S+   + +  YKK
Sbjct: 246 TIILISVVYLLGALGYKK 263


>gi|257464627|ref|ZP_05628998.1| chelated iron ABC transporter, permease [Actinobacillus minor 202]
 gi|257450287|gb|EEV24330.1| chelated iron ABC transporter, permease [Actinobacillus minor 202]
          Length = 276

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL  G+ + L    L C+++ +  +  GD I+H+ L G+ ++ +  +PL I  F+
Sbjct: 15  PFIQQALVIGVVVALICAVLSCYLVLKGWSLMGDAISHAVLPGIVIAYLLAIPLAIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  +  D ++G++     +L LV+ + ++  +  L   LFGD+L +
Sbjct: 75  SGIFCAVAVGYLKENSRIKEDTVMGIVFSGMFALGLVMFAKVE-TDQHLMHILFGDLLGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              +      I  + ++++    +  L    +   A+  G   + +    +++ +L+I  
Sbjct: 134 TDNEFYQTLAISLVVLLVILVKRRDFLLYCFDASHARTVGFNIKVLHYSLLVLLALVIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +T    +   + M ++A    +     G++ S  FD  +GP 
Sbjct: 194 AMQVVGVILVVAMLITPGITGYTLAKRFDRMLLIAIFTAVNSAFWGVFLSFHFDVATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F+++    +
Sbjct: 254 IVLLQAVGFLIALAISR 270


>gi|49082970|gb|AAT50885.1| PA5501 [synthetic construct]
          Length = 263

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 111/259 (42%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ +
Sbjct: 1   MADFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+L
Sbjct: 61  TVGCVLLAVLLVTLQQRQPLAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+ +D+L I     L + ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I
Sbjct: 121 AVSASDLLWIIAGSALVLALICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAGLFLLSFVLPR 259


>gi|89101032|ref|ZP_01173874.1| manganese ABC transporter (membrane protein) [Bacillus sp. NRRL
           B-14911]
 gi|89084264|gb|EAR63423.1| manganese ABC transporter (membrane protein) [Bacillus sp. NRRL
           B-14911]
          Length = 431

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/261 (22%), Positives = 123/261 (47%), Gaps = 10/261 (3%)

Query: 7   IRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----LTICI 61
              LF  + +  ++G LG   + ++ +  GD +AH+AL G+ ++ +         L I  
Sbjct: 8   QWVLFGTMLLGAASGVLGSIALLRKQSLIGDAVAHAALPGICIAFMLTGEKSLPALLIGA 67

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV----NTDLTSFLF 117
            +   L +  +  I  +  L  D+ + ++        +V+L+ +        + L  F+F
Sbjct: 68  AITGLLAAYCIQFITSSSILKEDSAICLVLSVFFGFGIVLLTKISQSPAGNKSGLDDFIF 127

Query: 118 GDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMIT 177
           G   ++  +D+ L+ G   + I++    +K L   T + + A+  G+    +  +F+ + 
Sbjct: 128 GQAASMVGSDVKLMAGASAVLIVVTLLFFKELKVLTFDPDFARGLGLPAGWLNFMFLTLL 187

Query: 178 SLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS-LIF 236
           +  + + I+ +G+ L+ ++LI P+V AR ++ S   M I++   G L  + G   S L  
Sbjct: 188 AGTVVIGIQAVGVILMAAMLITPSVAARYWTESLGKMVIISGGFGALSGMAGTLLSTLGQ 247

Query: 237 DTPSGPSIIITSLFLFILSFF 257
              +GP I++T+  LF+ S  
Sbjct: 248 GLATGPFIVVTATGLFLFSVL 268


>gi|271963868|ref|YP_003338064.1| hypothetical protein Sros_2341 [Streptosporangium roseum DSM 43021]
 gi|270507043|gb|ACZ85321.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021]
          Length = 277

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/258 (24%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL S + + L+   LG FI+ +R+A  GD I H AL GVAL  +      +    
Sbjct: 8   DFMQRALISALLVGLAAPALGTFIVQRRLALLGDGIGHVALTGVALGFLTGTAPVLTAVA 67

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDILA 122
           ++ L ++ +  ++     S D  L ++ +  I+  ++++S      N  L S+LFG I +
Sbjct: 68  VSVLGAVAIELVRARGRTSGDVALALLFYGGIAGGVLLISLAPGGSNATLMSYLFGSISS 127

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+T D+ +I  +    + ++    + L     + E+AKA G+    + L+  +  +L + 
Sbjct: 128 VSTQDVWVIGLLAVAVLGVVAFFGRELYVLCQDEEVAKASGLPVRFLSLLIAVTAALTVV 187

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           ++++ +G+ L+++L+++P  T+++ +    +   L+ + G++  + GL  S   + P G 
Sbjct: 188 IAMRVVGLLLVSALMVVPVATSQQLTRGFRSTMALSMLFGMISTVGGLTSSFYIEVPPGA 247

Query: 243 SIIITSLFLFILSFFYKK 260
            I+I +L  F+L+    +
Sbjct: 248 IIVIVALAGFVLALGLGR 265


>gi|218548580|ref|YP_002382371.1| high-affinity zinc transporter membrane component [Escherichia
           fergusonii ATCC 35469]
 gi|218356121|emb|CAQ88738.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia fergusonii ATCC 35469]
 gi|324113595|gb|EGC07570.1| ABC 3 transporter [Escherichia fergusonii B253]
 gi|325496998|gb|EGC94857.1| high-affinity zinc transporter membrane component [Escherichia
           fergusonii ECD227]
          Length = 261

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 98/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGVMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + IL   W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVIIVLGILCWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|157693009|ref|YP_001487471.1| ABC transporter ATP-binding protein [Bacillus pumilus SAFR-032]
 gi|157681767|gb|ABV62911.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Bacillus pumilus SAFR-032]
          Length = 286

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 67/266 (25%), Positives = 133/266 (50%), Gaps = 8/266 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVA--------LSLIFQ 54
            EF   A  +G+ I      LG FI+ +R++   D ++H +L G+A          L+  
Sbjct: 8   YEFLQNAFIAGMLIGFIAPLLGVFIVVRRLSLIADALSHVSLAGIAASLFLDKKFGLLTG 67

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTS 114
           +         +   SL + +++       +  + +I    I ++++ +S     NTDL S
Sbjct: 68  VSPLYLGMAFSVAGSLFIERLRSVYKHYQELAIPIILSGGIGISVIFISLANGFNTDLFS 127

Query: 115 FLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFI 174
           +LFG + AV+  D+ ++ GI  + ++++  ++K L   + + E AKA G+  + I  IFI
Sbjct: 128 YLFGSVSAVSRLDLWIVVGISLIVVLVVVLLYKELFLLSFDEEHAKASGISAKWIHFIFI 187

Query: 175 MITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL 234
           ++ +L+I+ S++ +G  L+++L+ LP   + R +   +    L+ + G L ++ GL  S 
Sbjct: 188 LVVALVIAASMRIVGTLLVSALMTLPVAASIRIAKGFKQAIFLSILFGELSVLAGLILSY 247

Query: 235 IFDTPSGPSIIITSLFLFILSFFYKK 260
             D   G +I++ S+ + I   F  K
Sbjct: 248 YLDLAPGGTIVMLSILILIGCIFIGK 273


>gi|312958173|ref|ZP_07772696.1| zinc transport system permease protein [Pseudomonas fluorescens
           WH6]
 gi|311287604|gb|EFQ66162.1| zinc transport system permease protein [Pseudomonas fluorescens
           WH6]
          Length = 262

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 110/259 (42%), Positives = 181/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVA+  +  +  TI +
Sbjct: 1   MADFLLYALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVAMGFLLDVSPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G     +++L  +W+PLLA TV+ ELAK EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSAAVLVLLVVLWRPLLAITVHEELAKVEGLPVSGLRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MAI A+++G+L +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAIGASLLGMLAVCGGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++ +  LF+LSF   +
Sbjct: 241 PSIVVAAAALFLLSFVLPR 259


>gi|20088924|ref|NP_614999.1| zinc ABC transporter, permease protein [Methanosarcina acetivorans
           C2A]
 gi|19913769|gb|AAM03479.1| zinc ABC transporter, permease protein [Methanosarcina acetivorans
           C2A]
          Length = 274

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/257 (25%), Positives = 131/257 (50%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F   AL + I   ++ G +G F++ ++I +    IAH++  GV L     +     
Sbjct: 5   LQYTFIQNALIAAILASIACGIIGAFVVVKKIVFISGGIAHASFGGVGLGYYLDINPMYG 64

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +   +  ++LV+  + K   +  D+ +G++    ++L ++ +        DL ++LFG+I
Sbjct: 65  VLPFSLFSALVMGIVSKKSKIPEDSAIGILWSLGMALGVIFVYLTPGYAPDLMTYLFGNI 124

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L V   D+ L+  +  + +  ++  +K  LA   + E    +G+  EK+ L  + I +L 
Sbjct: 125 LTVPRLDLYLMLVLDAVIVGAVYLFYKEFLALCFDEEFTTVQGIPTEKLYLFLLCIIALT 184

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I V IK +GI L+ +LL +P   +R+F+ + + M +++T+ G L  + G+  S   D PS
Sbjct: 185 IVVLIKVVGIILVIALLTIPATLSRKFTHNLKRMMLISTVFGTLISVAGIGLSYALDVPS 244

Query: 241 GPSIIITSLFLFILSFF 257
           G +II+   F++ L   
Sbjct: 245 GATIILVLSFVYGLVAV 261


>gi|27363636|ref|NP_759164.1| Zinc ABC transporter inner membrane permease ZnuB [Vibrio
           vulnificus CMCP6]
 gi|27359752|gb|AAO08691.1| Zinc ABC transporter, inner membrane permease protein ZnuB [Vibrio
           vulnificus CMCP6]
          Length = 265

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 177/254 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI L  GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 7   EFLLPSLLAGLGIALIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYLALIV 66

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + ++SD +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 67  CCLALAVILVTLQKQQLVASDTLLGILAHSALSIGLVAVSFLDNVRVDLMSYLFGDLLAV 126

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L I+         L+  W+PLL+TTVN ELA  EG   + I+LI +++  ++I+V
Sbjct: 127 SPQDLLFIYAGVAAVGATLYLFWRPLLSTTVNEELAAVEGTNIDLIRLILMLMVGIVIAV 186

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P   ARRF+ SPE MA  A++IG+L ++ GL  S  FDTP+GPS
Sbjct: 187 GMKFVGALIMTSLLIIPAAAARRFAQSPEQMAGFASLIGVLAVLGGLTLSWHFDTPAGPS 246

Query: 244 IIITSLFLFILSFF 257
           ++I++  +F+L+  
Sbjct: 247 VVISATAIFMLAQL 260


>gi|332364319|gb|EGJ42093.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK355]
          Length = 287

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITSIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++   K  +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAK-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+  L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   +
Sbjct: 138 DIDMWISIGVALLVLLVIAIFFKQLLITSFDPLLAQAMGMKVNFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F+ SFF 
Sbjct: 258 VLTSALIFLTSFFI 271


>gi|156973656|ref|YP_001444563.1| hypothetical protein VIBHAR_01359 [Vibrio harveyi ATCC BAA-1116]
 gi|156525250|gb|ABU70336.1| hypothetical protein VIBHAR_01359 [Vibrio harveyi ATCC BAA-1116]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 182/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLDINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +++L+ +QK + +++D +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAVLLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+         L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+V
Sbjct: 123 SPQDLMFIYAGVIAVSGCLYLFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSIAVLMGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++ FLF+LS    +
Sbjct: 243 VVISATFLFMLSQLISR 259


>gi|90411604|ref|ZP_01219614.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum 3TCK]
 gi|90327494|gb|EAS43847.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum 3TCK]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 110/256 (42%), Positives = 186/256 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFDINLNLALII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCMVLAVILVSLQKQKYVATDTLLGILAHSALSLGLVAVSFLDHVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++ I+G G L +  L  +W+PLL+ T+N ++A+ EG+  + ++L  +++  ++I+V
Sbjct: 123 TTADLMWIYGGGILVLGALITLWRPLLSMTINEDMAQVEGVNVDLMRLALMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA +A++IGI+ + IGL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPEMMACMASVIGIIAVFIGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  +F+LS   +
Sbjct: 243 VVVAAAAMFMLSQLKR 258


>gi|110641372|ref|YP_669102.1| iron transport protein, inner membrane component [Escherichia coli
           536]
 gi|191170912|ref|ZP_03032463.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli F11]
 gi|218689100|ref|YP_002397312.1| iron transporter inner membrane component [Escherichia coli ED1a]
 gi|218704668|ref|YP_002412187.1| iron transport protein, inner membrane component [Escherichia coli
           UMN026]
 gi|293404688|ref|ZP_06648680.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli FVEC1412]
 gi|298380329|ref|ZP_06989928.1| manganese/iron transport system permease [Escherichia coli
           FVEC1302]
 gi|300896832|ref|ZP_07115328.1| ABC 3 transport family protein [Escherichia coli MS 198-1]
 gi|306813952|ref|ZP_07448125.1| iron transport protein, inner membrane component [Escherichia coli
           NC101]
 gi|331646459|ref|ZP_08347562.1| SitC protein [Escherichia coli M605]
 gi|110342964|gb|ABG69201.1| iron transport protein, inner membrane component [Escherichia coli
           536]
 gi|190908644|gb|EDV68232.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli F11]
 gi|218426664|emb|CAR07495.1| iron transport protein, inner membrane component [Escherichia coli
           ED1a]
 gi|218431765|emb|CAR12648.1| iron transport protein, inner membrane component [Escherichia coli
           UMN026]
 gi|222032947|emb|CAP75687.1| SitC protein [Escherichia coli LF82]
 gi|291426896|gb|EFE99922.1| chelated iron transport system membrane protein yfeC [Escherichia
           coli FVEC1412]
 gi|298277771|gb|EFI19285.1| manganese/iron transport system permease [Escherichia coli
           FVEC1302]
 gi|300359340|gb|EFJ75210.1| ABC 3 transport family protein [Escherichia coli MS 198-1]
 gi|305852589|gb|EFM53037.1| iron transport protein, inner membrane component [Escherichia coli
           NC101]
 gi|324009558|gb|EGB78777.1| ABC 3 transport family protein [Escherichia coli MS 57-2]
 gi|324015725|gb|EGB84944.1| ABC 3 transport family protein [Escherichia coli MS 60-1]
 gi|330911015|gb|EGH39525.1| manganese ABC transporter, inner membrane permease protein SitC
           [Escherichia coli AA86]
 gi|331045211|gb|EGI17338.1| SitC protein [Escherichia coli M605]
          Length = 285

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++KL+F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKLLFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|15600694|ref|NP_254188.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAO1]
 gi|107104603|ref|ZP_01368521.1| hypothetical protein PaerPA_01005682 [Pseudomonas aeruginosa PACS2]
 gi|116053651|ref|YP_793978.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218894604|ref|YP_002443474.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           LESB58]
 gi|254237819|ref|ZP_04931142.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           C3719]
 gi|254243052|ref|ZP_04936374.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa 2192]
 gi|296392366|ref|ZP_06881841.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAb1]
 gi|313111558|ref|ZP_07797357.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           39016]
 gi|9951836|gb|AAG08886.1|AE004962_10 permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa PAO1]
 gi|115588872|gb|ABJ14887.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169750|gb|EAZ55261.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           C3719]
 gi|126196430|gb|EAZ60493.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa 2192]
 gi|218774833|emb|CAW30651.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           LESB58]
 gi|310883859|gb|EFQ42453.1| permease of ABC zinc transporter ZnuB [Pseudomonas aeruginosa
           39016]
          Length = 262

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 111/259 (42%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ +
Sbjct: 1   MADFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L++D +LG++ HST+SL LV LSFMK V  DL ++LFGD+L
Sbjct: 61  TVGCVLLAVLLVTLQQRQPLAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV+ +D+L I     L + ++  +W+PLLA TV+ ELAK EG+    I+L  +++ +++I
Sbjct: 121 AVSASDLLWIIAGSALVLALICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAGLFLLSFVLPR 259


>gi|315650906|ref|ZP_07903947.1| cation ABC superfamily ATP binding cassette transporter, membrane
           protein [Eubacterium saburreum DSM 3986]
 gi|315486820|gb|EFU77161.1| cation ABC superfamily ATP binding cassette transporter, membrane
           protein [Eubacterium saburreum DSM 3986]
          Length = 589

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 118/272 (43%), Gaps = 17/272 (6%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-----QLPLTIC 60
            I +L+  I   L+   LG F++ +R++   D I+HS LLG+ +          + L I 
Sbjct: 1   MIESLYILIITSLACAVLGVFLVLRRLSMVSDAISHSVLLGIVIGYFVTKDIGSVFLIIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILS-FMKWVNTDLTSFLFGD 119
             +   LT+  +  + K++ ++ DA +G++     S+A+++++ + + V+ D    L G+
Sbjct: 61  ASLFGVLTTFCIELLIKSKRVTEDASVGIVFPLFFSVAVILITRYARNVHLDTEVVLIGE 120

Query: 120 ILAVN-----------TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEK 168
           I+                 ++ +  +  +NI+ +   ++ L  ++ +   A   G+    
Sbjct: 121 IILAPLHRINFLGFSLPKTLVQMSFVLLINIVFITVFFRKLKISSFDPVYATVAGIAGAV 180

Query: 169 IKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIII 228
           +   F+ + S     + + +G  L  +  I P  +A   S   +   +LA +  +    I
Sbjct: 181 LHYSFMALVSFTAVSAFESVGAILAIAFFISPAASAYLISKDLKITILLACVYAVFNSFI 240

Query: 229 GLYGSLIFDTPSGPSIIITSLFLFILSFFYKK 260
           G + ++ F+        + S   F+++    +
Sbjct: 241 GYFLAVKFNVSMSGMCAVVSGITFLITMMVYR 272


>gi|168262018|ref|ZP_02683991.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464006|ref|ZP_02697923.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197263339|ref|ZP_03163413.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|195633358|gb|EDX51772.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197241594|gb|EDY24214.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|205349218|gb|EDZ35849.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
          Length = 282

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 115/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI+ F Y
Sbjct: 252 IVVLFAIVFIVVFIY 266


>gi|166363594|ref|YP_001655867.1| ABC-transporter permease protein [Microcystis aeruginosa NIES-843]
 gi|166085967|dbj|BAG00675.1| ABC-transporter permease protein [Microcystis aeruginosa NIES-843]
          Length = 301

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 73/260 (28%), Positives = 140/260 (53%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   F  R+L   I + +    +G +++ QR+A  GD I+HS L G+A++ I    L + 
Sbjct: 13  LQYSFMQRSLIEAIIVGIICAVVGTYLMVQRLALLGDAISHSVLPGLAIAFIGNFNLLLG 72

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
             + + +++L++  I+    +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 73  ALLASMVSTLLINLIRNRSPIKEDAAMGIVFSAFFALGITLITLIQKNNKIDLNHFLFGN 132

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL V   DI     I  + ++ +  ++K LL  T +   A+A G+    + L  +++  L
Sbjct: 133 ILGVTAADIRDTLIIAVIVLLTVLLLYKELLFYTFDKIGAQAAGLPVNLLDLGLMLLIGL 192

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S++ +G+ L+ SLLI P  TA    T    +  +   +GI+  I G+Y S  ++ P
Sbjct: 193 TIVASLQAVGVILVLSLLITPAATAYLLVTRLHQVMGVGVGVGIISSISGMYLSYYWNLP 252

Query: 240 SGPSIIITSLFLFILSFFYK 259
           SGP+I++ +  LF+L+F + 
Sbjct: 253 SGPAIVLVAFSLFMLAFLFS 272


>gi|88855881|ref|ZP_01130543.1| putative ABC transporter membrane protein [marine actinobacterium
           PHSC20C1]
 gi|88814748|gb|EAR24608.1| putative ABC transporter membrane protein [marine actinobacterium
           PHSC20C1]
          Length = 290

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 126/257 (49%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F +RAL + +   +    L C+++    +  GD ++H+ L GV L+ +   P  +   
Sbjct: 13  YDFMLRALATSVMAAIVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYVVGAPFALGAI 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L   ++  I+    +  DA +G++  +  +L LV++S      TDL   +FG++L 
Sbjct: 73  IFGFLAVGLIGVIRNTSRIKEDAAIGIVFTTLFALGLVLISVTP-SQTDLNHIIFGNLLG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+  D++ +  +G + + +L    +       +   A A G+ P+ +    + + +L   
Sbjct: 132 VSWADLMQVIILGAITLGVLLVKRRDFTLYAFDATHAHAIGLNPKVLGAALLGLLALTAV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ +LLI+P  TA   +     M ++A ++  L  + GLY S   DT SG 
Sbjct: 192 VALQAVGVVLVVALLIIPGATAYLLTDRFSRMLVIAPVMSALAAVTGLYLSYYLDTASGG 251

Query: 243 SIIITSLFLFILSFFYK 259
            I++    +F L + + 
Sbjct: 252 MIVLVEGCVFALVYLFS 268


>gi|330467301|ref|YP_004405044.1| ABC-3 protein [Verrucosispora maris AB-18-032]
 gi|328810272|gb|AEB44444.1| ABC-3 protein [Verrucosispora maris AB-18-032]
          Length = 311

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 133/255 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +GC+++ + +A+ GD +AH+   G+A++ + Q  L +   +
Sbjct: 16  AFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFVLQGSLVLGGAV 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L++    +N  +  D+I+GV      +L +VI+S        L  FLFG I  +
Sbjct: 76  AGVATALLIAIFAQNRRVKEDSIIGVFLVGAFALGIVIISQAPGYAGSLQQFLFGSITGI 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + + +   + K  +A  ++ E+++A G+    + ++  ++ +L + +
Sbjct: 136 PDRDLYVVGGASLVILGLALALHKEFVAVCLDREMSRAMGLAVFWLDIVLYVLVTLAVVI 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LLI P   AR  +     M +LA +IG     +GLY S  +DTP G +
Sbjct: 196 SLQTIGNILVLALLITPAAAARLLTDRLGVMMLLAPVIGGASATVGLYLSWSYDTPVGGT 255

Query: 244 IIITSLFLFILSFFY 258
           I++ +  +F+ ++  
Sbjct: 256 IVLIATAVFLAAWLI 270


>gi|239833988|ref|ZP_04682316.1| ABC-3 protein [Ochrobactrum intermedium LMG 3301]
 gi|239822051|gb|EEQ93620.1| ABC-3 protein [Ochrobactrum intermedium LMG 3301]
          Length = 287

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 116/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL   + I + T  L CF++ +  +  GD I+H+ L GV ++ I  +P     F+
Sbjct: 14  EFMRYALAISVLIAIPTALLSCFLVLKGWSLMGDAISHAVLPGVVVAYIIGIPFGFGAFV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L    + +N  +  D ++G++      L LV+   ++     L   LFGD+L +
Sbjct: 74  AGMSCALATGYLTENSRIKQDTVMGIVFSGMFGLGLVLYVAIR-STVHLDHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D++    I  L   IL   W+  L    +   A+A G+    +    + + SL I  
Sbjct: 133 TLSDLVETAVIAALTAGILVVKWRDFLLHAFDPVQARAVGLPVRLLHYGLLCLISLTIVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +K +GI L  ++LI P   A   +     M +LA  I +     G+Y S   D+   P+
Sbjct: 193 VLKAVGIILAIAMLIAPGAIAFLLTRKFSTMMLLAAAIAVFASFFGVYLSFFIDSAPAPT 252

Query: 244 IIITSLFLFILSFFY 258
           I++    +F+ +F Y
Sbjct: 253 IVLLMTVIFLAAFIY 267


>gi|56414816|ref|YP_151891.1| Iron transporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363744|ref|YP_002143381.1| Iron transporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56129073|gb|AAV78579.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197095221|emb|CAR60772.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 282

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 114/255 (44%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +++   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALVIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFTGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI  F Y
Sbjct: 252 IVVLFAIVFIAVFIY 266


>gi|332290484|ref|YP_004421336.1| high-affinity zinc transporter membrane component [Gallibacterium
           anatis UMN179]
 gi|330433380|gb|AEC18439.1| high-affinity zinc transporter membrane component [Gallibacterium
           anatis UMN179]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 111/257 (43%), Positives = 177/257 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLG+AL ++F L   I I +
Sbjct: 3   EIIFPAWITGIVLSLITAPLGAFVVWRKMAYFGDTLSHSALLGIALGIVFDLNPYIAILL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++ N   ++D +LG+I H+++SL +V +  +  V  DL ++LFGD+LA+
Sbjct: 63  LIILLALILVWLENNTHFAADTLLGIIAHTSLSLGVVTIGLIGGVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+L I     L + IL   W+ L++ TVN ELA+ EG+  +K +++ +++T++ I++
Sbjct: 123 TYQDLLWIGIGVILVLSILCYFWQALISATVNPELAQIEGVDVKKGRIVLMLLTAITIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRFS +PE+MAI+A II ++ +  GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFSRTPESMAIIAVIISMIAVTGGLLLSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I S  LFILS F K+
Sbjct: 243 VVICSALLFILSLFKKQ 259


>gi|194017728|ref|ZP_03056338.1| hydrophobic membrane protein ZurM [Bacillus pumilus ATCC 7061]
 gi|194010628|gb|EDW20200.1| hydrophobic membrane protein ZurM [Bacillus pumilus ATCC 7061]
          Length = 286

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 67/266 (25%), Positives = 133/266 (50%), Gaps = 8/266 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVA--------LSLIFQ 54
            EF   A  +G+ I      LG FI+ +R++   D ++H +L G+A          L+  
Sbjct: 8   YEFLQNAFIAGMLIGFIAPLLGVFIVVRRLSLIADALSHVSLAGIAASLFLDKKFGLLTG 67

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTS 114
           +         +   SL + +++       +  + +I    I ++++ +S     NTDL S
Sbjct: 68  VSPLYLGMAFSVAGSLFIERLRSVYKHYQELAIPIILSGGIGISVIFISLANGFNTDLFS 127

Query: 115 FLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFI 174
           +LFG + AV+  D+ ++ GI  + ++++  ++K L   + + E AKA G+  + I  IFI
Sbjct: 128 YLFGSVSAVSRLDLWIVVGISLVVVLVVVLLYKELFLLSFDEEHAKASGISAKWIHFIFI 187

Query: 175 MITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL 234
           ++ +L+I+ S++ +G  L+++L+ LP   + R +   +    L+ + G L ++ GL  S 
Sbjct: 188 LVVALVIAASMRIVGTLLVSALMTLPVAASIRIAKGFKQAIFLSILFGELSVLAGLILSY 247

Query: 235 IFDTPSGPSIIITSLFLFILSFFYKK 260
             D   G +I++ S+ + I   F  K
Sbjct: 248 YLDLAPGGTIVMLSILILIGCIFIGK 273


>gi|157148275|ref|YP_001455594.1| hypothetical protein CKO_04092 [Citrobacter koseri ATCC BAA-895]
 gi|157085480|gb|ABV15158.1| hypothetical protein CKO_04092 [Citrobacter koseri ATCC BAA-895]
          Length = 286

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/256 (25%), Positives = 132/256 (51%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   + L ++S     + ++ + + G++LA
Sbjct: 70  LSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGIGLFMVSLNPM-SVNIQTIILGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG ++++IL   WK L+ T  +   A++ G+ P ++KL+F  + S+   
Sbjct: 129 IAPEDILQLAIIGTVSLVILLLKWKDLMVTFFDENHARSIGLNPARLKLLFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +  +A  IG L    G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLTIAVAIGSLTSFFGAWLSYWLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVLQTLLFLLAFIF 264


>gi|67078362|ref|YP_245980.1| manganese ABC transporter, permease [Bacillus cereus E33L]
 gi|66970668|gb|AAY60642.1| manganese ABC transporter, permease [Bacillus cereus E33L]
          Length = 288

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I 
Sbjct: 11  MQYSFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 71  AVLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++
Sbjct: 130 LSVRSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMV 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  S
Sbjct: 190 TVASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLAS 249

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ + FLF L+FF+ 
Sbjct: 250 GATIVLVATFLFGLAFFFS 268


>gi|298717583|ref|YP_003730225.1| iron transport system membrane protein SitC [Pantoea vagans C9-1]
 gi|298361772|gb|ADI78553.1| Iron transport system membrane protein sitC [Pantoea vagans C9-1]
          Length = 286

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/254 (25%), Positives = 134/254 (52%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F+ 
Sbjct: 12  YMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAFLS 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L  DAI+G+I  S   L L ++S +     ++ + + G+ILA+ 
Sbjct: 72  GGLAAGSMLLLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTAVNIQTIVLGNILAIA 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+L +  IG L+I+IL   WK L+ T  +   A+A G++PE++K++F  + ++    +
Sbjct: 131 PADVLQLALIGGLSIIILLFKWKDLMVTFFDENHARAIGLRPERLKVLFFTLLAVSTVAA 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G  I
Sbjct: 191 LQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSITSFLGAWASYYLDGATGGII 250

Query: 245 IITSLFLFILSFFY 258
           ++    LF+L+F +
Sbjct: 251 VVAQTLLFLLAFVF 264


>gi|284921277|emb|CBG34343.1| iron ABC transporter, permease protein [Escherichia coli 042]
          Length = 285

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDHFPRLLIIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|257464778|ref|ZP_05629149.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus minor 202]
 gi|257450438|gb|EEV24481.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus minor 202]
          Length = 259

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 168/256 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I +  
Sbjct: 3   DILLPAWLAGLLLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ ++     S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTIILALALVWLEHKTNYSVDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I         IL   W+ LL+ T++ ELA+ EG++  +++L+ +++T+L I++
Sbjct: 123 DFNDVIFIAVGVVFIAAILGFYWEKLLSITISPELAQIEGLKVARLRLLLMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE+M I A    ++ I  GL  S I DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPESMVIYAICFSVMAITGGLLLSSIEDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LF++S   K
Sbjct: 243 VVVCAGGLFLISLLKK 258


>gi|157693764|ref|YP_001488226.1| metal cation ABC transporter membrane protein [Bacillus pumilus
           SAFR-032]
 gi|157682522|gb|ABV63666.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Bacillus pumilus SAFR-032]
          Length = 290

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 140/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  +ALF+ + + +  G +GCFII + +A  GD I+H+ L GVA+S +  +       
Sbjct: 10  YAFLQKALFTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYMLGINFFFGAV 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   LT++ +  + +N  + +D+ +G++  +  S+ +++++F+K  ++DL   LFG++LA
Sbjct: 70  LTGVLTAIGIGYVSQNSRIKNDSAIGIVFTAFFSIGIILITFLK-SSSDLYHILFGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V ++D+ +  GIG   ++ +   +K LL ++ +  ++   G+    I    + + +L+  
Sbjct: 129 VRSSDMWITLGIGIFILLAVIVFYKELLISSFDPVISSVYGLPNRMIHYFLMTLLTLVTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   +     M  L+   G +  + GL  S  ++  SG 
Sbjct: 189 ASLQTVGIILVVAMLITPAATAYLLTDRLWIMIYLSAFFGAVSAVAGLGLSFTYNLSSGA 248

Query: 243 SIIITSLFLFILSFFYK 259
           SI++ +  LF  +F + 
Sbjct: 249 SIVLVATILFGSAFIFS 265


>gi|218988927|gb|ACL13590.1| iron transporter SitD [Salmonella enterica subsp. salamae serovar
           Sofia]
          Length = 282

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/255 (25%), Positives = 116/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    + +N  +  D ++G++        LV+   ++     L   LFG++L V
Sbjct: 73  AGLFCAIATGYLDENSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGNMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI +F Y
Sbjct: 252 IVVLFAIVFIAAFIY 266


>gi|26247466|ref|NP_753506.1| SitC protein [Escherichia coli CFT073]
 gi|91210364|ref|YP_540350.1| SitC protein [Escherichia coli UTI89]
 gi|117623374|ref|YP_852287.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitC [Escherichia
           coli APEC O1]
 gi|218558080|ref|YP_002390993.1| iron transport protein, inner membrane component [Escherichia coli
           S88]
 gi|218700267|ref|YP_002407896.1| iron transporter inner membrane component [Escherichia coli IAI39]
 gi|227886439|ref|ZP_04004244.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Escherichia coli 83972]
 gi|300940480|ref|ZP_07155058.1| ABC 3 transport family protein [Escherichia coli MS 21-1]
 gi|300972062|ref|ZP_07171820.1| ABC 3 transport family protein [Escherichia coli MS 45-1]
 gi|300996125|ref|ZP_07181405.1| ABC 3 transport family protein [Escherichia coli MS 200-1]
 gi|301046476|ref|ZP_07193630.1| ABC 3 transport family protein [Escherichia coli MS 185-1]
 gi|26107867|gb|AAN80066.1|AE016759_340 SitC protein [Escherichia coli CFT073]
 gi|85376558|gb|ABC70485.1| SitC [Escherichia coli]
 gi|86604473|emb|CAJ21352.1| iron transport protein, inner-membrane component SitC [Escherichia
           coli]
 gi|91071938|gb|ABE06819.1| SitC protein [Escherichia coli UTI89]
 gi|115512498|gb|ABJ00573.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitC [Escherichia
           coli APEC O1]
 gi|218364849|emb|CAR02541.1| iron transport protein, inner membrane component [Escherichia coli
           S88]
 gi|218370253|emb|CAR18051.1| iron transport protein, inner membrane component [Escherichia coli
           IAI39]
 gi|227836643|gb|EEJ47109.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Escherichia coli 83972]
 gi|294490093|gb|ADE88849.1| iron chelate ABC transporter, permease protein [Escherichia coli
           IHE3034]
 gi|300301547|gb|EFJ57932.1| ABC 3 transport family protein [Escherichia coli MS 185-1]
 gi|300304588|gb|EFJ59108.1| ABC 3 transport family protein [Escherichia coli MS 200-1]
 gi|300411036|gb|EFJ94574.1| ABC 3 transport family protein [Escherichia coli MS 45-1]
 gi|300454728|gb|EFK18221.1| ABC 3 transport family protein [Escherichia coli MS 21-1]
 gi|307553200|gb|ADN45975.1| iron/manganese transport system membrane protein SitC [Escherichia
           coli ABU 83972]
 gi|307627328|gb|ADN71632.1| iron transport protein, inner membrane component [Escherichia coli
           UM146]
 gi|315290811|gb|EFU50183.1| ABC 3 transport family protein [Escherichia coli MS 153-1]
 gi|323953996|gb|EGB49795.1| ABC 3 transporter [Escherichia coli H263]
          Length = 285

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++KLIF  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKLIFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|83311410|ref|YP_421674.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magneticum AMB-1]
 gi|82946251|dbj|BAE51115.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magneticum AMB-1]
          Length = 260

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 97/259 (37%), Positives = 171/259 (66%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F +RAL +G  + L  GPLGCFI+W+R+AYFGD +AHSALLG+   L+  +   + +
Sbjct: 1   MDDFLLRALMAGAAVALVAGPLGCFIVWRRMAYFGDALAHSALLGIVAGLLLGVAPLVGV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +  + +++L + + + +   D++LG++ H +++L LV+LS M  V  DL  +LFGDIL
Sbjct: 61  VALCVIAAVILSRAEADRSAGGDSLLGILAHGSLALGLVLLSLMDRVRVDLMGWLFGDIL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  +D+  +WG G + + +L   W+ L+A  V+ +LA  EG +  + +++ +++ +L +
Sbjct: 121 AVTASDMAWLWGGGAVVLAVLGWQWRSLIAAAVDEDLAVVEGHKVARSRMLLMLLVALGV 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + ++K +G+ L+T++LI+P   ARR S +PE MA+LA + G++ + +GL GS ++D PSG
Sbjct: 181 AAAMKVVGVMLVTAMLIIPAAAARRLSRTPERMAVLAALAGLIAVALGLGGSWVWDIPSG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI+  +  LF+LS    +
Sbjct: 241 PSIVTVATALFLLSRTISR 259


>gi|16761641|ref|NP_457258.1| Iron transport protein inner membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29143125|ref|NP_806467.1| iron transporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213052183|ref|ZP_03345061.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213426195|ref|ZP_03358945.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213620870|ref|ZP_03373653.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213855136|ref|ZP_03383376.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|289823858|ref|ZP_06543464.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25316146|pir||AD0848 Iron transport protein, inner membrane component sitD [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16503942|emb|CAD05971.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29138758|gb|AAO70327.1| iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 282

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 114/255 (44%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI  F Y
Sbjct: 252 IVVLFAIVFIAVFIY 266


>gi|113954271|ref|YP_730960.1| ABC transporter [Synechococcus sp. CC9311]
 gi|113881622|gb|ABI46580.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           CC9311]
          Length = 288

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/258 (24%), Positives = 126/258 (48%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           + + F +RAL     +    G L C++  +  A  GD ++HS L GV L+    LP ++ 
Sbjct: 9   LQHAFMVRALLISATVGAVCGLLSCYMTLKGWALMGDAVSHSVLPGVILAYAIGLPFSVG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+    +  ++  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++
Sbjct: 69  AFVFGVGSVAMIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNV 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L ++  DI     I  L   +L    + LL    +   A++ G+    +  + + + SL 
Sbjct: 128 LGISIADIQQTVLISALVTAVLLLFRRDLLLFCFDPTHARSIGINTGVLHYLLLSVLSLA 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
               ++ +GI L+ ++L+ P  TA   +   + M+ LA    IL  ++G+Y S   D+  
Sbjct: 188 AVAGLQTVGIILVVAMLVTPGATAYLLTDRFDRMSWLAIGSSILSSLLGVYTSYWTDSSP 247

Query: 241 GPSIIITSLFLFILSFFY 258
              I++    LF+++F +
Sbjct: 248 AGCIVLVQTGLFVMAFLF 265


>gi|116495866|ref|YP_807600.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei ATCC 334]
 gi|227533581|ref|ZP_03963630.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|301067422|ref|YP_003789445.1| Mn2+/Zn2+ ABC transporter permease [Lactobacillus casei str. Zhang]
 gi|18369745|emb|CAC81444.1| hydrophobic membrane protein [Lactobacillus casei]
 gi|116106016|gb|ABJ71158.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei ATCC 334]
 gi|227188785|gb|EEI68852.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|300439829|gb|ADK19595.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus casei str. Zhang]
          Length = 298

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 14  YDFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINVMIGAS 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + +L++  +  N  + +D  +GV+  +  +L  +++S  +   T+L   LFG+ILA
Sbjct: 74  VFGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILISMAE-SATNLHHILFGNILA 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +DI+    +  + I+ +   +K LL T+ +   AK  G+    I    +++ +L+  
Sbjct: 133 VSDSDIVTTAVVLGIVILFVVLFYKELLITSFDNTFAKTYGLNTTMIHYALMLVLTLVTV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++   E M I +  +G+   I GLY S  F+  SGP
Sbjct: 193 SALQTVGIILVVAMLITPAATAFLWTDRLETMLITSASVGVFSAITGLYFSFTFNWASGP 252

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF +SF + 
Sbjct: 253 AIVLVAAVLFAISFVFS 269


>gi|69244847|ref|ZP_00603071.1| ABC-3 [Enterococcus faecium DO]
 gi|257879100|ref|ZP_05658753.1| ABC-3 transporter [Enterococcus faecium 1,230,933]
 gi|257882093|ref|ZP_05661746.1| ABC-3 transporter [Enterococcus faecium 1,231,502]
 gi|257883725|ref|ZP_05663378.1| ABC-3 transporter [Enterococcus faecium 1,231,501]
 gi|257889930|ref|ZP_05669583.1| ABC-3 transporter [Enterococcus faecium 1,231,410]
 gi|258615480|ref|ZP_05713250.1| ABC transporter, permease protein [Enterococcus faecium DO]
 gi|260562721|ref|ZP_05833216.1| ABC-3 transporter [Enterococcus faecium C68]
 gi|261208117|ref|ZP_05922792.1| ABC-3 transporter [Enterococcus faecium TC 6]
 gi|289566360|ref|ZP_06446789.1| manganese transport system membrane protein mntC [Enterococcus
           faecium D344SRF]
 gi|293552713|ref|ZP_06673378.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1039]
 gi|293563550|ref|ZP_06677998.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|293567247|ref|ZP_06678602.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1071]
 gi|294614592|ref|ZP_06694497.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1636]
 gi|294617376|ref|ZP_06697012.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|314939304|ref|ZP_07846550.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|314941293|ref|ZP_07848187.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|314947824|ref|ZP_07851231.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
 gi|314950697|ref|ZP_07853775.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|314992061|ref|ZP_07857512.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|314995519|ref|ZP_07860617.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|68196201|gb|EAN10631.1| ABC-3 [Enterococcus faecium DO]
 gi|257813328|gb|EEV42086.1| ABC-3 transporter [Enterococcus faecium 1,230,933]
 gi|257817751|gb|EEV45079.1| ABC-3 transporter [Enterococcus faecium 1,231,502]
 gi|257819563|gb|EEV46711.1| ABC-3 transporter [Enterococcus faecium 1,231,501]
 gi|257826290|gb|EEV52916.1| ABC-3 transporter [Enterococcus faecium 1,231,410]
 gi|260072880|gb|EEW61240.1| ABC-3 transporter [Enterococcus faecium C68]
 gi|260077701|gb|EEW65417.1| ABC-3 transporter [Enterococcus faecium TC 6]
 gi|289161869|gb|EFD09740.1| manganese transport system membrane protein mntC [Enterococcus
           faecium D344SRF]
 gi|291590051|gb|EFF21844.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1071]
 gi|291592573|gb|EFF24177.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1636]
 gi|291596367|gb|EFF27624.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|291603137|gb|EFF33324.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1039]
 gi|291604552|gb|EFF34038.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|313590258|gb|EFR69103.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|313593382|gb|EFR72227.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|313597119|gb|EFR75964.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|313599894|gb|EFR78737.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|313641395|gb|EFS05975.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|313645804|gb|EFS10384.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
          Length = 279

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 142/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQ-SATDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+L  ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMLSAVVGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|306827892|ref|ZP_07461159.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus pyogenes ATCC 10782]
 gi|304429811|gb|EFM32853.1| metal ion ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus pyogenes ATCC 10782]
          Length = 284

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITFIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVNAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|282898846|ref|ZP_06306833.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
 gi|281196373|gb|EFA71283.1| ABC-3 [Cylindrospermopsis raciborskii CS-505]
          Length = 269

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 138/255 (54%), Gaps = 1/255 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             R+L   + I L    +G +++ QR+A  GD I+HS L G+A++ I    + +  F+ A
Sbjct: 1   MQRSLIVAVLIGLLCAVVGTYLMVQRLALLGDAISHSVLPGLAIAFIIGANIFVGAFIAA 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGDILAVN 124
            ++++ +  I+    +  DA +G++     +L + +++ ++  N  DL  FLFG+IL V 
Sbjct: 61  MVSTVAIAVIKNRSPIKEDAAMGIVFSGFFALGVTLITGIQKANKIDLNHFLFGNILGVT 120

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             ++     +  + ++I+F ++K LL  T +   A+  G+   ++ +  +++ SL I  S
Sbjct: 121 PNEVRDTAILAAVALIIVFLLYKELLFYTFDPIGAQVAGLPVNQLNISLMLVISLTIVAS 180

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+ L+ S+LI P  TA         + IL   I I+  I+G+Y S  ++ PSGP+I
Sbjct: 181 MKAVGVILVLSMLITPGATAYLLVNRLHQVMILGAAIAIISSILGIYLSYFYNLPSGPAI 240

Query: 245 IITSLFLFILSFFYK 259
           ++     F+L+F + 
Sbjct: 241 VLVVCTAFVLAFLFS 255


>gi|260575818|ref|ZP_05843814.1| ABC-3 protein [Rhodobacter sp. SW2]
 gi|259021971|gb|EEW25271.1| ABC-3 protein [Rhodobacter sp. SW2]
          Length = 263

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 104/260 (40%), Positives = 164/260 (63%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA  +GIG+ L+ GPLG F++W+R+AYFGD  AH+A+LGVAL+L   LP+ + 
Sbjct: 1   MLDDFLIRAALAGIGVALAAGPLGSFVVWRRMAYFGDATAHAAILGVALALATDLPIGLG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             ++A   +   +        + D  LGV+ HS ++  LV +SF+  V  DL S+LFGDI
Sbjct: 61  TLLVALAMAAT-VSTLAARGWAMDTTLGVLAHSALAFGLVAVSFIPEVRVDLASYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+  IWG   L + +L   W  LL +T++ +LA A G+ P++ +LI  +  +++
Sbjct: 120 LAVSRVDLGFIWGGAALVLALLVWRWSALLTSTLSEDLACASGLNPDRERLILTLALAVV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V++K IG  LI ++LI+P   AR  + SPE MA+LA +IG+   + GL  SL +DTP+
Sbjct: 180 VAVALKVIGALLIAAMLIIPAAAARGLARSPEQMAVLAALIGMASALGGLRMSLSYDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSI+  +  +F +     +
Sbjct: 240 GPSIVAVAACVFCVVAIVSR 259


>gi|315654873|ref|ZP_07907778.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Mobiluncus curtisii ATCC 51333]
 gi|315490834|gb|EFU80454.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Mobiluncus curtisii ATCC 51333]
          Length = 297

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 122/255 (47%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F +R +            L C+++    +  GD ++H+ L G+ +S +   P  I   +
Sbjct: 14  QFMLRGIIVTGVAAAVCAVLSCWLVLIGWSLLGDALSHAILPGIVVSYLLGTPFAIGALV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A L   ++  ++    +  D  +GV+  +  +  LV++S     + DL   LFGD+L +
Sbjct: 74  AALLVVGLIGAVRGRGRVKEDTAIGVVFTTMFASGLVLISLFP-SHIDLHHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+  +  +  L +++L    + L+    +   A A G+    +  + ++  SL + V
Sbjct: 133 TRADMWQVLILSPLALVLLLYKKRDLVLYAFDKTHAHAIGISTSWLATLLLVALSLTVVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G  LI +L+I P  TAR  +     M  +A ++ +  +++G Y S  FDT SG +
Sbjct: 193 AMQAVGAILIVALVITPGATARLLTNRFNAMLWIAPLLSVSCVVLGAYISYWFDTASGAT 252

Query: 244 IIITSLFLFILSFFY 258
           +++    LF++ +  
Sbjct: 253 VVLLEGVLFLIVWLV 267


>gi|227552351|ref|ZP_03982400.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecium TX1330]
 gi|257895076|ref|ZP_05674729.1| ABC-3 transporter [Enterococcus faecium Com12]
 gi|227178519|gb|EEI59491.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Enterococcus faecium TX1330]
 gi|257831641|gb|EEV58062.1| ABC-3 transporter [Enterococcus faecium Com12]
          Length = 279

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 141/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQ-SATDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+   +IG++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMFSAVIGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|257886478|ref|ZP_05666131.1| ABC-3 transporter [Enterococcus faecium 1,141,733]
 gi|257892685|ref|ZP_05672338.1| ABC-3 transporter [Enterococcus faecium 1,231,408]
 gi|257897684|ref|ZP_05677337.1| ABC-3 transporter [Enterococcus faecium Com15]
 gi|293377939|ref|ZP_06624120.1| ABC 3 transport family protein [Enterococcus faecium PC4.1]
 gi|293571398|ref|ZP_06682428.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E980]
 gi|257822532|gb|EEV49464.1| ABC-3 transporter [Enterococcus faecium 1,141,733]
 gi|257829064|gb|EEV55671.1| ABC-3 transporter [Enterococcus faecium 1,231,408]
 gi|257835596|gb|EEV60670.1| ABC-3 transporter [Enterococcus faecium Com15]
 gi|291608537|gb|EFF37829.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E980]
 gi|292643486|gb|EFF61615.1| ABC 3 transport family protein [Enterococcus faecium PC4.1]
          Length = 279

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 75/259 (28%), Positives = 141/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M  +F   AL + + + L++G +G FII + ++  GD I+H+ L GVA+S +F       
Sbjct: 10  MNYQFLQYALVTSMLVGLASGVIGSFIILRGMSLMGDAISHAVLPGVAISYMFGFSYIFG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+ V+  + +   L +D  +G++  S  +L ++++S+ +   TDL   LFG++
Sbjct: 70  ATAFGMLTAAVIGFVTQRSRLKNDTAIGIVFSSFFALGIILISYAQ-SATDLYHILFGNV 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+LL   +  + ++ +F  +K L  T+ +  +AKA G+    I  + +   +L+
Sbjct: 129 LAVRESDLLLTALVSGIVLIFVFFFYKELKITSFDPTMAKAYGLNTSLIHYLLMFFLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
             VS++ +G  L+ ++LI P  TA   +     M I A  IG+   ++G++ S  ++ PS
Sbjct: 189 AVVSLQTVGTILVIAMLITPAATAYLLTNHLLKMIITAAGIGMFSAVVGVFFSYSYNWPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++     FIL+F + 
Sbjct: 249 GATIVLACTAFFILAFLFS 267


>gi|284006272|emb|CBA71508.1| iron ABC transporter, membrane protein [Arsenophonus nasoniae]
          Length = 271

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/254 (23%), Positives = 114/254 (44%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
             +A+ + +        L CF+I +  +  GD I+H+ L G+ ++ +  +PL+I  F   
Sbjct: 1   MQKAIITALVTGTVCAILSCFLILKGWSLMGDAISHAVLPGIVIAFVVGIPLSIGAFASG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
              +     +++N  +  D ++G++     +  LV+ + +   +  LT  LFG+IL +  
Sbjct: 61  IFCAFATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFARI-DTDQHLTHILFGNILGITA 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            +      I    I I+    K  +    +   AK  G+  + +    + + +L I  S+
Sbjct: 120 AEFKQTLWISGFTIAIILLKRKDFMLYCFDPNQAKVIGLPVKLLHYGLLSLLALTIVASL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +GI L+ ++LI P + A     +   M I+A I      +IG   S   D  +GP I+
Sbjct: 180 QAVGIILVIAMLISPGIIAFTLCQNFNRMLIIAVIASTTSSLIGTILSFHIDAATGPCIV 239

Query: 246 ITSLFLFILSFFYK 259
           +T    FI +  Y 
Sbjct: 240 LTQAIYFIAALIYN 253


>gi|292492315|ref|YP_003527754.1| ABC transporter [Nitrosococcus halophilus Nc4]
 gi|291580910|gb|ADE15367.1| ABC-3 protein [Nitrosococcus halophilus Nc4]
          Length = 281

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 125/253 (49%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL +GI   L  G +G F++ +RI +    IAH+ L G+ ++            + 
Sbjct: 12  FLQNALVAGILASLGCGIVGSFVVVKRIGFLAGGIAHTVLGGMGIAYYLDKNPFAGALVA 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L +L++  +        D ++  +    +++ ++ +S     N DL S+LFG+IL V+
Sbjct: 72  ALLAALLIGWVSLRWREREDTLISALWSMGMAVGMIFISQTPGYNVDLMSYLFGNILMVS 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
              + L+  +  + ++ +   +K  LA + + E A+  G+      L+ + + +L + + 
Sbjct: 132 REKLYLMGAVDGVIVLTVILFYKQFLALSFDEEFARLRGVPVTFFYLLLLCMVALTVVLL 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           I+ +G+ L+ +LL+LP   A ++  S   M +LA I+G      GL  S   D P+G +I
Sbjct: 192 IQVVGLVLVIALLVLPAAIAGQYMGSLAGMMLLAAILGSAFTSTGLVMSYEPDLPAGSTI 251

Query: 245 IITSLFLFILSFF 257
           ++ +   ++LS  
Sbjct: 252 VLVTGAAYLLSTL 264


>gi|254503155|ref|ZP_05115306.1| ABC 3 transport family [Labrenzia alexandrii DFL-11]
 gi|222439226|gb|EEE45905.1| ABC 3 transport family [Labrenzia alexandrii DFL-11]
          Length = 288

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 113/257 (43%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A    + + + T  L CF++ +  A  GD ++H+ L G+ L+ I  LPL +  F 
Sbjct: 13  PFMQNAFLICVLVSIPTALLSCFLVMKGWALMGDAVSHAVLPGIVLAYIVGLPLILGAFA 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++    +  N  +  D ++GV+      L +V+   ++  N  L   LFG++L V
Sbjct: 73  AGMVCAVATGYLSNNSRVKQDTVMGVVFSGMFGLGIVLYVAVE-TNAHLDHILFGNMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+     I  +    L   WK L+  + +   A+A G+    +    +   SL I  
Sbjct: 132 GNQDLWTAGIISLVVASGLVLKWKDLVLHSFDAAQAQASGLPVNWLHYGLLAALSLTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++   G+ L   L+I P   A         M  ++ I+ +L ++ G Y S   D+   P+
Sbjct: 192 TLSATGLILAIGLVIAPGAIAFLLVRKFSTMLWVSVIVCMLSMLAGTYLSFFIDSAPAPT 251

Query: 244 IIITSLFLFILSFFYKK 260
           I++     FI +F  ++
Sbjct: 252 IVLILTAAFIAAFIRRQ 268


>gi|77456290|ref|YP_345795.1| hypothetical protein Pfl01_0062 [Pseudomonas fluorescens Pf0-1]
 gi|77380293|gb|ABA71806.1| high-affinity zinc ABC transport system, membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 262

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 181/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F   AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  T+ +
Sbjct: 1   MADFLFYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTVAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G     +++L  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSAAVLVLLVTLWRPLLAITVHEELARVEGLSVAGLRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G+L +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGMLAVCGGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++T+  LF+LSF   +
Sbjct: 241 PSIVVTAAALFLLSFVLPR 259


>gi|163802532|ref|ZP_02196424.1| arginyl-tRNA synthetase [Vibrio sp. AND4]
 gi|159173615|gb|EDP58434.1| arginyl-tRNA synthetase [Vibrio sp. AND4]
          Length = 261

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 181/257 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +GIGI L  GPLG F++W+++AYFGDT+AH++L+G+AL  +  + L + + +
Sbjct: 3   EFLLPSILAGIGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGLALGFLLNINLYLALLV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +QK + +++D +LG++ HS +S+ LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAALLVTLQKQQLVATDTLLGILAHSALSIGLVSVSFLDNVRVDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I+         L+  W+PLL++TV+ ELA  EG+  + ++L+ +++  ++I+V
Sbjct: 123 SPQDLMFIYTGVIAVSACLYLFWRPLLSSTVSEELAAVEGVNTDLVRLVLMLMVGVVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TAR+ S+SPE MA+ A+IIG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARKVSSSPEQMALFASIIGSVAVLMGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           ++I++ FLF+LS    +
Sbjct: 243 VVISATFLFMLSQLISR 259


>gi|319955491|ref|YP_004166758.1| abc-3 protein [Cellulophaga algicola DSM 14237]
 gi|319424151|gb|ADV51260.1| ABC-3 protein [Cellulophaga algicola DSM 14237]
          Length = 375

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 115/259 (44%), Gaps = 10/259 (3%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----LTICIFMIA 65
                +    G LG F + ++ +  GD I+H+AL G+A++ +         L I   +  
Sbjct: 21  LGTAILGAVCGMLGSFAVLRKQSLLGDAISHAALPGIAIAFLITGTKDSSVLLIGALISG 80

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLFGDIL 121
            L +  +  I     L SD  LG+I        +++L+F++         L  +LFG   
Sbjct: 81  LLGTFWIRGITTKTHLKSDTALGLILSLFFGFGMLLLTFIQKQPNANQAGLDKYLFGQAA 140

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +  +D+ L+  +  + ++IL   WK       + +  K  G   + I ++      L I
Sbjct: 141 TLVESDVWLMAIVTGICLIILLLFWKEFKILLFDADYTKTLGFNTKFIDILITTFIVLAI 200

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL-IFDTPS 240
            + ++ +G+ L++++L+ P   AR+++ S   M ILA I G    + G   S    +  +
Sbjct: 201 VLGLQTVGVVLMSAMLLAPAAAARQWTNSLSFMVILAAIFGAFAGVFGTAISASQTNLST 260

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP I+I +    + SF + 
Sbjct: 261 GPVIVIVAGVFVLFSFIFS 279


>gi|288561583|ref|YP_003428989.1| manganese ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288548215|gb|ADC52097.1| manganese ABC transporter, permease [Bacillus pseudofirmus OF4]
          Length = 292

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 146/259 (56%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF  RAL + + + +  G +GCFII + ++  GD I+H+ L GVA+S +  + +   
Sbjct: 11  LQYEFLQRALLTSVLVGIVCGVIGCFIILRGMSLMGDAISHAVLPGVAISYMLGINIFYG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   LT++ +  I +N  +  D  +G++  +  ++ +++++F++  +TDL   LFG++
Sbjct: 71  AVVTGLLTAIAIGYISQNSRIKDDTSIGIMFTAAFAVGIIVITFLQ-SSTDLYHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV T+++ +   +  + ++ ++  +K LL TT +  ++ A G+  + I  + + + ++ 
Sbjct: 130 LAVPTSEMWMTLIVTVIVLLSVYLFFKELLVTTFDPTMSAAYGLPNKIIHYLLMALLTMA 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  LA   G++  IIGLY S  ++  S
Sbjct: 190 TVASLQTVGIVLVVAMLITPAATAYLLTNHLGIMVFLAAGFGVVASIIGLYFSFSYNLAS 249

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP+I++ +   F ++FF  
Sbjct: 250 GPTIVVVASTFFAMAFFLS 268


>gi|261343860|ref|ZP_05971505.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rustigianii DSM 4541]
 gi|282568247|gb|EFB73782.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rustigianii DSM 4541]
          Length = 261

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI+ I     +   +LF  W+ LL+ TV+ ELA  +G+  ++ +L+ +M+T+L I +
Sbjct: 123 TYEDIITILIGVVVVCGLLFYRWRALLSMTVSAELAFVDGINLQRSRLLLMMVTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA++A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMALIAVLIGMVSVTGGLTLSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++TS  LF+LS   K
Sbjct: 243 VVLTSAILFVLSLCVK 258


>gi|54308246|ref|YP_129266.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum SS9]
 gi|46912674|emb|CAG19464.1| putative ABC-type Mn2+/Zn2+ transport system, permease component
           [Photobacterium profundum SS9]
          Length = 261

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 110/256 (42%), Positives = 186/256 (72%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + AL +GIGI +  GPLG F++W+++AYFGDT++H++LLG+AL  +F + L + + +
Sbjct: 3   EFLLPALAAGIGIAILAGPLGSFVVWRKMAYFGDTLSHASLLGIALGFLFDINLNLALII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCMVLAVILVSLQKQKYVATDTLLGILAHSALSLGLVAVSFLDHVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++ I+G G L +  L  +W+PLL+ T+N ++A+ EG+  + ++L  +++  ++I+V
Sbjct: 123 TTADLMWIYGGGILVLGALIALWRPLLSMTINEDMAQVEGVNVDLMRLALMLMVGMVIAV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA +A++IGI+ + IGL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSHSPEMMACMASVIGIIAVFIGLAMSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  +F+LS   +
Sbjct: 243 VVVAAAAMFMLSQLRR 258


>gi|119491198|ref|ZP_01623295.1| ABC-3 [Lyngbya sp. PCC 8106]
 gi|119453539|gb|EAW34700.1| ABC-3 [Lyngbya sp. PCC 8106]
          Length = 291

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 74/256 (28%), Positives = 134/256 (52%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A+   + + +    +G ++I QR+   GD IAH+ L G+A++    + + +  F+
Sbjct: 11  EFMRHAVLVAVLMGILCPVVGSYLIVQRMGLLGDVIAHAVLPGLAIAFYLGIDIFLGAFI 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             T+++L++  IQ    +  D  + ++    ++L +++++ ++    DL SFLFGDIL+V
Sbjct: 71  SGTVSTLIIAWIQSQSRVKIDVAMALVFSGFLALGILLITVLE-SKLDLHSFLFGDILSV 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            T D++    I    ++ +   +K LL  T N   A+A G+    I +  +   +L I  
Sbjct: 130 TTRDVVRTLMITLFILLCVRLFYKELLFYTFNPLGAQAMGLPVNLINIGLVSAITLTIIA 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ SLLI P +TA         M  L  I GI   + G+Y S   + PSG +
Sbjct: 190 SMQAVGVVLVVSLLIGPGITAYLLVKELHQMMGLGAIFGIFSSVAGMYISYYLNVPSGAA 249

Query: 244 IIITSLFLFILSFFYK 259
           I++T   LFIL+  + 
Sbjct: 250 IVLTVSGLFILALLFS 265


>gi|15673299|ref|NP_267473.1| manganese ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|12724296|gb|AAK05415.1|AE006363_10 manganese ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|326406853|gb|ADZ63924.1| manganese/iron transport system permease protein [Lactococcus
           lactis subsp. lactis CV56]
          Length = 281

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   +L + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   +   + 
Sbjct: 14  FLQNSLVTAVVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFVGAIIF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L+S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLSSIIITFIKNNSIIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  L  G+  + ++++   +K LL T+ +  +A+A GM+      + +++ +L+   +
Sbjct: 133 DIDKWLTMGVSGIVLIVIILFFKELLITSFDPLMARAIGMKVNFYHYLLMVLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S   M IL++ +G +  ++GL+    F+   G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYTNSLRKMIILSSSLGAVSSVLGLFIGYSFNIAVGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           +ITS  +F +SF   
Sbjct: 253 VITSAIIFAISFLVS 267


>gi|269926685|ref|YP_003323308.1| ABC-3 protein [Thermobaculum terrenum ATCC BAA-798]
 gi|269790345|gb|ACZ42486.1| ABC-3 protein [Thermobaculum terrenum ATCC BAA-798]
          Length = 280

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/254 (24%), Positives = 139/254 (54%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           ++  RAL + I + +S   +G +++ +R++  GD + H+A  GVA + +  +   +   +
Sbjct: 11  DYMQRALIASIIVGISCPIVGLYLVLRRLSLIGDGLGHAAFAGVAAAWLAGINPLLGAAI 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A   +L + +++       D  L ++ +S I+L +V+ S  + +N  L ++LFG IL +
Sbjct: 71  FAIAGALGVEKLRSWRREHGDLALAIVFYSGIALGVVLTSLARRMNLSLFTYLFGSILTI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+L+I   G   I+++  ++K L   T + ++AK  G+    +  + +++ ++ +  
Sbjct: 131 TNTDLLIIGITGACVIVLVIMLYKELFTLTYDEDIAKVSGLPVNLLNHLIVLLGAITVVS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+  +L++P  +A + + S +  +I +   G+   I+GL  S I D   G +
Sbjct: 191 ALRVVGVLLVAGMLVIPVASALQIARSFKQASIYSICFGLASTILGLAFSYILDLAPGGA 250

Query: 244 IIITSLFLFILSFF 257
           I++T++ LF +S  
Sbjct: 251 IVLTAVILFTISSI 264


>gi|161502991|ref|YP_001570103.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|160864338|gb|ABX20961.1| hypothetical protein SARI_01053 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + IL   W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIATGVVIVLAILSWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A + G+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVVTGMLAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMLKKQ 259


>gi|52081847|ref|YP_080638.1| manganese ABC transporter [Bacillus licheniformis ATCC 14580]
 gi|52787236|ref|YP_093065.1| MntD [Bacillus licheniformis ATCC 14580]
 gi|319647765|ref|ZP_08001983.1| MntD protein [Bacillus sp. BT1B_CT2]
 gi|52005058|gb|AAU25000.1| manganese ABC transporter [Bacillus licheniformis ATCC 14580]
 gi|52349738|gb|AAU42372.1| MntD [Bacillus licheniformis ATCC 14580]
 gi|317390106|gb|EFV70915.1| MntD protein [Bacillus sp. BT1B_CT2]
          Length = 286

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 142/259 (54%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  ++LF+ I + +  G +GCFII + +A  GD I+H+ L GVA+S +  +     
Sbjct: 8   MEYSFLQKSLFTSIMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYMLGVNFFFG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 LT+L +  + +N  + +D+ +G++  +  ++ +++++ +K  ++DL   LFG++
Sbjct: 68  AVFTGILTALGIGYVSQNSRIKNDSAIGIVFTAFFAVGIILITLVK-SSSDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   IG + +  +F  +K LL T+ +  +A   G+    I    + + +++
Sbjct: 127 LAVRSSDMWITLVIGVIILTAVFLFYKELLITSFDPTMAAVYGLPNRLIHYFLMTLLTMV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  L+  +G L  +IGL  S  ++  S
Sbjct: 187 TVASLQTVGIILVVAMLITPAATAYLLTDRLWVMIYLSAFLGALSAVIGLGLSYTYNLSS 246

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ +  LF LSF + 
Sbjct: 247 GAAIVLVATILFGLSFTFS 265


>gi|268589735|ref|ZP_06123956.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rettgeri DSM 1131]
 gi|291314887|gb|EFE55340.1| zinc uptake ABC transporter, permease protein ZnuB [Providencia
           rettgeri DSM 1131]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWVAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+ I+    +   +LF  W+ LL+ TV+ ELA  +G+  ++++L+ +++T+L I +
Sbjct: 123 SYEDIITIFIGVIVVCGLLFYRWRALLSITVSPELAFVDGINIQRLRLLLMLVTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAAIAVLIGMIAVTGGLTLSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ S  LF+ S   K
Sbjct: 243 VVLVSAILFVFSLTIK 258


>gi|70733588|ref|YP_257228.1| zinc ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347887|gb|AAY95493.1| zinc ABC transporter, permease protein [Pseudomonas fluorescens
           Pf-5]
          Length = 262

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 180/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + +  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +   + +
Sbjct: 1   MADFLLYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPAVAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G     +++L  +W+PLLA TV+ ELA+ EG+    ++L  +++ +++I
Sbjct: 121 AISPGDLAWILGGSAAVLLLLVALWRPLLAITVHEELARVEGLPVASLRLALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G+L +  GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGMLAVCGGLALSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++T+  LF+LSF   +
Sbjct: 241 PSIVVTAATLFLLSFVLPR 259


>gi|167550292|ref|ZP_02344049.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|168242597|ref|ZP_02667529.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|194447502|ref|YP_002046827.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|205353808|ref|YP_002227609.1| iron transport protein inner membrane protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858127|ref|YP_002244778.1| Iron transport protein inner membrane protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|194405806|gb|ACF66025.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|205273589|emb|CAR38576.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205324735|gb|EDZ12574.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205338077|gb|EDZ24841.1| chelated iron transport system membrane protein YfeD [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|206709930|emb|CAR34284.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|326628916|gb|EGE35259.1| Iron transport protein, inner membrane component [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 282

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 114/255 (44%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + + +    L  F++ +  A  GD ++H+   GV L+ I  +PL I  F+
Sbjct: 13  DFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAYIVGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D ++G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI+    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNITLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +        LA  + ++    G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYLSFYLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI  F Y
Sbjct: 252 IVVLFAIVFIAVFIY 266


>gi|157148276|ref|YP_001455596.1| hypothetical protein CKO_04093 [Citrobacter koseri ATCC BAA-895]
 gi|157085481|gb|ABV15159.1| hypothetical protein CKO_04093 [Citrobacter koseri ATCC BAA-895]
          Length = 282

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 117/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F I AL     + +    L  F++ +  A  GD ++H+   G+ L+ I  +PL I  F+
Sbjct: 13  DFMINALMVSAIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGIVLAYIAGIPLAIGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D I+G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAVATGYLDDNSRIKRDTIMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +DIL    I     +I+   WK  L    +   AKA G+    +    + + +L I  
Sbjct: 132 SISDILQTALIALGIALIIGLKWKDFLLHAFDPHQAKASGLNTSLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +       +LA  + ++   +G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAILLTRRFARALMLAVTLSVVTSFLGVYLSFFLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +FI++F Y
Sbjct: 252 IVVLFTAIFIVAFIY 266


>gi|226224047|ref|YP_002758154.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes Clip81459]
 gi|254993208|ref|ZP_05275398.1| zinc ABC transporter, permease protein [Listeria monocytogenes FSL
           J2-064]
 gi|255522269|ref|ZP_05389506.1| zinc ABC transporter, permease protein [Listeria monocytogenes FSL
           J1-175]
 gi|284801833|ref|YP_003413698.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes 08-5578]
 gi|284994975|ref|YP_003416743.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes 08-5923]
 gi|225876509|emb|CAS05218.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|284057395|gb|ADB68336.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes 08-5578]
 gi|284060442|gb|ADB71381.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes 08-5923]
 gi|328465491|gb|EGF36720.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           1816]
 gi|328474962|gb|EGF45756.1| zinc ABC transporter, permease protein [Listeria monocytogenes 220]
 gi|332311887|gb|EGJ24982.1| Zinc ABC transporter, permease protein [Listeria monocytogenes str.
           Scott A]
          Length = 292

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGLVIGIVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRNVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIVTILYQK 273


>gi|261417669|ref|YP_003251351.1| ABC transporter [Geobacillus sp. Y412MC61]
 gi|297529364|ref|YP_003670639.1| ABC transporter [Geobacillus sp. C56-T3]
 gi|319767525|ref|YP_004133026.1| ABC transporter [Geobacillus sp. Y412MC52]
 gi|261374126|gb|ACX76869.1| ABC-3 protein [Geobacillus sp. Y412MC61]
 gi|297252616|gb|ADI26062.1| ABC-3 protein [Geobacillus sp. C56-T3]
 gi|317112391|gb|ADU94883.1| ABC-3 protein [Geobacillus sp. Y412MC52]
          Length = 277

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 132/267 (49%), Gaps = 8/267 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-------- 53
             EF   A  +G+    +   LG FI+ +R++   D ++H  L G+A  L+         
Sbjct: 7   QYEFLRNAFVAGVLTGFTAPLLGVFIVVRRLSLIADALSHVTLAGIAAGLLLEKTIPAAA 66

Query: 54  QLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLT 113
                      + + SL + +++       +  + ++  S + L+++ +S      TDL 
Sbjct: 67  SWNPLYIGMGFSVVGSLFIEKLRAVYRHYEELAIPIVLSSGLGLSVIFISMANGFTTDLF 126

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           S+LFG + AV+  D+   + +     M++   +K L   + + E A+  G++   I  +F
Sbjct: 127 SYLFGSVSAVSRADVWTAFAVAAAAAMVILTFYKELFLLSFDEEYARVSGVRTTLIHFLF 186

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
           I++ +L+I+ S++ +G+ LI+SL+ LP   + R + S + +  L+ + G L +I GL+ +
Sbjct: 187 IVLVALVIAASMRIVGVLLISSLMTLPVAASIRIAKSFKQVIGLSILFGELAVIAGLWAA 246

Query: 234 LIFDTPSGPSIIITSLFLFILSFFYKK 260
              D   G +I+I ++ + + +  +K+
Sbjct: 247 YELDWAPGGTIVIAAVVILLFALGWKR 273


>gi|240948709|ref|ZP_04753081.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           minor NM305]
 gi|240296925|gb|EER47503.1| high-affinity zinc uptake system membrane protein [Actinobacillus
           minor NM305]
          Length = 259

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 167/256 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +  + A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I +  
Sbjct: 3   DILLPAWLAGLLLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ I+     S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTIILALALVWIEHKTNYSVDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I         IL   W+ LL+ T++ ELA+ EG++  +++L+ +++T+L I++
Sbjct: 123 DFNDVIFIAVGVVFIAAILGFYWEKLLSITISPELAQIEGLKVARLRLLLMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE M I A    I+ I  GL  S I DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPEAMVIYAIGFSIIAITGGLLLSSIKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LF++S   K
Sbjct: 243 VVVCAGGLFLMSLLKK 258


>gi|239826871|ref|YP_002949495.1| ABC transporter [Geobacillus sp. WCH70]
 gi|239807164|gb|ACS24229.1| ABC-3 protein [Geobacillus sp. WCH70]
          Length = 351

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 60/267 (22%), Positives = 125/267 (46%), Gaps = 10/267 (3%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-----LP 56
            +        S   + L++G +G F + ++ +  GD +AH+AL GV L+ +         
Sbjct: 1   MDANVQWVFTSTFLLGLASGMIGSFALLKKQSLLGDAMAHAALPGVCLAFLLYKEKSLFL 60

Query: 57  LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDL 112
             I   +   L +  + QI +   +  D  +G++      + +V+L+F+        + +
Sbjct: 61  FFIGAALSGLLATFFIQQIVRFTRVKEDTAIGLVLSVFFGIGIVLLTFINQHSQGNQSGI 120

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
             FLFG   ++  +D+ ++  +    I ++   +K     T +   A+  G+    +  +
Sbjct: 121 NDFLFGQAASLIESDVKMLSAVALTLIALIALFFKEFKLITFDPAFARGLGLPVSLLNGV 180

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
            + +   ++   ++ +G+ L+++LLI P + AR ++     M +LA + G L  +IG Y 
Sbjct: 181 LMFLIVAVVVTGLQAVGVVLMSALLITPALAARYWTEELGWMVVLAGLFGGLSGVIGTYL 240

Query: 233 S-LIFDTPSGPSIIITSLFLFILSFFY 258
           S L    P+GP II+ +  LF+ SF +
Sbjct: 241 STLATGMPTGPLIIVAATILFLFSFLF 267


>gi|110641977|ref|YP_669707.1| high-affinity zinc transporter membrane component [Escherichia coli
           536]
 gi|110343569|gb|ABG69806.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli 536]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ +     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISVAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|315303766|ref|ZP_07874268.1| metal ion ABC transporter, permease protein [Listeria ivanovii FSL
           F6-596]
 gi|313627854|gb|EFR96485.1| metal ion ABC transporter, permease protein [Listeria ivanovii FSL
           F6-596]
          Length = 280

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 69/258 (26%), Positives = 142/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMLGMNFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRNSDMWMTIVIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASSFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  LF ++F +
Sbjct: 247 GAAMVLVATILFFIAFLF 264


>gi|46447441|ref|YP_008806.1| putative zinc ABC transporter membrane protein [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46401082|emb|CAF24531.1| putative zinc ABC transporter membrane protein [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 351

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/265 (24%), Positives = 132/265 (49%), Gaps = 7/265 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF------- 53
           M +     AL +G    + +G +G ++I +RI +   +I+HS L G+ L +         
Sbjct: 61  MTHSLLFSALLAGFAASIVSGIIGSYVIVKRIVFIAGSISHSVLSGIGLCIWLERTQGIH 120

Query: 54  QLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLT 113
                +     A L++L+L  I        D+++  I    +++ ++ +S     N +LT
Sbjct: 121 WASPLLGALTAAILSALILGWIHLYYRQREDSVIAAIWSIGMAIGILFISQTPGFNVELT 180

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           +FL G+IL V+ TD+ ++WG+    I+++  + K  LA   + E A+ +G+    + L+ 
Sbjct: 181 NFLIGNILWVSQTDLYILWGLDICTILLVLCLHKRFLAICFDEEQARLQGLPVNGLYLLL 240

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
           +++ ++ I + I+ +GI L+ ++L +P   A   ++S   M +LA     L  + G   +
Sbjct: 241 LILIAISIVLLIQVVGIVLVMTMLTIPATIANLLTSSLSKMMLLAIFFSSLFCLTGNSVA 300

Query: 234 LIFDTPSGPSIIITSLFLFILSFFY 258
             FD P+G +I + +   +I S  +
Sbjct: 301 YYFDWPTGATIALIAGIAYIFSLTF 325


>gi|226330415|ref|ZP_03805933.1| hypothetical protein PROPEN_04333 [Proteus penneri ATCC 35198]
 gi|225201210|gb|EEG83564.1| hypothetical protein PROPEN_04333 [Proteus penneri ATCC 35198]
          Length = 285

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 123/256 (48%), Gaps = 1/256 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F  RA+ + I I ++   L C+++ +  +  GD I+H+ L GV L+ +  +PLT+  
Sbjct: 13  QYPFMQRAIVAAIIIGIACAILSCYMVLKGWSLMGDAISHAVLPGVVLAYVTAIPLTVGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F+     S     ++ +  +  D ++G++     ++ LVI + +   +  L   LFG+IL
Sbjct: 73  FLSGLFCSFATGYLKDHSRIKEDTVMGIVFSGMFAVGLVIFASV-DTDQHLMHILFGNIL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +    +  I  I  + I I+    K  +    +   A+  G+    +    + I +L I
Sbjct: 132 GITPDVLTQISIICVITITIMLIKQKDFMLYCFDPNQARIVGLPVTLLHYGLLSILALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P +TA   + S   M +LA I  +   +IG + S   D  +G
Sbjct: 192 VASMQAVGIILVVAMLISPGITAYLLTRSFSRMIMLAIIFSVASSVIGTFISFHIDGATG 251

Query: 242 PSIIITSLFLFILSFF 257
           P I++T    FI++  
Sbjct: 252 PCIVLTQAVFFIIALL 267


>gi|331003719|ref|ZP_08327213.1| hypothetical protein HMPREF0491_02075 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330412102|gb|EGG91497.1| hypothetical protein HMPREF0491_02075 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 589

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 117/268 (43%), Gaps = 17/268 (6%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-----QLPLTIC 60
            I +L+  I   L+   LG F++ +R++   D I+HS LLG+ +          + L I 
Sbjct: 1   MIESLYILIITSLACAVLGVFLVLRRLSMVSDAISHSVLLGIVIGYFVTKDIGSVFLIIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILS-FMKWVNTDLTSFLFGD 119
             +   LT+  +  + K++ ++ DA +G+I     S+A+++++ + + V+ D    L G+
Sbjct: 61  ASLFGVLTTFCIELLIKSKRITEDASVGIIFPLFFSVAVILITRYARNVHLDTEIVLIGE 120

Query: 120 ILAVN-----------TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEK 168
           I+                 ++ +  +  +NI+ +   ++ L  ++ +   A   G+    
Sbjct: 121 IILAPLHRINFWGFSLPKALVQMSFVLLINIVFITVFFRKLKISSFDPVYATVAGIAGAV 180

Query: 169 IKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIII 228
           +   F+ + S     + + +G  L  +  I P  +A   S   +   +LA +  +    I
Sbjct: 181 LHYSFMALVSFTAVSAFESVGAILAIAFFISPAASAYLISKDLKITILLACVYAVFNSFI 240

Query: 229 GLYGSLIFDTPSGPSIIITSLFLFILSF 256
           G + ++ F+        + S   F+++ 
Sbjct: 241 GYFLAVKFNVSMSGMCAVVSGITFLITM 268


>gi|297571075|ref|YP_003696849.1| ABC transporter [Arcanobacterium haemolyticum DSM 20595]
 gi|296931422|gb|ADH92230.1| ABC-3 protein [Arcanobacterium haemolyticum DSM 20595]
          Length = 287

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 134/254 (52%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL   I   +  G +G  ++ + +++ GD ++H+   G+A +   Q  + +   + 
Sbjct: 17  FLPRALIVAILASIVCGVVGTHVVLRGMSFVGDALSHAVFPGIAAAFALQGSILLGGAVA 76

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             + +L++    ++  L  D+I+GV   +  +L LVI+S +      L SFLFG +    
Sbjct: 77  GVIVTLLITLFSQHRRLKEDSIIGVFFAAAFALGLVIMSRIPGYTGSLESFLFGSLNGST 136

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D+L + G+GF+ I +L    + L+A +V+ + A + GM      LI  +  +  + VS
Sbjct: 137 DSDMLAVAGLGFVIISVLALFHRKLVAVSVDRDYASSLGMSTLAADLIIYLAVAAAVVVS 196

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ IG  L+ +LLI P   AR  +     M +++  +G LG  +G++ S  +D P+G +I
Sbjct: 197 VQTIGNILVLALLITPAAAARMLTDRVATMMVISPALGSLGAFLGIWASWTWDVPTGATI 256

Query: 245 IITSLFLFILSFFY 258
           ++    +F++++ +
Sbjct: 257 VLILTVIFVVAWLF 270


>gi|260776447|ref|ZP_05885342.1| zinc ABC transporter permease protein ZnuB [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260607670|gb|EEX33935.1| zinc ABC transporter permease protein ZnuB [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 261

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 107/256 (41%), Positives = 178/256 (69%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI    GPLG F++W+R+AYFGDT+AH++L+G+AL  +  + L   + +
Sbjct: 3   EFLLPSILAGLGIAAIAGPLGSFVVWRRMAYFGDTLAHASLMGLALGFLLDVNLYFALIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                + +L+ +Q+ + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLALAFILVALQRQQLVATDTLLGILAHSALSLGLVAVSFLDNVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    L   IL   W+ LLATTVN +LA  EG   + ++L+ +++  L+I++
Sbjct: 123 SPTDLVYIYAGAALVSAILVYFWRSLLATTVNEDLAAVEGHNVDLMRLVLMIMVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  TARRFS +PE MAI A+ IG + +++GL  S  +DTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAATARRFSRTPEQMAITASFIGAVAVLLGLSLSWHYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I++  +F+LS  Y+
Sbjct: 243 VVISATAMFMLSQLYR 258


>gi|297561097|ref|YP_003680071.1| ABC transporter [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296845545|gb|ADH67565.1| ABC-3 protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 304

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/256 (22%), Positives = 131/256 (51%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RAL   +   ++   L C++     +  GD ++H+ L GV LS +F LP  +   +
Sbjct: 18  DFVRRALLVSVVAGVACAVLSCWMTLVGWSLMGDAVSHAVLPGVVLSYLFGLPFAVGALV 77

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               +  ++  + +   +  DA++GV+  +  +L LV++S +    TDL   LFG++L V
Sbjct: 78  FGAGSVALIGVVNRTSRVKEDAVIGVVFTAMFALGLVLVSRVP-SQTDLGHILFGNVLGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TDI  +  +  + + +++   + L     +   A A G+ P  ++ + + + S+ + V
Sbjct: 137 SDTDIWQVLVLAGVVLAVVWYKHRDLTLYAFDPVHAHAVGINPRLLETLLLGLLSVTVVV 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +GI L+ +++I+P  TA   +   E M +++  + +   + G++ S   +  +G +
Sbjct: 197 ALQAVGIILVVAMVIVPGATAYLLTDRFERMLVISAAVAVAAAVAGVFLSFHLNVSTGGA 256

Query: 244 IIITSLFLFILSFFYK 259
           I++     F L++ + 
Sbjct: 257 IVLAQSSAFTLAYLFS 272


>gi|238749493|ref|ZP_04610998.1| Chelated iron transport system membrane protein yfeC [Yersinia
           rohdei ATCC 43380]
 gi|238712148|gb|EEQ04361.1| Chelated iron transport system membrane protein yfeC [Yersinia
           rohdei ATCC 43380]
          Length = 294

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + I+A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFGRLLIIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTLVFLLAFLF 265


>gi|83594224|ref|YP_427976.1| ABC-3 transporter component [Rhodospirillum rubrum ATCC 11170]
 gi|83577138|gb|ABC23689.1| ABC-3 transporter component [Rhodospirillum rubrum ATCC 11170]
          Length = 285

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 69/257 (26%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A+   + + + T  L CF++ +  A  GD I+H+ L GV L+ +  LPL +  F 
Sbjct: 16  PFLRDAMIIALLVAVPTALLSCFLVLKGWALMGDAISHAVLPGVVLAYVAGLPLGVGAFA 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +LV   ++ N  +  D ++GV+      L +V+ + ++  +  L   LFGD+L V
Sbjct: 76  AGLGCALVTGYLKDNSRIKQDTVMGVVFSGMFGLGIVLHTSIR-TDVHLDHILFGDMLGV 134

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            ++D+L    I  L +  +    + LL    + + A+A G+    +    + + +L I  
Sbjct: 135 GSSDLLESGLIALLVVGAIALKGRDLLLHAFDPQQARAIGLPVGLLHYGLLCLLALTIVG 194

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K  GI L  +LLI P   A  F+    +M + A +I  L  ++G+Y SL  D+   P+
Sbjct: 195 ALKATGILLTVALLIGPGAIAFLFTRRFSSMLLAAVVISSLASVLGVYISLFLDSAPAPT 254

Query: 244 IIITSLFLFILSFFYKK 260
           I++     FI +F   +
Sbjct: 255 IVLLLTLTFIAAFMVSR 271


>gi|16803486|ref|NP_464971.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes EGD-e]
 gi|224499702|ref|ZP_03668051.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           Finland 1988]
 gi|224501613|ref|ZP_03669920.1| zinc ABC transporter, permease protein [Listeria monocytogenes FSL
           R2-561]
 gi|254829795|ref|ZP_05234450.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           10403S]
 gi|254898388|ref|ZP_05258312.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           J0161]
 gi|255030402|ref|ZP_05302353.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           LO28]
 gi|16410875|emb|CAC99524.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria monocytogenes EGD-e]
          Length = 292

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGLVIGVVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRNVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIVTILYQK 273


>gi|212711933|ref|ZP_03320061.1| hypothetical protein PROVALCAL_03008 [Providencia alcalifaciens DSM
           30120]
 gi|212685455|gb|EEB44983.1| hypothetical protein PROVALCAL_03008 [Providencia alcalifaciens DSM
           30120]
          Length = 261

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 105/256 (41%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWIAGMLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +L+L+ ++K   L+ D +LG++ HS++SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  VTLLLALILVWLEKRPQLAVDTLLGIMAHSSLSLGLVVVSLMANVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI+ I     +   +LF  W+ LL+ TV+ ELA  +G+  ++ +L+ +M+T+L I +
Sbjct: 123 TYEDIITILIGVVVVCGLLFYRWRALLSMTVSSELAFVDGINLQRSRLLLMMVTALTIGI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA+ A  IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFAKTPEQMALTAIGIGMISVTGGLTLSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++TS  LFILS   K
Sbjct: 243 VVLTSAILFILSLCVK 258


>gi|21909856|ref|NP_664124.1| integral membrane protein MtsC, ABC transporter (permease protein)
           [Streptococcus pyogenes MGAS315]
 gi|28896449|ref|NP_802799.1| ABC transporter (permease) [Streptococcus pyogenes SSI-1]
 gi|21904043|gb|AAM78927.1| integral membrane protein MtsC, ABC transporter (permease protein)
           [Streptococcus pyogenes MGAS315]
 gi|28811700|dbj|BAC64632.1| putative ABC transporter (permease) [Streptococcus pyogenes SSI-1]
          Length = 284

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + + I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGVNFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    ++++   +K LL T+ +  LAK+ G++      + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFDPILAKSMGVKVIAYHYLLMVLLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++++G L  ++GLY    F+  +
Sbjct: 189 AVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSLLGALASVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAMMFLISFFVS 267


>gi|254362891|ref|ZP_04978965.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeD [Mannheimia haemolytica PHL213]
 gi|261494124|ref|ZP_05990627.1| ABC transport system permease protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496035|ref|ZP_05992445.1| ABC transport system permease protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|110735187|gb|ABG89164.1| ABC transport system permease protein [Mannheimia haemolytica]
 gi|153094529|gb|EDN75361.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeD [Mannheimia haemolytica PHL213]
 gi|261308285|gb|EEY09578.1| ABC transport system permease protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261310290|gb|EEY11490.1| ABC transport system permease protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 269

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 65/257 (25%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL + I +   +  L C+++ +  +  GD I+H+ L GV +S +  LPL+I  F 
Sbjct: 12  EFMQIALITAILVAGVSAVLSCYLVLKGWSLMGDAISHAVLPGVVISSLAGLPLSIGAFF 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L +  +++N  L  D ++G++     +  +++ +        LT  LFG++L V
Sbjct: 72  SGLGCALSVGYLKENSRLKEDTVMGIVFSGMFAFGILLFTAFN-TGEHLTHILFGNLLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+L    I     +++    K  L    +   AK  G+    +    + + +L I  
Sbjct: 131 TKSDLLQTLLISLFTFVVMVAKRKDFLLYCFDVNQAKVAGLPVRLLHYGLLSLLALTIIS 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +TA   +   ++M ++A  + I   + G   S   D  +GP+
Sbjct: 191 AMQVVGVILVVAMLITPGITAYLLTKRFDSMLLIALGVAIFSSVFGTLLSYHIDAATGPT 250

Query: 244 IIITSLFLFILSFFYKK 260
           II+    +F LSF Y K
Sbjct: 251 IILVQAAIFFLSFAYSK 267


>gi|261344027|ref|ZP_05971672.1| metal ion ABC transporter, permease protein [Providencia
           rustigianii DSM 4541]
 gi|282568420|gb|EFB73955.1| metal ion ABC transporter, permease protein [Providencia
           rustigianii DSM 4541]
          Length = 296

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 127/256 (49%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNFMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DA++G I  +  +   +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGILAALAMTLVKHLTRLREDAVIGFIFSTFFAAG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ ++L  +WK LLA   +   A++ G+ P ++K+IF  + S    
Sbjct: 130 IADADVLQVEIIIAVSFIVLMCLWKDLLAVFFDESHARSIGLNPLRLKIIFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +   + + I++  IG     IG Y S   +  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDKFKTLLIISVSIGTATSAIGAYLSYFLNGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 LIVTFQTAIFLLAFFF 265


>gi|116512155|ref|YP_809371.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactococcus lactis subsp. cremoris SK11]
 gi|116107809|gb|ABJ72949.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactococcus lactis subsp. cremoris SK11]
          Length = 279

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F    L + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I     
Sbjct: 14  FLQNTLITAVVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIAF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L+SL++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLSSLIITYIKNNSLIKGDTAIGITFSSFLALGIILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  L  G+    ++++   +K LL T+ +  +AKA GM+      + +++ +L+   +
Sbjct: 133 DIDKWLTIGVSIFVLIVIALFFKQLLITSFDPLMAKAIGMKVNFYHYLLMVLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M IL++ IG +  ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIEAMLITPAATAYLYTNSLKKMLILSSSIGAISSVLGLFIGYTFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           +ITS  +F +SF   
Sbjct: 253 VITSAIIFAVSFLIS 267


>gi|237729691|ref|ZP_04560172.1| fur regulated protein [Citrobacter sp. 30_2]
 gi|226908297|gb|EEH94215.1| fur regulated protein [Citrobacter sp. 30_2]
          Length = 285

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 64/256 (25%), Positives = 130/256 (50%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F
Sbjct: 10  YQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   + L ++S     + ++ + + G++LA
Sbjct: 70  LSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGIGLFMVSLNPM-SVNIQTIILGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG +++ ILF  WK L+    +   A++ G+ P ++KL+F  + S+   
Sbjct: 129 IAPEDILQLAIIGVISLTILFLKWKDLMVVFFDENHARSIGLNPGRLKLLFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +  +A  IG L    G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLTIAVAIGSLTSFFGAWLSYWLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVLQTLLFLLAFVF 264


>gi|320102606|ref|YP_004178197.1| ABC-3 protein [Isosphaera pallida ATCC 43644]
 gi|319749888|gb|ADV61648.1| ABC-3 protein [Isosphaera pallida ATCC 43644]
          Length = 494

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 116/272 (42%), Gaps = 22/272 (8%)

Query: 10  LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIF-----QLPLTICIFMI 64
           L   + + LS   LGCF++ +R++  GD I+H+ L G+ ++ +        P+ I   + 
Sbjct: 31  LAVALTVNLSCAILGCFLVVRRMSLLGDAISHAVLPGLVVAFLLAGRIASGPMFIGATLA 90

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILS-FMKWVNTDLTSFLFGDILAV 123
              T+     +     +  DA LG++  +  +L +V++  +   V+ D    L+G I   
Sbjct: 91  GLFTAWASRALASTGRVRDDASLGIVFTTMFALGVVLIHAYADNVDLDPGCVLYGSIELT 150

Query: 124 NTTDILLIW----------------GIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPE 167
           +   I L W                      ++++ + W  L+ T+ +   A A G+  E
Sbjct: 151 SLERISLPWPGGGTWSVPRALFAPLLALCATLILVSRAWNELVWTSFDPGHAAAAGLNVE 210

Query: 168 KIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGII 227
           +I   F+++T+     S + +G  L+ ++LI+P   AR  ++  E M ILA  +G    +
Sbjct: 211 RIHRAFLVVTAATTVASFEAVGSILVVAMLIVPAACARLLTSRLEMMIILACFVGAFSAV 270

Query: 228 IGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259
            G   +   DT         +   F L+    
Sbjct: 271 GGFVLAAALDTNMAGMTAGVAGGFFALAVVGS 302


>gi|300744089|ref|ZP_07073108.1| manganese transport system membrane protein MntC [Rothia
           dentocariosa M567]
 gi|311112666|ref|YP_003983888.1| metal cation ABC transporter membrane protein [Rothia dentocariosa
           ATCC 17931]
 gi|300379814|gb|EFJ76378.1| manganese transport system membrane protein MntC [Rothia
           dentocariosa M567]
 gi|310944160|gb|ADP40454.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Rothia dentocariosa ATCC 17931]
          Length = 290

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/255 (23%), Positives = 135/255 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL +     L TG +GC ++ + + + GD +AHS   G+A++ +    L     +
Sbjct: 17  AFLPRALAAVTLASLVTGVVGCHVMMRGMVFIGDAVAHSVFPGLAVAFVIGGNLVFGGLI 76

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              +T++++    +N+ L  D+++G+    + +L +VI+S     +  +  FLFG I+ V
Sbjct: 77  AGVITAVLVAIFSQNQKLREDSVIGIFFAGSFALGIVIISLAPGYSGSIQDFLFGSIVGV 136

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DI     +    +++L+   + L+  +++ E A+A G+    + ++  ++ ++ + +
Sbjct: 137 SRGDIAQAAAMSAGILLLLWLFHRQLVTVSLDRESARALGLPVLWLDILLYVLVTVSVVI 196

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G  L+ +L+++P   +R        M + + + G+L    GLY S  F+ P+G +
Sbjct: 197 SLQTLGNVLVLALIVVPASASRLTCRRLGTMMLFSPVFGVLCSTAGLYFSWAFNLPTGGT 256

Query: 244 IIITSLFLFILSFFY 258
           I++T +  F+L + +
Sbjct: 257 IVLTMVAAFVLVWVF 271


>gi|89889862|ref|ZP_01201373.1| metal ABC transporter, ABC-3 family [Flavobacteria bacterium BBFL7]
 gi|89518135|gb|EAS20791.1| metal ABC transporter, ABC-3 family [Flavobacteria bacterium BBFL7]
          Length = 370

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/259 (20%), Positives = 114/259 (44%), Gaps = 10/259 (3%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-----PLTICIFMIA 65
                +    G LG F + ++ +  GD I+H+AL G+A++ +         L +   +  
Sbjct: 17  LGTAVLGAICGMLGSFAVLRKQSLLGDAISHAALPGIAVAFLITGAKDSNVLLLGALVSG 76

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLFGDIL 121
            +    +  I     L +D  LG+I        +++L++++         L  +LFG   
Sbjct: 77  LIGVFWIRGITTKTHLKTDTALGLILSLFFGFGMLLLTYIQKQPNANQAGLDKYLFGQAA 136

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +  +D+LL+  +  ++++++   WK       +   A   G   + I  +      L I
Sbjct: 137 TLVESDVLLMVTVTGISLLVMLLFWKEFKLLLFDKNYAMTLGFNTKFIDGLISFFIVLAI 196

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL-IFDTPS 240
            + ++ +G+ L++++L+ P   AR+++     M ILA I G    + G   S    +  +
Sbjct: 197 VIGLQTVGVVLMSAMLLAPAAAARQWTNRLSTMVILAAIFGAFSGVFGTAISASQNNLST 256

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP I++ +    I+SF + 
Sbjct: 257 GPVIVLVAAVFVIVSFLFS 275


>gi|75763114|ref|ZP_00742891.1| Manganese transport system membrane protein mntB [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218898239|ref|YP_002446650.1| metal ABC transporter, permease protein [Bacillus cereus G9842]
 gi|74489399|gb|EAO52838.1| Manganese transport system membrane protein mntB [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218540730|gb|ACK93124.1| metal ABC transporter, permease protein [Bacillus cereus G9842]
          Length = 288

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 75/258 (29%), Positives = 148/258 (57%), Gaps = 1/258 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I  
Sbjct: 12  QYSFLQKALLTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGA 71

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++L
Sbjct: 72  VLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNVL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           +V ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++ 
Sbjct: 131 SVRSSDMWMTLIIGVVIIGLVMLFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVT 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  SG
Sbjct: 191 VASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASG 250

Query: 242 PSIIITSLFLFILSFFYK 259
            +I++ + FLF L+FF+ 
Sbjct: 251 ATIVLVATFLFGLAFFFS 268


>gi|239931396|ref|ZP_04688349.1| metal transport ABC transporter [Streptomyces ghanaensis ATCC
           14672]
 gi|291439769|ref|ZP_06579159.1| metal transport system ABC transporter permease [Streptomyces
           ghanaensis ATCC 14672]
 gi|291342664|gb|EFE69620.1| metal transport system ABC transporter permease [Streptomyces
           ghanaensis ATCC 14672]
          Length = 300

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 128/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSWSPVWMAA 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  ++ ++      N +LTS+LFG + 
Sbjct: 66  LVSVLGAVLMELIRWYGRTRGDIALAMLFYGGMAGGVMFINLAPTGSNANLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSASDVTAICVLAAFVVLVTVGLRRQLFAVSQDEEFARVTGLPVRFLNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ S S      LA  IG+   + G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLSRSFAATFALAVAIGVSVTLGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++  FI+
Sbjct: 246 ATIVLLTIGAFIV 258


>gi|326333988|ref|ZP_08200218.1| ABC zinc/manganese transport system permease protein
           [Nocardioidaceae bacterium Broad-1]
 gi|325948267|gb|EGD40377.1| ABC zinc/manganese transport system permease protein
           [Nocardioidaceae bacterium Broad-1]
          Length = 339

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 125/258 (48%), Gaps = 5/258 (1%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL +   + ++   +G +I+ +R+A  GD I H A+ GVA+ L  Q   T    +
Sbjct: 10  PFMQRALIAAFLVGIAAPAVGTYIVQRRLALMGDGIGHVAVTGVAIGLWTQTSPTWTAVV 69

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +A   ++V+  +++      D  L ++ +  ++  + +        + L  FLFG IL +
Sbjct: 70  VAIAGAVVIEVVRERGHAEGDVALAMLFYGGLAGGVFVTGLAGTGASRLQEFLFGSILTI 129

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+L+   +  + I+I   +   L A + + + AK  G+      ++  ++ +L + +
Sbjct: 130 SVDDLLVTMALAVVLIVICVGLSPQLFAVSQDADYAKVAGLPVRFYSILVAVLAALSVVI 189

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIF-----DT 238
           +++ +G+ L+++L+++P    ++ + S     + A   G+   + GL  +        + 
Sbjct: 190 AMRTVGLLLVSALMVVPVAIVQQLTRSFRMTLLGAMGAGLAASVGGLVLAAALSRTGANV 249

Query: 239 PSGPSIIITSLFLFILSF 256
             GPSI++ +L  F L +
Sbjct: 250 QPGPSIVLVALAGFFLVW 267


>gi|222081879|ref|YP_002541244.1| zinc ABC transporter [Agrobacterium radiobacter K84]
 gi|221726558|gb|ACM29647.1| zinc ABC transporter [Agrobacterium radiobacter K84]
          Length = 281

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 63/255 (24%), Positives = 118/255 (46%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL   + I + T  L CF++ +  A  GD ++H+   GV ++ I   PL +  F 
Sbjct: 14  DFMVNALIISVLIAVPTALLSCFLVLKGWALMGDAMSHAVFPGVVIAYIVGFPLAVGAFA 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +L    ++ N  +  D ++G++        LV+   ++     L   LFGD+L +
Sbjct: 74  AGMVCALATGFLKDNSRIKQDTVMGIVFSGMFGFGLVLYVKIQ-SEVHLDHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DI+    +  L   ++   W+ LL    +   A+A G++   +    + + SL I  
Sbjct: 133 GWQDIMETAAVAVLAAAVIAVKWRDLLLHAFDPAQARAVGLRVNLLHYGLLCLLSLTIVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +GI L  SLLI P   A   +     M +L+ +I +     G+Y S   D+   P+
Sbjct: 193 TLQSVGIILAISLLIAPGAIAYLLARRFSVMLVLSVVIAVTAAFSGVYLSFFIDSAPAPT 252

Query: 244 IIITSLFLFILSFFY 258
           I++     F+ +F Y
Sbjct: 253 IVLLLAITFVGAFLY 267


>gi|240949227|ref|ZP_04753571.1| chelated iron ABC transporter, permease [Actinobacillus minor
           NM305]
 gi|240296343|gb|EER46987.1| chelated iron ABC transporter, permease [Actinobacillus minor
           NM305]
          Length = 276

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 126/257 (49%), Gaps = 1/257 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL  G+ + L    L C+++ +  A  GD I+H+ L G+ ++ +  +PL I  F+
Sbjct: 15  PFIQQALLIGVVVALICAVLSCYLVLKGWALMGDAISHAVLPGIVIAYLLAIPLAIGAFV 74

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++ +  +++N  +  D ++G++     +L LV+ + ++  +  L   LFGD+L +
Sbjct: 75  SGIFCAVAVGYLKENSRIKEDTVMGIVFSGMFALGLVMFAKVE-TDQHLMHILFGDLLGI 133

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             ++      I  + ++++    +  L    +   A+  G   + +    +++ +L+I  
Sbjct: 134 TNSEFYQTLAISLVVLLVILVKRRDFLLYCFDASHARTVGFNIKVLHYSLLVLLALVIIS 193

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +T    +   + M ++A    +     G++ S  FD  +GP 
Sbjct: 194 AMQVVGVILVVAMLITPGITGYILAKRFDRMLLIAIFTAVNSAFWGVFLSFHFDVATGPC 253

Query: 244 IIITSLFLFILSFFYKK 260
           I++     F++S    +
Sbjct: 254 IVLLQAVGFLISLTISR 270


>gi|294676686|ref|YP_003577301.1| zinc ABC transporter permease ZnuB [Rhodobacter capsulatus SB 1003]
 gi|294475506|gb|ADE84894.1| zinc ABC transporter, permease protein ZnuB [Rhodobacter capsulatus
           SB 1003]
          Length = 261

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 166/260 (63%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F IRA   G+G+ L+TGPLG F+IW+R+AYFGD  AH+A+LGVAL+  F + +   
Sbjct: 1   MLDDFLIRAALGGVGLTLATGPLGSFVIWRRMAYFGDATAHAAILGVALAYGFGVSVYAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
              +A   +L +  +      + D +LGV+ HS ++  LV  SF   +  DL++FLFGDI
Sbjct: 61  TLAVALAMALTVASLSGR-GHAMDTVLGVLAHSALAFGLVAASFFSGLRVDLSAFLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TD+ +IWG   L   +L   W+ LL  TVN ELA+A G+ P + +L+ ++  +L 
Sbjct: 120 LAVSRTDLAVIWGGSALVAAVLAWRWQGLLTATVNEELAQASGLDPRRERLVLVLALALT 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G  LI +LLI+P   AR+ +  PE MA+ AT IG L ++ GL  SL FDTP+
Sbjct: 180 VAVAIKIVGALLIAALLIVPAAAARQLARGPETMALAATGIGALAVLGGLQASLAFDTPA 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GPSI+  +  +F L+   ++
Sbjct: 240 GPSIVAVAAGIFALTLLLRR 259


>gi|327468666|gb|EGF14145.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK330]
          Length = 287

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|315634604|ref|ZP_07889888.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Aggregatibacter segnis ATCC 33393]
 gi|315476552|gb|EFU67300.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Aggregatibacter segnis ATCC 33393]
          Length = 261

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 171/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +G+ + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   DILFPAWITGMVLSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L S+ ++ ++ N   S D +LG+I HS +S+ +V +  ++ V  DL S+LFGD+LA+
Sbjct: 63  LTILLSIAMVWLENNTQFSVDTLLGIIAHSCLSIGVVTVGLLQNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + +  L   WKPL++TT++ ELA+ EG+  ++++ I +++T+L I++
Sbjct: 123 TYDDLIYISLGAIVVLTALIYFWKPLISTTISPELAQVEGINVKRMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P   A+RF+ +PE+M  +A I+ +L + +GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAAAAKRFARTPESMVGIAVIVSMLAVSMGLTLSAYYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I + FLF+ S   K
Sbjct: 243 VVICATFLFLCSLLKK 258


>gi|170650819|ref|YP_001739970.1| iron/manganese transport system membrane protein SitC [Escherichia
           coli SMS-3-5]
 gi|194446913|ref|YP_002038964.1| iron/manganese transport system inner membrane protein SitC
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|310286477|ref|YP_003937738.1| SitC protein, iron transporter, inner membrane component
           [Escherichia coli]
 gi|170522095|gb|ACB20272.1| iron/manganese transport system membrane protein SitC [Escherichia
           coli SMS-3-5]
 gi|194358665|gb|ACF57108.1| iron/manganese transport system inner membrane protein SitC
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|301130382|gb|ADK62183.1| iron/manganese transport system inner membrane protein SitC
           [Salmonella enterica subsp. enterica serovar Kentucky]
 gi|301130510|gb|ADK62310.1| iron/manganese transport system inner membrane protein SitC
           [Salmonella enterica subsp. enterica serovar Kentucky]
 gi|308826806|emb|CBX36075.1| SitC protein, iron transport protein, inner membrane component
           [Escherichia coli]
 gi|315288530|gb|EFU47928.1| ABC 3 transport family protein [Escherichia coli MS 110-3]
 gi|325495785|gb|EGC93646.1| iron/manganese transport system membrane protein SitC [Escherichia
           fergusonii ECD227]
          Length = 285

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQLTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|302035765|ref|YP_003796087.1| manganese transport system permease [Candidatus Nitrospira
           defluvii]
 gi|300603829|emb|CBK40161.1| Manganese transport system, permease component [Candidatus
           Nitrospira defluvii]
          Length = 273

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 135/254 (53%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  R+L +   +      +G F++ + +A+ G   AH+A  GV L+ +  LP      
Sbjct: 7   YDFMQRSLLAAALVGAVCSVIGVFVVLRGLAFAGAGTAHAAFAGVTLAYLLGLPPLSLAI 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    T  +   +++   +  D  +G++  +T++LA++ L  MK  N ++  +LFG +L+
Sbjct: 67  VFGLTTVWITGWVEEKGRMKLDVSIGILYTATMALAILFLGLMKTYNPEVYGYLFGSVLS 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V T +++ I G+  + +  +  + K L     + E+A A G+   +I  + + + +L + 
Sbjct: 127 VTTEELMTIGGLSVVVLGTILLLSKELYFIAFDQEMAAASGIPARQIFYLLLTLVALTVV 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           +++K +G  L+ +++++P  TA + + S   M + + +IGI   + G+  S  FD PSGP
Sbjct: 187 IALKTVGAILVFAMILIPASTAYQLTHSLTQMTLYSMLIGIFCAVSGVLLSYAFDLPSGP 246

Query: 243 SIIITSLFLFILSF 256
           SI++ +  LF L+ 
Sbjct: 247 SIVLLATSLFFLAV 260


>gi|302551283|ref|ZP_07303625.1| metal transport ABC transporter [Streptomyces viridochromogenes DSM
           40736]
 gi|302468901|gb|EFL31994.1| metal transport ABC transporter [Streptomyces viridochromogenes DSM
           40736]
          Length = 300

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 126/253 (49%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLTWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW-VNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  ++ ++      N  LTS+LFG + 
Sbjct: 66  LVSVLGAVLMELIRWYGRTRGDLALAMLFYGGMAGGVMFINLAPTGSNASLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSESDVTAICVLAAFVVLVTLGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++   S      +A  IG+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQIGRSFAATFAIAVAIGVSVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++  FI+
Sbjct: 246 ATIVLLTIGAFIV 258


>gi|125623968|ref|YP_001032451.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|124492776|emb|CAL97731.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|300070741|gb|ADJ60141.1| manganese transport system membrane protein [Lactococcus lactis
           subsp. cremoris NZ9000]
          Length = 279

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 142/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I     
Sbjct: 14  FLQNALITAVVIGIVSGAVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIAF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L+SL++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLSSLIITYIKNNSLIKGDTAIGITFSSFLALGIILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  L  G+    ++++   +K LL T+ +  +AKA GM+      + +++ +L+   +
Sbjct: 133 DIDKWLTIGVSIFVLIVIALFFKQLLITSFDPLMAKAIGMKVNFYHYLLMVLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M IL++ IG +  ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYTNSLKKMLILSSSIGAISSVLGLFIGYTFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           +ITS  +F +SF   
Sbjct: 253 VITSAIIFAVSFLIS 267


>gi|52081046|ref|YP_079837.1| transcriptional regulator [Bacillus licheniformis ATCC 14580]
 gi|52786423|ref|YP_092252.1| YceA [Bacillus licheniformis ATCC 14580]
 gi|319644996|ref|ZP_07999229.1| YceA protein [Bacillus sp. BT1B_CT2]
 gi|52004257|gb|AAU24199.1| transcriptional regulator [Bacillus licheniformis ATCC 14580]
 gi|52348925|gb|AAU41559.1| YceA [Bacillus licheniformis ATCC 14580]
 gi|317392805|gb|EFV73599.1| YceA protein [Bacillus sp. BT1B_CT2]
          Length = 286

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 75/266 (28%), Positives = 140/266 (52%), Gaps = 8/266 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVA--------LSLIFQ 54
            EF   A  SGI I L    LG FI+ +R++   D ++H +L G+A         +++  
Sbjct: 8   YEFLQNAFISGILIGLIAPLLGVFIVVRRLSLIADALSHVSLAGIAASLYAGKQFAVLAG 67

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTS 114
           +         +   SL++ +++       +  + +I    I ++++ +S     NTDL S
Sbjct: 68  VSPIYFGMAFSVAGSLIIERLRTVYKHYQELAIPIIMSGGIGISVIFISLADGFNTDLFS 127

Query: 115 FLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFI 174
           +LFG + AV+  D+L+I GI    ++++F ++K L   + + E AKA G+  + I  IFI
Sbjct: 128 YLFGSVSAVSREDMLVIVGISAAVLIVVFSLFKELFLLSFDEEHAKASGISAKWIHFIFI 187

Query: 175 MITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL 234
           +I +L+I+ S++ +G  L+++L+ LP   + R +   +    L+ + G L +I+GL  + 
Sbjct: 188 LIVALVIAASMRIVGTLLVSALMTLPVAASMRIAKGFKQAIFLSILFGELSVIVGLVLAY 247

Query: 235 IFDTPSGPSIIITSLFLFILSFFYKK 260
             D   G +I++ S+F+ IL   Y K
Sbjct: 248 HLDLAPGGTIVMLSIFILILCISYNK 273


>gi|325286594|ref|YP_004262384.1| ABC-type transporter, integral membrane subunit [Cellulophaga
           lytica DSM 7489]
 gi|324322048|gb|ADY29513.1| ABC-type transporter, integral membrane subunit [Cellulophaga
           lytica DSM 7489]
          Length = 374

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/267 (21%), Positives = 118/267 (44%), Gaps = 10/267 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQL-----PL 57
           +            +    G LG F + ++ +  GD I+H+AL G+AL+ +         L
Sbjct: 13  DYTLQTITLGTAILGALCGMLGSFAVLRKQSLLGDAISHAALPGIALAFLITGAKDSNTL 72

Query: 58  TICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLT 113
            I   +   + +  +  I K   L SD  LG+I        +++L+F++         L 
Sbjct: 73  LIGALVSGLVGTFWIRGIVKKTHLKSDTALGLILSLFFGFGMLLLTFIQKMPNANQAGLD 132

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
            +LFG    +  +D+  +  I  L+++IL   WK       + +  K+ G   + + ++ 
Sbjct: 133 KYLFGQAATLVASDVWTMCVIAGLSLLILLVFWKEFKLLLFDADYTKSLGFNVKFLDVLI 192

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
                + I V ++ +G+ L++++L+ P   AR+++ S   M +LA + G    + G   S
Sbjct: 193 TFFIVISIVVGLQTVGVVLMSAMLLAPAAAARQWTNSLGVMVVLAAVFGAFSGVFGTAIS 252

Query: 234 LIF-DTPSGPSIIITSLFLFILSFFYK 259
               +  +GP I++ +    + SF + 
Sbjct: 253 ASSNNLSTGPVIVLIAAVFVLFSFIFS 279


>gi|300742514|ref|ZP_07072535.1| iron chelate ABC transporter, permease protein [Rothia dentocariosa
           M567]
 gi|300381699|gb|EFJ78261.1| iron chelate ABC transporter, permease protein [Rothia dentocariosa
           M567]
          Length = 289

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 131/255 (51%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RA+   +   +    L C+++    +  GD I+H+ L GV L+ I  +P  +   +
Sbjct: 14  PFMTRAMVVTVIAAVVCALLSCWLVMLGWSLMGDAISHAVLPGVVLAYIAGIPFAVGAVI 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A +   ++  +Q++  +  DA +G++  +  +L LV++S     +TDL   LFG++L V
Sbjct: 74  AALVAVTLIGAVQRSGRVREDAAIGIVFTTLFALGLVLVSVTP-SSTDLNHILFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  +  +  +   +L    +  +    +   A A G++P  +  + +++ +L   V
Sbjct: 133 SWPDVWQVAILAVIVAGVLLIKRRDFILYAFDRGFAHAIGLRPRALGALLLVMLALTSVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++L++P  TAR  +     M  ++  + +LG ++GLY S   D   G +
Sbjct: 193 ALQIVGVVLVVAMLVIPGSTARLLTDRFTPMLAVSVGVSVLGTLVGLYSSYHLDISPGGA 252

Query: 244 IIITSLFLFILSFFY 258
           +++T   +F+ ++ +
Sbjct: 253 VVVTQGIIFLTAYIF 267


>gi|332292038|ref|YP_004430647.1| ABC-3 protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170124|gb|AEE19379.1| ABC-3 protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 370

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 120/270 (44%), Gaps = 11/270 (4%)

Query: 1   MYNEFFIRAL-FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP--- 56
           +++++ +R +      +    G LG F + ++ +  GD I+H+AL G+A++ +       
Sbjct: 10  LFSDYTLRTITLGTAILGAICGMLGSFAVLRKQSLLGDAISHAALPGIAIAFLITGTKDT 69

Query: 57  --LTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNT 110
             L +   +   + +  +  +     L SD  LG++        +++L+F++        
Sbjct: 70  NILLLGALVSGLIGTFWIRGMVTKTHLKSDTALGLVLSLFFGFGMLLLTFIQKQPNANQA 129

Query: 111 DLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIK 170
            L  +LFG    +   D+ L+  +  + ++I+   WK       + +  K  G     I 
Sbjct: 130 GLDKYLFGQAATLVEKDVTLMAVVTGICLVIMLLFWKEFKILLFDADYTKTLGFNTRFID 189

Query: 171 LIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGL 230
           ++      L I + ++ +G+ L++++L+ P   AR+++     M +LA I G    + G 
Sbjct: 190 ILITFFIVLAIVLGLQTVGVVLMSAMLLAPAAAARQWTNKLSVMIVLAAIFGAFSGVFGT 249

Query: 231 YGSL-IFDTPSGPSIIITSLFLFILSFFYK 259
             S    +  +GP I++ +    + SF + 
Sbjct: 250 AISASQNNLSTGPVIVLVASVFVLFSFIFS 279


>gi|218534496|ref|YP_002401026.1| SitC protein, iron transport protein, inner membrane component
           [Escherichia coli S88]
 gi|218349700|emb|CAQ87092.1| SitC protein, iron transport protein, inner membrane component
           [Escherichia coli S88]
          Length = 285

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQLTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWASYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|78213011|ref|YP_381790.1| ABC transporter [Synechococcus sp. CC9605]
 gi|78197470|gb|ABB35235.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           CC9605]
          Length = 274

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 125/255 (49%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F ++AL     +    G L CF+  +  A  GD ++H+ L GV ++    LP ++  F
Sbjct: 10  HAFMVKALMISALVGGVCGLLSCFMTLKGWALMGDAVSHAVLPGVVVAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  D+     I  L +++L    + L+    +   A++ G+    +  + + + SL   
Sbjct: 129 ISAGDVQQTLVISVLVLVLLLLFRRDLMLFCFDPTHARSIGINTGLLHYMLLGLLSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ S+L+ P  TA   +   + M +LA    +L  ++G++ S   D+ +  
Sbjct: 189 AGLQTVGIILVVSMLVTPGATAYLLTDRFDRMTLLAVTSSVLSSVLGVFISYWTDSSTAG 248

Query: 243 SIIITSLFLFILSFF 257
            I++     F+L+F 
Sbjct: 249 CIVLAQTAQFVLAFL 263


>gi|157418262|ref|YP_001481334.1| SitC [Escherichia coli APEC O1]
 gi|169546420|ref|YP_001711859.1| SitC [Escherichia coli]
 gi|222104895|ref|YP_002539384.1| SitC [Escherichia coli]
 gi|300825155|ref|ZP_07105246.1| ABC 3 transport family protein [Escherichia coli MS 119-7]
 gi|300905610|ref|ZP_07123358.1| ABC 3 transport family protein [Escherichia coli MS 84-1]
 gi|301306721|ref|ZP_07212776.1| ABC 3 transport family protein [Escherichia coli MS 124-1]
 gi|331652647|ref|ZP_08353658.1| iron transport protein, inner membrane component [Escherichia coli
           M718]
 gi|331685914|ref|ZP_08386491.1| iron transport protein, inner membrane component [Escherichia coli
           H299]
 gi|47118339|gb|AAT11266.1| inner membrane component [Escherichia coli]
 gi|86604482|emb|CAJ21598.1| iron transport protein, inner-membrane component SitC [Escherichia
           coli]
 gi|88770312|gb|ABD51749.1| SitC [Escherichia coli APEC O1]
 gi|168830972|gb|ACA34753.1| SitC [Escherichia coli]
 gi|221589320|gb|ACM18317.1| SitC [Escherichia coli]
 gi|300402548|gb|EFJ86086.1| ABC 3 transport family protein [Escherichia coli MS 84-1]
 gi|300522354|gb|EFK43423.1| ABC 3 transport family protein [Escherichia coli MS 119-7]
 gi|300838039|gb|EFK65799.1| ABC 3 transport family protein [Escherichia coli MS 124-1]
 gi|312914831|dbj|BAJ38805.1| SitC [Salmonella enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|312945779|gb|ADR26606.1| SitC [Escherichia coli O83:H1 str. NRG 857C]
 gi|312949163|gb|ADR29989.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315252683|gb|EFU32651.1| ABC 3 transport family protein [Escherichia coli MS 85-1]
 gi|331049753|gb|EGI21819.1| iron transport protein, inner membrane component [Escherichia coli
           M718]
 gi|331076867|gb|EGI48088.1| iron transport protein, inner membrane component [Escherichia coli
           H299]
          Length = 285

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQLTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|88808311|ref|ZP_01123821.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           WH 7805]
 gi|88787299|gb|EAR18456.1| ABC transporter component, possibly Mn transport [Synechococcus sp.
           WH 7805]
          Length = 278

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 59/248 (23%), Positives = 122/248 (49%), Gaps = 1/248 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F ++AL     +    G L C++  +  A  GD ++H+ L GV L+    LP ++  F
Sbjct: 10  HAFMLKALLISGLVGGVCGLLSCYMTLKGWALMGDAVSHAVLPGVVLAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVATIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++++DIL    I  + I++L    + LL    +   A++ G+    +  + + + SL   
Sbjct: 129 ISSSDILQTVLISSVVIVLLLLFRRDLLLFCFDPTHARSIGINTGVLHYLLLSVLSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   +   + M  LA    +L  ++G+Y S   D+ +  
Sbjct: 189 AGLQTVGIILVVAMLVTPGATAYLLTDRFDRMTWLAIGSSVLSSLLGVYVSYWTDSSTAG 248

Query: 243 SIIITSLF 250
            I++    
Sbjct: 249 CIVLVQTG 256


>gi|327459549|gb|EGF05895.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1]
          Length = 287

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPATTAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|313145239|ref|ZP_07807432.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134006|gb|EFR51366.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 272

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 64/259 (24%), Positives = 128/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   L   + 
Sbjct: 7   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYTGLSPILS 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + K + +  D+ + +     ++L ++          DL+++LFG+I
Sbjct: 67  AAVFSVLSAFGVEWLSKRKDMREDSAIAMFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +  TD+L++  +  L I+       P++    + E A+++G+    ++ I +M  +L 
Sbjct: 127 LTITQTDLLMLGILAILLILFFTLFIHPIIYIAFDREFARSQGIPVVVLEYILMMFIALT 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+   + +  L+  IG L  + GL  S   + PS
Sbjct: 187 IVSCLRMVGIVLAISLLTIPQMTANLFTNKFKRIIWLSIAIGYLSCLGGLLISYRLNVPS 246

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++I     K
Sbjct: 247 GASIIFFSILIYIACKIGK 265


>gi|70725143|ref|YP_252057.1| hypothetical protein SH0142 [Staphylococcus haemolyticus JCSC1435]
 gi|68445867|dbj|BAE03451.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 278

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 77/258 (29%), Positives = 147/258 (56%), Gaps = 1/258 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F  RAL + I + +  G +G  II + ++  GD ++H+ L GVALS +F +P+ +   
Sbjct: 11  YQFLNRALITSIVVGIVCGTVGSLIILRGLSLMGDAMSHAVLPGVALSFLFNIPMFVGAL 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + SL++  I  N     DA +G+   + ++  ++I+S +    TDL   LFG++LA
Sbjct: 71  VTGMIASLLIGYISNNSKTKPDAAIGISFTAFLATGVIIISLIN-STTDLHHILFGNLLA 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +          IG + I+++  +++PL+ +T +   ++  G+    I    +++ +L+  
Sbjct: 130 ITRQTFWTTIIIGVIVILLIVILYRPLMISTFDATFSRVSGLNTTMIHYFIMLLLALVTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            SI+ +GI L+ +LL+ P  TA   + +  +M I+A++IGI+  IIGLY S I++ PSG 
Sbjct: 190 ASIQTVGIILVVALLVTPASTAFLITKNLYSMMIVASLIGIVSSIIGLYFSFIYNLPSGA 249

Query: 243 SIIITSLFLFILSFFYKK 260
           +I+I +  ++IL+  + K
Sbjct: 250 TIVIATFSIYILTLLFSK 267


>gi|67923752|ref|ZP_00517217.1| ABC-3 [Crocosphaera watsonii WH 8501]
 gi|67854416|gb|EAM49710.1| ABC-3 [Crocosphaera watsonii WH 8501]
          Length = 298

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 125/254 (49%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F ++A++    + L    L C+I  +  +  GD I+H+ + GV ++    +P  I  F+ 
Sbjct: 21  FLVQAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHAVVPGVVIAYAINIPFAIGAFIF 80

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               ++ +  I+ N  L  DA++G++     +  LVI++ +   N DL   LFG++L ++
Sbjct: 81  GFGATIAIGYIKSNTRLKEDAVIGIVFTGFFAFGLVIITKIP-SNIDLFHILFGNVLGIS 139

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI+     G + ++I+    K LL    +   AKA G+  + +    + + +L I  +
Sbjct: 140 KSDIIQTLISGIITLVIILLRRKDLLLFCFDPNHAKAIGLNTQMMYYTLLSVLALTIVAA 199

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++  GI L+ S+L+ P       S   + M I++ I  +   + G Y S   D  +G SI
Sbjct: 200 LQTAGIILVISMLVTPGSIGYLLSDRFDYMLIISVISSVFSCVFGTYVSYHLDVSTGGSI 259

Query: 245 IITSLFLFILSFFY 258
           ++    LF+L+  +
Sbjct: 260 VVLLTLLFVLAMIF 273


>gi|331657908|ref|ZP_08358870.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA206]
 gi|315299958|gb|EFU59196.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 16-3]
 gi|331056156|gb|EGI28165.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA206]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMTYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|320095089|ref|ZP_08026798.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319977956|gb|EFW09590.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 308

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 129/255 (50%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   +  G +G  ++ + +A+ GD +AHS   G+A++ +    L +   +
Sbjct: 28  AFLPRALLMAVLAAVVCGAVGVHVVLRGMAFIGDAVAHSVFPGLAIAFLTSGSLVLGGAI 87

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T++++  +  +  L  D+I+GV+     +L +VI++        L  FLFG I  V
Sbjct: 88  AGVATAVLVALLSHSRRLKEDSIIGVLFVGAFALGVVIIARAPGYAGSLQDFLFGSITGV 147

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+ +  G G + + +L    + ++A T++ E A+  G++     L+     +L + +
Sbjct: 148 PASDVPVAIGGGAVVLTLLCVFHRWIVAVTLDRETARVAGVRILATDLVLYTAVALAVVI 207

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P   AR  +     M  L+  +G L  I+GLY S   D P+G +
Sbjct: 208 SVQTIGNVLVLALLVAPASIARLLTDRLFTMMWLSPALGALAGIVGLYLSWSIDVPTGAT 267

Query: 244 IIITSLFLFILSFFY 258
           I++  +  F L++ +
Sbjct: 268 IVLVLIGFFALAWVF 282


>gi|331683365|ref|ZP_08383966.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H299]
 gi|331079580|gb|EGI50777.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H299]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 102/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G+L +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMLAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|238783392|ref|ZP_04627415.1| Chelated iron transport system membrane protein yfeC [Yersinia
           bercovieri ATCC 43970]
 gi|238715637|gb|EEQ07626.1| Chelated iron transport system membrane protein yfeC [Yersinia
           bercovieri ATCC 43970]
          Length = 294

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 126/256 (49%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +  +   L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAACAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++++IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSLVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + I+A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFGRLLIIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTVVFLLAFIF 265


>gi|197335109|ref|YP_002157163.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
 gi|197316599|gb|ACH66046.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           fischeri MJ11]
          Length = 273

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 104/260 (40%), Positives = 170/260 (65%), Gaps = 1/260 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++F  RA  +G+G+ L+T PLGCFI+W+R+AYFGD  AH+++LG+ALSL   LP+   
Sbjct: 1   MLDDFLWRATLAGVGVTLATAPLGCFIVWRRMAYFGDATAHASMLGIALSLALSLPILPS 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +  IA + ++ + +     + + D +LGV+ HS +++ LV +SF+  +  DL ++LFGDI
Sbjct: 61  VLFIALIMAITVSKFSGR-SYAMDTLLGVMAHSALAIGLVAVSFLSGIRLDLMAYLFGDI 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  D+ +IWG     I ++   W  LL +T++ +LA A    P++ +LI  +  +++
Sbjct: 120 LAVSKMDLFIIWGGALFIIGLIRFRWSGLLLSTLDKDLALASNFSPKREQLILTIALAIV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           ++V+IK +G+ LI ++LI+P   AR FS +PE M +LA +IG    I+GL  S +FDTP+
Sbjct: 180 VAVAIKVVGVLLIVAMLIIPAAAARPFSQTPEMMVVLAALIGSSSSILGLRASYLFDTPT 239

Query: 241 GPSIIITSLFLFILSFFYKK 260
           GP+I+  +  LFI S   +K
Sbjct: 240 GPTIVCIATGLFITSSLIRK 259


>gi|261341190|ref|ZP_05969048.1| iron chelate ABC transporter, permease protein AfeC [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316487|gb|EFC55425.1| iron chelate ABC transporter, permease protein AfeC [Enterobacter
           cancerogenus ATCC 35316]
          Length = 285

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 137/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  LSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG +++++L   WK L+ T  +   A+A G++PE++K++F  + ++   
Sbjct: 129 IAPEDILQLSIIGVVSMLVLLFKWKDLMVTFFDENHARAIGLRPERLKILFFTLLAVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSITSFLGAWASYYLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|294141799|ref|YP_003557777.1| iron (chelated) ABC transporter permease protein [Shewanella
           violacea DSS12]
 gi|293328268|dbj|BAJ02999.1| iron (chelated) ABC transporter, permease protein [Shewanella
           violacea DSS12]
          Length = 305

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 127/255 (49%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  +A    + + + T  L CF++ +  +  GD I+HS L GV L+ +  +P  I  F  
Sbjct: 20  FMHQAFMIVLLVAIPTSVLSCFLVLKGWSLMGDAISHSVLPGVILAYVLSIPYAIGAFAA 79

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               +L    I+ N  L  D ++GV+  S   L LV+++ ++     L   LFGD+L V+
Sbjct: 80  GMFCALATGFIKDNSRLKEDTVMGVVFSSMFGLGLVLMTKVE-TGVHLDHILFGDVLGVS 138

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            TD+L   GI  L I  +    + LL    +++ AKA G+    +    + I SL I  +
Sbjct: 139 WTDVLEAGGIALLVISFILFKGRDLLVFVFDHQHAKAIGLPVNLLHYGLLSILSLTIVGA 198

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +K +G+ L+ ++LI P   A   +   ++M ++A  I  L   +G+Y S   D+   P+I
Sbjct: 199 LKAVGMILVVAMLIAPGAIAFLLTRKFQSMMLIALFISTLTSFLGVYLSFFIDSAPAPTI 258

Query: 245 IITSLFLFILSFFYK 259
           I+    +FI  FFY 
Sbjct: 259 IMLMTLIFICVFFYS 273


>gi|329298644|ref|ZP_08255980.1| high-affinity zinc transporter membrane component [Plautia stali
           symbiont]
          Length = 259

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 100/256 (39%), Positives = 166/256 (64%), Gaps = 2/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLGGVLLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M+ V  DL  +LFGD+LA+
Sbjct: 63  LTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMQGVRVDLMVYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ L+ G   + ++++   W+ LL+ T++ ELA+ +G      +   +++T+L I V
Sbjct: 123 TPDDLSLMAGGVAIVLVVMAWQWRSLLSMTISPELAQVDG--VNIQRTCLMLVTALTIGV 180

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS SPE MA  A +IGI+ +  GL  S  +DTP+GPS
Sbjct: 181 AMKFVGALIITSLLIIPAATARRFSRSPEQMAGFAVLIGIIAVTGGLTFSASYDTPAGPS 240

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI+S   K
Sbjct: 241 VVLCAAVLFIISMAKK 256


>gi|300865795|ref|ZP_07110549.1| ABC-3 protein [Oscillatoria sp. PCC 6506]
 gi|300336208|emb|CBN55704.1| ABC-3 protein [Oscillatoria sp. PCC 6506]
          Length = 281

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 136/255 (53%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EFF RAL   +   L  G +G +I  +R++Y    ++H+ L G  LS +  L   I   
Sbjct: 10  YEFFSRALLVAMMAGLLCGVIGVYITTRRMSYIAHGLSHAILGGAVLSYVLGLNFYIGSG 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   +++L+ +Q      + SDA +G++T ++ +L + I+S  +  + +  + LFG++L 
Sbjct: 70  IWGFVSALL-IQYLTGRKIYSDAAIGIVTTASFALGVAIISSSRKFSQNFEAALFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V   D+ ++ G+  + + ++F  ++PLL    + E+A+  G+  + +  +F ++ + ++ 
Sbjct: 129 VTPEDLWIVTGVTVILLSLVFVFYQPLLFWCFDREVAQVHGVPVKAMDTLFALMLATLLV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            ++  +G+TLI S +++P  TAR  S     + +++  +G     +G+Y S  FD  SG 
Sbjct: 189 TTLNILGVTLIISAVVIPASTARLLSDRFSYIMLISGGLGAAIAFVGVYLSYHFDIASGA 248

Query: 243 SIIITSLFLFILSFF 257
           S+++ S  +F     
Sbjct: 249 SVVLLSTLVFGGVLL 263


>gi|290893022|ref|ZP_06556011.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL J2-071]
 gi|290557382|gb|EFD90907.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL J2-071]
          Length = 280

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGINFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLVATIIFFIAFLF 264


>gi|297623013|ref|YP_003704447.1| ABC-3 protein [Truepera radiovictrix DSM 17093]
 gi|297164193|gb|ADI13904.1| ABC-3 protein [Truepera radiovictrix DSM 17093]
          Length = 316

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 70/254 (27%), Positives = 133/254 (52%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL + + +    G L CF++ +R A  GD I+H+ L GVA++ +   P  +  F+ 
Sbjct: 42  FMQRALLTTLVVGAVCGVLSCFVVLRRWALLGDAISHAVLPGVAVAYLLAWPYFVGAFVT 101

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             LT+L +  I+++  +  D  +G++     +L +V++S +    T L   LFG++L V 
Sbjct: 102 GALTALGIGFIERHTRIKEDTAMGLMFTGAFALGVVMISRIA-TATHLMHILFGNVLGVR 160

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
              +LL    G   ++ +F  +K L     +   A A G+    +    +++ +L I  S
Sbjct: 161 MPVLLLTLLAGAATLLAVFLFYKELSLYIFDPTQASAVGINTAAVHYGLMLLLTLTIVAS 220

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G+ L+ ++LI P  TA   S +   M +LA  +G++  ++GLY S   +  SG +I
Sbjct: 221 LETVGVILVVAMLITPGATAYLLSNNLPRMMLLAAGVGMVSGVVGLYLSFYLNVASGGTI 280

Query: 245 IITSLFLFILSFFY 258
           ++ +  LF+L+  +
Sbjct: 281 VLVASGLFVLALIF 294


>gi|271500730|ref|YP_003333755.1| ABC-3 protein [Dickeya dadantii Ech586]
 gi|270344285|gb|ACZ77050.1| ABC-3 protein [Dickeya dadantii Ech586]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 106/257 (41%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA+ L+  + L   +  
Sbjct: 3   ELLLPGWLAGVCLAVAAGPLGSFVVWRRMSYFGDTLAHASLLGVAIGLLLGVNLFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L ++ L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  ITLLLAVGLVWLERRPGLAIDTLLGIMAHSALSLGLVVVSLMNNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D+ LI     L + +L   W+ LL+ TV+ ELA  +G+   + KLI +++T+L I +
Sbjct: 123 TSEDLWLIGPGVLLVLAVLGWQWQALLSMTVSPELAHVDGVAIARTKLILMLVTALTIGL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRFS +PE MA+ A   GIL +  GL  S   +TP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFSRTPEQMALCAMGAGILAVTGGLAFSAEANTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCASLLFILSLLKKQ 259


>gi|194015237|ref|ZP_03053853.1| manganese transport system membrane protein MntB [Bacillus pumilus
           ATCC 7061]
 gi|194012641|gb|EDW22207.1| manganese transport system membrane protein MntB [Bacillus pumilus
           ATCC 7061]
          Length = 290

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 139/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  +ALF+ + + +  G +GCFII + +A  GD I+H+ L GVA+S +  +       
Sbjct: 10  YAFLQKALFTSVMVGIICGVIGCFIILRGMALMGDAISHAVLPGVAISYMLGINFFFGAV 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   LT++ +  + +N  + +D+ +G++  +  S+ +++++F+K  ++DL   LFG++LA
Sbjct: 70  LTGVLTAIGIGYVSQNSRIKNDSAIGIVFTAFFSIGIILITFLK-SSSDLYHILFGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V ++D+ +  GIG   ++ +   +K LL ++ +  ++   G+    I    + + +L+  
Sbjct: 129 VRSSDMWITLGIGIFILLAVIIFYKELLISSFDPVISSVYGLPNRMIHYFLMTLLTLVTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +GI L+ ++LI P  TA   +     M  L+   G +  + GL  S  ++  SG 
Sbjct: 189 ASLQTVGIILVVAMLITPAATAYLLTDRLWIMIYLSAFFGAVSAVAGLGLSFTYNLSSGA 248

Query: 243 SIIITSLFLFILSFFYK 259
           SI++ +  LF  +F   
Sbjct: 249 SIVLVATILFGSAFILS 265


>gi|108803984|ref|YP_643921.1| hypothetical protein Rxyl_1143 [Rubrobacter xylanophilus DSM 9941]
 gi|108765227|gb|ABG04109.1| ABC-3 [Rubrobacter xylanophilus DSM 9941]
          Length = 287

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 136/252 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  R L + + + +  G LG F++ + +A+ GD +AH++  GVAL+ +  L +    F+ 
Sbjct: 13  FMQRGLLASVLVAVVCGALGSFVVLKGLAFIGDALAHASFGGVALAFVLGLNVYAGAFVF 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A  T+L +  + ++  + SD  +GV+   T +L + ++S ++   TDL  +LFGD+L++ 
Sbjct: 73  ALATALGIGALSQHGKVRSDTAIGVLFSGTFALGIAVISGVESYTTDLFGYLFGDVLSIT 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+  I   G   + +L   ++ LL    +  +A A G+    ++ + + +  + I  +
Sbjct: 133 ARDLAAISLAGAAVLALLGLFYRQLLFVAFDPAVAAASGVPARALEYLLLALLGMTIVAA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L+ +LL+ P+ TA  F     +M + + ++G L  ++G+Y S   +  SG SI
Sbjct: 193 LQAVGIVLVVALLVTPSATAHLFCRRFHHMILASMVLGSLSALLGIYLSYYLNVASGASI 252

Query: 245 IITSLFLFILSF 256
           I+ +  LF  + 
Sbjct: 253 ILVATALFFAAL 264


>gi|300865219|ref|ZP_07110036.1| Manganese transport system membrane protein mntB [Oscillatoria sp.
           PCC 6506]
 gi|300336784|emb|CBN55186.1| Manganese transport system membrane protein mntB [Oscillatoria sp.
           PCC 6506]
          Length = 282

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 129/256 (50%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           +EF ++A+   + + +    L C++  +  A  GD ++H+ + GV ++ +  +PL I  F
Sbjct: 14  HEFMVKAVLVSMLVGVVCSVLSCYMTLKGWALMGDAVSHAVMPGVVIAYLLNIPLAIGAF 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    + + +  I+    +  D ++G++     +L LV++S  +  + DLT  LFG++L 
Sbjct: 74  VFGVGSVVAIGFIKSKTRIKEDTVIGLVFTGFFALGLVLISKTQ-SSVDLTHILFGNVLG 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DI+    I  + ++ +    K  L    +   A++ G+    +    + + SL   
Sbjct: 133 ISDGDIIQTIVISVIALVTIAIFRKDFLLFCFDPTHARSIGINTVALYYTLLSLLSLTAV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ ++L+ P  TA   + S + M +LAT  G+   ++GLY S   D  +G 
Sbjct: 193 AGLQTVGIILVVAMLVTPGATAYLLTDSFDYMMLLATASGVFSSVMGLYASYYLDASTGG 252

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+  +
Sbjct: 253 CIVVVQTLLFVLAMIF 268


>gi|217964407|ref|YP_002350085.1| hydrophobic membrane protein ZurM [Listeria monocytogenes HCC23]
 gi|217333677|gb|ACK39471.1| hydrophobic membrane protein ZurM [Listeria monocytogenes HCC23]
 gi|307571028|emb|CAR84207.1| zinc ABC transporter, permease protein [Listeria monocytogenes L99]
          Length = 292

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGLVIGIVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIVTILYQK 273


>gi|91211084|ref|YP_541070.1| high-affinity zinc transporter membrane component [Escherichia coli
           UTI89]
 gi|117624011|ref|YP_852924.1| high-affinity zinc transporter membrane component [Escherichia coli
           APEC O1]
 gi|157155379|ref|YP_001463162.1| high-affinity zinc transporter membrane component [Escherichia coli
           E24377A]
 gi|170019796|ref|YP_001724750.1| high-affinity zinc transporter membrane component [Escherichia coli
           ATCC 8739]
 gi|191172985|ref|ZP_03034519.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli F11]
 gi|194439081|ref|ZP_03071164.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 101-1]
 gi|209919226|ref|YP_002293310.1| high-affinity zinc transporter membrane component [Escherichia coli
           SE11]
 gi|218554447|ref|YP_002387360.1| high-affinity zinc transporter membrane component [Escherichia coli
           IAI1]
 gi|218558724|ref|YP_002391637.1| high-affinity zinc transporter membrane component [Escherichia coli
           S88]
 gi|218699569|ref|YP_002407198.1| high-affinity zinc transporter membrane component [Escherichia coli
           IAI39]
 gi|237705813|ref|ZP_04536294.1| zinc uptake ABC transporter [Escherichia sp. 3_2_53FAA]
 gi|253773184|ref|YP_003036015.1| high-affinity zinc transporter membrane component [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161919|ref|YP_003045027.1| high-affinity zinc transporter membrane component [Escherichia coli
           B str. REL606]
 gi|293410171|ref|ZP_06653747.1| znuB [Escherichia coli B354]
 gi|300904743|ref|ZP_07122573.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 84-1]
 gi|300928890|ref|ZP_07144395.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 187-1]
 gi|300982163|ref|ZP_07175898.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 200-1]
 gi|301304448|ref|ZP_07210560.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 124-1]
 gi|306814311|ref|ZP_07448477.1| high-affinity zinc transporter membrane component [Escherichia coli
           NC101]
 gi|312969899|ref|ZP_07784082.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1827-70]
 gi|91072658|gb|ABE07539.1| ZnuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           UTI89]
 gi|115513135|gb|ABJ01210.1| ZnuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           APEC O1]
 gi|157077409|gb|ABV17117.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E24377A]
 gi|169754724|gb|ACA77423.1| ABC-3 protein [Escherichia coli ATCC 8739]
 gi|190906696|gb|EDV66301.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli F11]
 gi|194422040|gb|EDX38044.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 101-1]
 gi|209912485|dbj|BAG77559.1| zinc ABC transporter permease component [Escherichia coli SE11]
 gi|218361215|emb|CAQ98799.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli IAI1]
 gi|218365493|emb|CAR03220.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli S88]
 gi|218369555|emb|CAR17324.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli IAI39]
 gi|222033608|emb|CAP76349.1| High-affinity zinc uptake system membrane protein znuB [Escherichia
           coli LF82]
 gi|226900570|gb|EEH86829.1| zinc uptake ABC transporter [Escherichia sp. 3_2_53FAA]
 gi|242377580|emb|CAQ32335.1| znuB, subunit of ZnuA/ZnuB/ZnuC ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253324228|gb|ACT28830.1| ABC-3 protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973820|gb|ACT39491.1| high-affinity zinc transporter membrane component [Escherichia coli
           B str. REL606]
 gi|253978014|gb|ACT43684.1| high-affinity zinc transporter membrane component [Escherichia coli
           BL21(DE3)]
 gi|291470639|gb|EFF13123.1| znuB [Escherichia coli B354]
 gi|294493785|gb|ADE92541.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli IHE3034]
 gi|300307319|gb|EFJ61839.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 200-1]
 gi|300403327|gb|EFJ86865.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 84-1]
 gi|300463118|gb|EFK26611.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 187-1]
 gi|300840299|gb|EFK68059.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 124-1]
 gi|305852470|gb|EFM52921.1| high-affinity zinc transporter membrane component [Escherichia coli
           NC101]
 gi|307626658|gb|ADN70962.1| high-affinity zinc transporter membrane component [Escherichia coli
           UM146]
 gi|309702083|emb|CBJ01397.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           ETEC H10407]
 gi|310338184|gb|EFQ03273.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1827-70]
 gi|312946459|gb|ADR27286.1| high-affinity zinc transporter membrane component [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315257310|gb|EFU37278.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 85-1]
 gi|315286572|gb|EFU46007.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 110-3]
 gi|320194425|gb|EFW69056.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli WV_060327]
 gi|323186365|gb|EFZ71715.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1357]
 gi|323937117|gb|EGB33397.1| ABC 3 transporter [Escherichia coli E1520]
 gi|323948255|gb|EGB44243.1| ABC 3 transporter [Escherichia coli H120]
 gi|323952361|gb|EGB48234.1| ABC 3 transporter [Escherichia coli H252]
 gi|323956490|gb|EGB52232.1| ABC 3 transporter [Escherichia coli H263]
 gi|323961914|gb|EGB57513.1| ABC 3 transporter [Escherichia coli H489]
 gi|323972633|gb|EGB67836.1| ABC 3 transporter [Escherichia coli TA007]
 gi|324007234|gb|EGB76453.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 57-2]
 gi|324012872|gb|EGB82091.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 60-1]
 gi|324018002|gb|EGB87221.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 117-3]
 gi|332343585|gb|AEE56919.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli UMNK88]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|163753602|ref|ZP_02160725.1| hypothetical protein KAOT1_18307 [Kordia algicida OT-1]
 gi|161325816|gb|EDP97142.1| hypothetical protein KAOT1_18307 [Kordia algicida OT-1]
          Length = 356

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 118/259 (45%), Gaps = 10/259 (3%)

Query: 11  FSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLP-----LTICIFMIA 65
                +    G LG F + ++ +  GD I+H+AL G+A++ +         L +   +  
Sbjct: 1   MGTAILGAICGMLGSFAVLRKQSLLGDAISHAALPGIAIAFLITGVKDSNLLLLGALISG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKW----VNTDLTSFLFGDIL 121
            + +  +  I +   L SD  LG+         +++L+F++         L ++LFG   
Sbjct: 61  LIGTFWIRGITQKTHLKSDTALGLTLSLFFGFGMLLLTFIQKQPNASQAGLDTYLFGQAA 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D+ LI  +  + ++I+F  WK       + E  K  G     I ++      + I
Sbjct: 121 TLLEKDVWLIAIVAGIALLIVFVFWKEFKILLFDPEYTKTLGFNTRFIDILITTFIVITI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS-LIFDTPS 240
            + ++ +G+ L++++L+ P   AR+++ S   M +LA I G    ++G   S +  +  +
Sbjct: 181 VLGLQTVGVILMSAMLLAPAAAARQWTNSLGIMVLLAAIFGAFSGVVGTGISTIEGNLST 240

Query: 241 GPSIIITSLFLFILSFFYK 259
           GP I++ +  + + SF + 
Sbjct: 241 GPVIVLVAASIVLFSFIFS 259


>gi|229134018|ref|ZP_04262838.1| Manganese transport system membrane protein mntC [Bacillus cereus
           BDRD-ST196]
 gi|228649353|gb|EEL05368.1| Manganese transport system membrane protein mntC [Bacillus cereus
           BDRD-ST196]
          Length = 278

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +  +   I 
Sbjct: 1   MQYGFLQKALLTSVMVGVICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 61  AVLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAVGIILITFMK-SSSDLYHILFGNV 119

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++
Sbjct: 120 LSVRSSDMWMTLIIGVVIISLVILFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMV 179

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ ++LI P  TA   +     M  LA  IG L  ++GLY S  ++  S
Sbjct: 180 TVASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLAS 239

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ + FLF L+FF+ 
Sbjct: 240 GATIVLVATFLFGLAFFFS 258


>gi|119962099|ref|YP_948966.1| ABC-type Mn2+/Zn2+/Fe2+ transport system, permease component
           [Arthrobacter aurescens TC1]
 gi|119948958|gb|ABM07869.1| putative ABC-type Mn2+/Zn2+/Fe2+ transport system, permease
           component [Arthrobacter aurescens TC1]
          Length = 275

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 128/254 (50%), Gaps = 1/254 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
            +RAL +     +    L C+++    +  GD ++H+ L GV L+ I   P  +   + A
Sbjct: 1   MVRALATTAIAAVVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIVGAPFALGALVFA 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
            +   ++  ++    +  DA +G++  S  +L LV++S      TDL   +FG++L V+ 
Sbjct: 61  LIAVTLIGVVRNTSRVKEDAAIGIVFTSLFALGLVLISVTP-SQTDLNHIIFGNLLGVSI 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            D++ +  +G +   IL    + L     +   A A G+ P+++  + + + +L   V++
Sbjct: 120 PDLIQVVVLGVVAFAILILKRRDLTLYAFDPTHAHAIGLSPKRLGALLLGLLALTSVVAL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G+ L+ ++LI+P  TA   +     M ++A +I ++  + G+Y S   DT SG  ++
Sbjct: 180 QTVGVVLVVAMLIIPGATAYLLTDRFSRMLVIAPVISVVCSVAGIYLSYYLDTASGAMVV 239

Query: 246 ITSLFLFILSFFYK 259
           +T   +F + + + 
Sbjct: 240 LTQGVVFAVVYLFS 253


>gi|52424844|ref|YP_087981.1| ZnuB protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306896|gb|AAU37396.1| ZnuB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI +   T PLG F++W+++AYFGDT++HSALLGVAL +   +   + I +
Sbjct: 3   EIIFPAWLTGILLSFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGICLDINPYLSILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL  +LFGD+LAV
Sbjct: 63  LTLILAVAMVWLESNTQFSVDTLLGIIAHSCLSLGVVTVGLLQNVRVDLMGYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I     + ++ L   WKPL++TTV+ ELA+ EG+   +++ I +++T+L I++
Sbjct: 123 SYEDLIYIGIGVLIVLISLIYFWKPLISTTVSPELAQVEGINIRRMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+MAI+A  + I+ + +GL  S  ++T +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMAIIAVGLSIVAVSLGLTLSAFYNTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S F+F++S   K
Sbjct: 243 VVICSSFIFLISLLKK 258


>gi|300951480|ref|ZP_07165315.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 116-1]
 gi|300956629|ref|ZP_07168908.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 175-1]
 gi|300316611|gb|EFJ66395.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 175-1]
 gi|300449230|gb|EFK12850.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 116-1]
 gi|323940473|gb|EGB36664.1| ABC 3 transporter [Escherichia coli E482]
          Length = 261

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVACGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S ++DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAVYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|238765233|ref|ZP_04626163.1| Chelated iron transport system membrane protein yfeC [Yersinia
           kristensenii ATCC 33638]
 gi|238696561|gb|EEP89348.1| Chelated iron transport system membrane protein yfeC [Yersinia
           kristensenii ATCC 33638]
          Length = 294

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDEGHALSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFSRLLVIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTVVFLLAFVF 265


>gi|159044205|ref|YP_001532999.1| ABC-3 metal transporter [Dinoroseobacter shibae DFL 12]
 gi|157911965|gb|ABV93398.1| ABC-3 metal transporter [Dinoroseobacter shibae DFL 12]
          Length = 283

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 67/256 (26%), Positives = 117/256 (45%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A    + I + T  L CF++ +  +  GD I+H+ L G+ L+ +  +PL    F 
Sbjct: 12  PFMQNAFLIAVLISVPTAILSCFVVLKGWSLMGDAISHAVLPGIVLAYVLGIPLIFGAFA 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L    +Q +  +  D ++GV+      L LVI + ++  N  L   LFG++L +
Sbjct: 72  AGMTCALATGYLQAHSRVKQDTVMGVVFSGMFGLGLVIYTKIE-TNMHLDHILFGNMLGI 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
            + D+     I  +   IL   W+  L    +   A+A G++   +    + + SL I  
Sbjct: 131 GSGDLATAGIIAVVVAGILLVKWRDFLLHAFDPAQARAVGLRVAWLHYGLLALISLTIVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +K +GI L   LLI P   A   +    +M  +A  +  L  I G+Y S   D+   P+
Sbjct: 191 VLKAVGIILAIGLLIAPGAIAFLVTKRFVHMLWIAVAVTCLASISGVYASFWLDSAPAPT 250

Query: 244 IIITSLFLFILSFFYK 259
           II+    +F+ +F +K
Sbjct: 251 IILILSAVFVAAFVHK 266


>gi|283786714|ref|YP_003366579.1| iron ABC transporter permease [Citrobacter rodentium ICC168]
 gi|282950168|emb|CBG89804.1| iron ABC transporter, permease protein [Citrobacter rodentium
           ICC168]
          Length = 288

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 65/255 (25%), Positives = 115/255 (45%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F + AL     + +    L  F++ +  A  GD ++H+   G+ L+ I  LPL +  F+
Sbjct: 13  DFMLNALTVSAIVAVPCALLSVFLVLKGWALMGDAMSHAVFPGIVLAYIIGLPLAVGAFI 72

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                ++    +  N  +  D I+G++        LV+   ++     L   LFGD+L V
Sbjct: 73  AGLFCAVATGYLDDNSRIKRDTIMGIVFSGMFGAGLVLYVSIQ-SEVHLDHILFGDMLGV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  DIL    I     +I+   WK LL    +   AKA G+    +    + + +L I  
Sbjct: 132 SLNDILQTALIALGIALIVSMKWKDLLLHAFDPHQAKASGLNVVLLHYGLLCMIALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +GI L  SLLI P   A   +       +LA  + +    +G+Y S   D+   P+
Sbjct: 192 TLKSVGIILSISLLIAPGAIAVLLTRRFARALLLAVALSVTTSFLGVYLSFFLDSAPAPT 251

Query: 244 IIITSLFLFILSFFY 258
           I++    +F+ +F Y
Sbjct: 252 IVVLFTVIFVAAFIY 266


>gi|290579681|ref|YP_003484073.1| putative Mn/Zn ABC transporter [Streptococcus mutans NN2025]
 gi|254996580|dbj|BAH87181.1| putative Mn/Zn ABC transporter [Streptococcus mutans NN2025]
          Length = 279

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   + 
Sbjct: 14  FLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L SL++  I++N  + SD  +G+   S ++L ++++  +   +TDL   LFG+ILAV 
Sbjct: 74  GLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILI-GLANSSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   +
Sbjct: 133 DMDKWITLGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F+LSF +
Sbjct: 253 VLTSALIFLLSFVF 266


>gi|145594570|ref|YP_001158867.1| ABC-3 protein [Salinispora tropica CNB-440]
 gi|145303907|gb|ABP54489.1| ABC-3 protein [Salinispora tropica CNB-440]
          Length = 312

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 136/254 (53%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  +AL   +   +  G +GC+++ + +A+ GD +AH+   G+A++ + Q  L +   +
Sbjct: 16  AFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFVLQGSLVLGGAV 75

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
               T+L++    +N  +  D+I+GV      +L +VI+S        L  FLFG I  +
Sbjct: 76  AGVATALLIAIFSQNRRVKEDSIIGVFLVGAFALGIVIISQAPGYAGSLQQFLFGSITGI 135

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G G + + ++  + K  +A  ++ E++++ G+    + ++  ++ +L + +
Sbjct: 136 ADRDLYVVGGAGLVILGLVLALHKEFVAVCLDREMSRSMGLSVFWLDIVLYVLVTLAVVI 195

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LLI P   AR  +     M +LA +IG    ++GLY S  +DTP G +
Sbjct: 196 SLQTIGTILVLALLITPAAAARLLTDRLGVMMLLAPVIGGSAAVVGLYLSWSYDTPVGGT 255

Query: 244 IIITSLFLFILSFF 257
           I++ +  +F+ ++ 
Sbjct: 256 IVLIATAVFLAAWL 269


>gi|227549802|ref|ZP_03979851.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078057|gb|EEI16020.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 297

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 57/255 (22%), Positives = 133/255 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RAL   +   +    +GC+++ + +A+ GD +AH+   G+A++   Q  + +   +
Sbjct: 19  AFLPRALLVAVISAIVCAVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFALQASVLLGGAV 78

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + ++ +  + +   +  D ++G++  +  +L LV++S +      L+SFLFG +  V
Sbjct: 79  AGVIVAVAIAVLSQRRRVKEDTVIGIVFAAAFALGLVVISRVDGYTASLSSFLFGSLTGV 138

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + + I +    G + +  +  +   L A  ++ E A+A  +    + L   +  +  + +
Sbjct: 139 SASAIWVSAVAGVVIVAAMVLLKPWLAAVALDRETARAMNLPVAALDLALYLCVTAAVVI 198

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ IG  L+ +LL+ P   AR ++ +   M +L+  IG +G ++G++ S  +++P+G +
Sbjct: 199 SVQTIGNILVLALLVTPAAAARLYTDNLSTMMLLSASIGAVGSVVGVWLSWSYNSPTGAT 258

Query: 244 IIITSLFLFILSFFY 258
           I++    +F LS+ +
Sbjct: 259 IVLAVTSIFALSWLF 273


>gi|116253627|ref|YP_769465.1| iron transmembrane ABC transporter component [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258275|emb|CAK09377.1| putative iron transmembrane ABC transporter component [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 281

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 61/253 (24%), Positives = 120/253 (47%), Gaps = 1/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F + AL   + + +    L CF++ +  +  GD I+H+   GV ++ I  +P  +  F+ 
Sbjct: 15  FMVNALVISVLVAIPMALLSCFLVLKGWSLMGDAISHAVFPGVVIAYIVGIPFAVGAFVA 74

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               ++    ++ N  +  D ++G++      L LV+   ++  +  L   LFGD+L V+
Sbjct: 75  GMFCAIATGFLKDNSRIKQDTVMGIVFSGMFGLGLVLYVKIQ-SDVHLDHILFGDMLGVS 133

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI     I  +  ++L   WK  L    +   A+A G++   +    + + SL I  +
Sbjct: 134 WRDIGQSAVIAAITAVVLGVKWKDFLLHAFDPAQARAVGLRINLLHYGLLALISLTIVGA 193

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  ++LI P   A   +     M +L+  I ++G  +G+Y S   D+   P+I
Sbjct: 194 LQAVGIILSIAMLIAPGAIAFLLTRRFSTMLLLSVAIAVIGSFVGVYLSFFIDSAPAPTI 253

Query: 245 IITSLFLFILSFF 257
           ++     F+L+F 
Sbjct: 254 VLVLAIGFVLAFI 266


>gi|238757792|ref|ZP_04618975.1| Chelated iron transport system membrane protein yfeC [Yersinia
           aldovae ATCC 35236]
 gi|238704035|gb|EEP96569.1| Chelated iron transport system membrane protein yfeC [Yersinia
           aldovae ATCC 35236]
          Length = 294

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHVTRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFSRLLVIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTVVFLLAFVF 265


>gi|220910275|ref|YP_002485586.1| ABC transporter [Cyanothece sp. PCC 7425]
 gi|219866886|gb|ACL47225.1| ABC-3 protein [Cyanothece sp. PCC 7425]
          Length = 277

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 134/259 (51%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF   A+  G+   +    +G F+I QR+A  GD +AH    G+ALS  +++ + I 
Sbjct: 7   LQYEFMRNAIAIGMLTGILCPIVGSFLIVQRLALLGDVVAHCVFPGLALSFFWKIDILIG 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
            F+   L + ++  I+    +  DA + +I  S  +L + +++ ++    DL +FLFGDI
Sbjct: 67  AFISGILGTFLIGWIRTQSRVKVDAAMALIFSSFFALGITLITLLR-TKIDLDAFLFGDI 125

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L+V  TDI     +     +     +K LL  +++   A+A G+  + I   F+   +L 
Sbjct: 126 LSVTPTDIARTLVVTLGIGLATKLFYKELLFYSLDRTGAEAIGLPVQLIHFGFMAAVTLT 185

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           +  S++ +G+ L+ +LL+ P +TA         M  L +++G+L  + G+Y S   + PS
Sbjct: 186 LIASMQAVGVLLVIALLVGPALTAYLLVKELAQMIGLGSLLGVLASVSGVYLSYFLNIPS 245

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ S   F+L+  + 
Sbjct: 246 GAAIVLVSSSFFLLALLFS 264


>gi|110636328|ref|YP_676536.1| hypothetical protein Meso_4004 [Mesorhizobium sp. BNC1]
 gi|110287312|gb|ABG65371.1| ABC-3 protein [Chelativorans sp. BNC1]
          Length = 273

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 139/257 (54%), Positives = 202/257 (78%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF RAL +GIG+ +  GPLGCF++W+R+AYFGDT+AHSALLGVALS +F++ LT  
Sbjct: 1   MLDDFFTRALVAGIGLAMVVGPLGCFVVWRRMAYFGDTMAHSALLGVALSFLFEINLTAG 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F++A L SL LL +Q++  LS+DA+LG+++HST++L LV+++FM W+  DL +FLFGDI
Sbjct: 61  VFVVAALASLALLFLQRHGTLSTDALLGILSHSTLALGLVMVAFMSWIRIDLMAFLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+  DI +I+G G L +++L  +W+PLLA TVN E+A AEGM+PE+ + IF+++ + M
Sbjct: 121 LAVSRMDIAMIYGGGALVLLVLAWLWRPLLAATVNPEIAAAEGMRPERARFIFMLLMAAM 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +GI LITSLLI+P    RRF+++PE MAI A+I G + +I GL  SL FDTPS
Sbjct: 181 IAIAMKIVGIMLITSLLIIPAAAGRRFASTPEIMAIAASIAGAIAVIGGLTASLQFDTPS 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++ +L LF+LS  
Sbjct: 241 GPSIVVAALILFLLSLV 257


>gi|332358585|gb|EGJ36409.1| Mn2+/Zn2+ ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1056]
          Length = 287

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 83/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F+LSFF 
Sbjct: 258 VLTSALIFLLSFFI 271


>gi|16129812|ref|NP_416373.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. MG1655]
 gi|89108699|ref|AP_002479.1| zinc transporter subunit [Escherichia coli str. K-12 substr. W3110]
 gi|157161328|ref|YP_001458646.1| high-affinity zinc transporter membrane component [Escherichia coli
           HS]
 gi|170081515|ref|YP_001730835.1| zinc ABC transporter membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|188494717|ref|ZP_03001987.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 53638]
 gi|238901074|ref|YP_002926870.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli BW2952]
 gi|256022475|ref|ZP_05436340.1| high-affinity zinc transporter membrane component [Escherichia sp.
           4_1_40B]
 gi|301029308|ref|ZP_07192405.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 196-1]
 gi|301645625|ref|ZP_07245554.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 146-1]
 gi|307138522|ref|ZP_07497878.1| high-affinity zinc transporter membrane component [Escherichia coli
           H736]
 gi|331642473|ref|ZP_08343608.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H736]
 gi|2507486|sp|P39832|ZNUB_ECOLI RecName: Full=High-affinity zinc uptake system membrane protein
           znuB
 gi|1736502|dbj|BAA15667.1| zinc transporter subunit [Escherichia coli str. K12 substr. W3110]
 gi|1788166|gb|AAC74929.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. MG1655]
 gi|157067008|gb|ABV06263.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli HS]
 gi|169889350|gb|ACB03057.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188489916|gb|EDU65019.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli 53638]
 gi|238863796|gb|ACR65794.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli BW2952]
 gi|260449018|gb|ACX39440.1| ABC-3 protein [Escherichia coli DH1]
 gi|299877734|gb|EFI85945.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 196-1]
 gi|301076157|gb|EFK90963.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 146-1]
 gi|315136502|dbj|BAJ43661.1| high-affinity zinc transporter membrane component [Escherichia coli
           DH1]
 gi|331039271|gb|EGI11491.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H736]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 172/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S ++DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAVYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|159186175|ref|NP_356188.2| ABC transporter, membrane spanning protein (iron) [Agrobacterium
           tumefaciens str. C58]
 gi|159141309|gb|AAK88973.2| ABC transporter, membrane spanning protein (iron) [Agrobacterium
           tumefaciens str. C58]
          Length = 286

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 131/254 (51%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + A++    +    G L  +++ +  +  GD ++H+ + GVA + +  LP ++  F+ 
Sbjct: 13  YMLNAIWVSALVGGVCGFLSAYLMLKGWSLIGDALSHAIVPGVAGAYMLGLPFSLGAFLS 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA+ 
Sbjct: 73  GGLAAGSMLFLNQKTRLKEDAIIGLIFTSFFGLGLFMVS-LSPTSVNIQTIVLGNILAIT 131

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D + +  IG +++++L   W+  +    +   A+  G++PE +K+IF  + +     +
Sbjct: 132 AEDTIQLALIGGISLLVLALKWRDFMVVFFDENHARTVGLKPEVLKVIFFTLLAASTVAA 191

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+ ++++ P  TA   +   E + +++ IIG     +G Y S   D  +G  I
Sbjct: 192 LQTVGAFLVVAMVVTPGATAYLLTDRFERLILMSLIIGAATSFVGAYLSYFLDGATGGVI 251

Query: 245 IITSLFLFILSFFY 258
           ++    +F+ +F +
Sbjct: 252 VVLQTAIFLAAFVF 265


>gi|330998202|ref|ZP_08322028.1| ABC 3 transport family protein [Paraprevotella xylaniphila YIT
           11841]
 gi|329568894|gb|EGG50692.1| ABC 3 transport family protein [Paraprevotella xylaniphila YIT
           11841]
          Length = 271

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 125/251 (49%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   +  G +G +I+ +R+ +    I H++  G+ + +       +   + 
Sbjct: 8   FFQNALLGSLLASILCGLIGTYIVARRLVFISGGITHASFGGIGIGVYLGFSPILSAAVF 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L++  +        +  D+ + +     +S+ ++          +L+S+LFG+IL V 
Sbjct: 68  SVLSACGIQWFSHRRDMREDSAIAIFWTLGMSIGIICSFLAPGFTPELSSYLFGNILTVT 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +D+ L+  +  +         +PL++   + E A+++ +    ++ + +   +L I   
Sbjct: 128 PSDLYLLGTLALIATAAFTFFLRPLVSIAFDTEFARSQHLPVTMVEYLMMAFIALTIVAC 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L+ SLL +P VTA  F+ S + MA+L+ + G  G + GLY S  ++ PSG SI
Sbjct: 188 LRMVGIVLVISLLTIPQVTANIFTHSFKRMALLSIVTGYSGCLGGLYLSYHYNIPSGASI 247

Query: 245 IITSLFLFILS 255
           I  S+ ++++ 
Sbjct: 248 IFVSILIYLVC 258


>gi|300767875|ref|ZP_07077785.1| manganese ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308180065|ref|YP_003924193.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum subsp. plantarum ST-III]
 gi|300494860|gb|EFK30018.1| manganese ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308045556|gb|ADN98099.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum subsp. plantarum ST-III]
          Length = 291

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 15  YDFLQSALITAIMVGVMSGIIGSFIILRGMSMMGDAISHAVLPGVAVAYMLGINVLIGAS 74

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L + ++  +     + +D  +G++  +  +L  +++S +   +T+L   LFG+ILA
Sbjct: 75  VFGILAASLIGFVASRSKIKTDTSIGIVFSAFYALGFILIS-LAESSTNLHHILFGNILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ TD++    +  L I+ +   +K LL T+ +   AK  G++ + +    +++ +L+  
Sbjct: 134 VSDTDMMTTTVVLGLVILFVVFFYKELLITSFDPTFAKTYGLKVQLLHYALMLVLTLVTV 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++     M  L+ +IG+L  ++GLY S   +  SGP
Sbjct: 194 SALQTVGIILVVAMLITPAATAFLWTERLAVMLGLSALIGVLSSVVGLYLSYTLNWASGP 253

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F +SF   
Sbjct: 254 AIVLVAAIFFGISFIIS 270


>gi|212638711|ref|YP_002315231.1| Mn2+/Zn2+ ABC transporter permease [Anoxybacillus flavithermus WK1]
 gi|212560191|gb|ACJ33246.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Anoxybacillus flavithermus WK1]
          Length = 277

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 70/267 (26%), Positives = 135/267 (50%), Gaps = 8/267 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------- 54
             EF   A   GI I      LG FI+ +R++   D ++H  L G+A SL+ Q       
Sbjct: 7   QYEFLQNAFIVGILIGFIAPLLGVFIVVRRLSLIADALSHVTLAGIAASLLVQKKFFAFA 66

Query: 55  -LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLT 113
            L         + + SL + +++       +  + +I    I L+++ +S     NTDL 
Sbjct: 67  TLNPIYIGMAFSVVGSLFIEKLRTVYKHYQELAIPIILSGGIGLSVIFISLADGFNTDLF 126

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           S+LFG + AV+  D+  I  I F+ + ++F  +K     + + E A+A G++ + +  +F
Sbjct: 127 SYLFGSVSAVSRADVWTISIIFFIVLTVIFLFYKEWFILSFDEEYAQASGVKVKSLHFVF 186

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
           I++ +L+I+ S++ +GI L++SL+ LP   + R +   +     + + G   +I+GL+ S
Sbjct: 187 IVLVALVIAASMRIVGILLVSSLMTLPVAASIRIAKGFKQALWFSVLFGEFAVIVGLFLS 246

Query: 234 LIFDTPSGPSIIITSLFLFILSFFYKK 260
              +   G +I++ ++ + I S  +KK
Sbjct: 247 YYLNLAPGGTIVLLAVCILIASIMWKK 273


>gi|183598804|ref|ZP_02960297.1| hypothetical protein PROSTU_02236 [Providencia stuartii ATCC 25827]
 gi|188021012|gb|EDU59052.1| hypothetical protein PROSTU_02236 [Providencia stuartii ATCC 25827]
          Length = 296

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 127/256 (49%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  I+    L  DA++G I  +  +   +++  +   + ++ + +FG+IL 
Sbjct: 71  FTGILAALAMTFIKHITRLREDAVIGFIFSTFFAAG-LLIVSLNPTSVNVQTIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ ++L  +WK LLA   +   A++ G+ P ++K+IF  + S    
Sbjct: 130 IADADVLQVEIIIAISFIVLLALWKDLLAVFFDESHARSIGLNPLRLKIIFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +   + + I+A  IG     IG Y S   +  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDQFKRLLIIAVAIGTATSAIGAYASYFLNGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 LIVTLQTVIFLLAFFF 265


>gi|28377887|ref|NP_784779.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum WCFS1]
 gi|27462357|gb|AAO15437.1|AF416708_2 MtsB [Lactobacillus plantarum]
 gi|28270721|emb|CAD63626.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum WCFS1]
          Length = 291

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 15  YDFLQSALITAIMVGVMSGIIGSFIILRGMSMMGDAISHAVLPGVAVAYMLGINVLIGAS 74

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L + ++  +     + +D  +G++  +  +L  +++S +   +T+L   LFG+ILA
Sbjct: 75  VFGILAASLIGFVASRSKIKTDTSIGIVFSAFYALGFILIS-LAESSTNLHHILFGNILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ TD++    +  L I+ +   +K LL T+ +   AK  G++ + +    +++ +L+  
Sbjct: 134 VSDTDMMTTTVVLGLVILFVAFFYKELLITSFDPTFAKTYGLKVQLLHYALMLVLTLVTV 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++     M  L+ +IG+L  ++GLY S   +  SGP
Sbjct: 194 SALQTVGIILVVAMLITPAATAFLWTERLAVMLGLSALIGVLSSVVGLYLSYTLNWASGP 253

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F +SF   
Sbjct: 254 AIVLVAAIFFGISFIIS 270


>gi|46907674|ref|YP_014063.1| zinc ABC transporter permease [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47092736|ref|ZP_00230522.1| zinc ABC transporter, permease protein [Listeria monocytogenes str.
           4b H7858]
 gi|258611677|ref|ZP_05241420.2| zinc ABC transporter [Listeria monocytogenes FSL R2-503]
 gi|293596235|ref|ZP_05229496.2| zinc ABC transporter [Listeria monocytogenes FSL J1-194]
 gi|293596951|ref|ZP_05265990.2| zinc ABC transporter [Listeria monocytogenes HPB2262]
 gi|300765589|ref|ZP_07075568.1| zinc ABC transporter, permease protein [Listeria monocytogenes FSL
           N1-017]
 gi|46880942|gb|AAT04240.1| zinc ABC transporter, permease protein [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47018924|gb|EAL09671.1| zinc ABC transporter, permease protein [Listeria monocytogenes str.
           4b H7858]
 gi|258605369|gb|EEW17977.1| zinc ABC transporter [Listeria monocytogenes FSL R2-503]
 gi|293584190|gb|EFF96222.1| zinc ABC transporter [Listeria monocytogenes HPB2262]
 gi|293593733|gb|EFG01494.1| zinc ABC transporter [Listeria monocytogenes FSL J1-194]
 gi|300513690|gb|EFK40758.1| zinc ABC transporter, permease protein [Listeria monocytogenes FSL
           N1-017]
          Length = 295

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 9   LQYDFIRNTFIVGLVIGIVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 68

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 69  AALNPLYLGFGFSVVGSLLMEKLRNVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 128

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 129 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 188

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 189 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 248

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 249 AYYLNLAPGGAIVIISVLLLIVTILYQK 276


>gi|281178308|dbj|BAI54638.1| iron ABC transporter permease component [Escherichia coli SE15]
          Length = 285

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 136/256 (53%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++KL+F  + S+   
Sbjct: 129 IDPADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKLLFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVIFLVVTPGATAWLLTDRFPRLLMIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|329767717|ref|ZP_08259234.1| membrane protein in scaA 5'region [Gemella haemolysans M341]
 gi|328838955|gb|EGF88547.1| membrane protein in scaA 5'region [Gemella haemolysans M341]
          Length = 279

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFI+ + ++  GD I+H+ L GVALS I  +   I   + 
Sbjct: 14  FLQNALITAIVIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVALSFILGIDFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITFIKGNSIIKSDTAIGITFSSFLALGVILISVAK-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L+   +
Sbjct: 133 DVDMYITIGVGVFVLLVITLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  L++ IG    ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGACCSVLGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F +SFF 
Sbjct: 253 VLTSAIVFAISFFI 266


>gi|311112404|ref|YP_003983626.1| iron (Fe3+) ABC transporter membrane protein YfeC [Rothia
           dentocariosa ATCC 17931]
 gi|310943898|gb|ADP40192.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           membrane protein YfeC [Rothia dentocariosa ATCC 17931]
          Length = 289

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 129/255 (50%), Gaps = 1/255 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F  RA+   +   +    L C+++    +  GD I+H+ L GV L+ I  +P  +   +
Sbjct: 14  PFMTRAMVVTVIAAVVCALLSCWLVMLGWSLMGDAISHAVLPGVVLAYIAGIPFAVGAVI 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
            A +   ++  +Q++  +  DA +G++  +  +L LV++S     +TDL   LFG++L V
Sbjct: 74  AALVAVTLIGAVQRSGRVREDAAIGIVFTTLFALGLVLVSVTP-SSTDLNHILFGNVLGV 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+  +  +  +   +L    +  +    +   A A G++P  +  + +++ +L   V
Sbjct: 133 SWPDVWQVAILAVIVAGVLLIKRRDFILYAFDRGFAHAIGLRPRVLGALLLVMLALTSVV 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++L++P  TAR  +     M  ++  +  LG ++GLY S   D   G +
Sbjct: 193 ALQIVGVVLVVAMLVIPGSTARLLTDRFTPMLAVSVGVSTLGTLVGLYSSYHLDISPGGA 252

Query: 244 IIITSLFLFILSFFY 258
           +++T   +F+  + +
Sbjct: 253 VVVTQGIIFLAVYIF 267


>gi|259047509|ref|ZP_05737910.1| metal ion ABC superfamily ATP binding cassette transporter,
           permease protein [Granulicatella adiacens ATCC 49175]
 gi|259035700|gb|EEW36955.1| metal ion ABC superfamily ATP binding cassette transporter,
           permease protein [Granulicatella adiacens ATCC 49175]
          Length = 277

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 137/259 (52%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   A  S + I    G LGCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 9   MEFHFLQNAFVSAVVIGAVAGILGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S ++  + +N  +  D  +G+   S ++L ++++   K  +TDL   LFG+I
Sbjct: 69  ALVFGLLASFLIAFVNQNSTIKGDTAIGITFSSFLALGVILIGVAK-SSTDLFHILFGNI 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV   D+L+   +  + ++++   +K L  T+ +   A++ GM  +    + + + +L+
Sbjct: 128 LAVQDIDLLITLVVSVIVVVVILAYFKELQVTSFDPVFAQSTGMNVQFYHYLLMFLLALV 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  +I +LLI P  TA  +S   + M ILA I G L  I+GL+    F+   
Sbjct: 188 SITAMQSVGTVMIVALLITPAATAYLYSNRLKIMLILAAIFGSLSSILGLFIGYTFNIAI 247

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++T+  LF++SF   
Sbjct: 248 GSTIVLTAAALFVVSFIIS 266


>gi|170683483|ref|YP_001745166.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli SMS-3-5]
 gi|170521201|gb|ACB19379.1| iron/manganese transport system inner membrane protein SitC
           [Escherichia coli SMS-3-5]
 gi|323969049|gb|EGB64358.1| ABC 3 transporter [Escherichia coli TA007]
          Length = 285

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 135/256 (52%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            E+ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 10  YEYMLNAMWVAAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  FSGGLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DIL +  IG +++++LF  WK L+ T  +   A+A G+ P ++K++F  + ++   
Sbjct: 129 IAPADILQLTIIGIVSVIVLFFKWKDLMVTFFDENHARAIGLYPGRLKILFFTLLAVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     + ++A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLVIAVTIGSVTSFLGAWVSYFLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFVF 264


>gi|152977310|ref|YP_001376827.1| ABC-3 protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152026062|gb|ABS23832.1| ABC-3 protein [Bacillus cytotoxicus NVH 391-98]
          Length = 288

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 149/259 (57%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + +  G +GCFII + +A  GD I+H+ L GVALS +F +   I 
Sbjct: 11  MQYGFLQKALLTSVMVGIIGGVIGCFIILRGMALMGDAISHAVLPGVALSYMFGMDYFIG 70

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                 +T++ +  + +N  +  D  +G++  S  ++ +++++FMK  ++DL   LFG++
Sbjct: 71  AVFTGVITAVGIGFVSQNSRIKQDMAIGIMFTSVFAIGIILITFMK-SSSDLYHILFGNV 129

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   IG + I ++   +K LL +T +  +A++ G+  + I    +++ +++
Sbjct: 130 LAVRSSDMWMTLVIGIIIIGLVILFYKELLVSTFDPIMAQSYGLPNKLIHYGLMVLLTMV 189

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              S++ +GI L+ S+LI P  TA   +     M  LAT IG    ++GLY S  ++  S
Sbjct: 190 TVASLQTVGIILVVSMLITPAATAYLLTNRLWIMIYLATGIGAFSSVVGLYFSFSYNLAS 249

Query: 241 GPSIIITSLFLFILSFFYK 259
           G +I++ + FLF L+FF+ 
Sbjct: 250 GAAIVLVATFLFGLAFFFS 268


>gi|47095397|ref|ZP_00233007.1| zinc ABC transporter, permease protein [Listeria monocytogenes str.
           1/2a F6854]
 gi|258611449|ref|ZP_05232421.2| zinc ABC transporter [Listeria monocytogenes FSL N3-165]
 gi|258612154|ref|ZP_05268145.2| zinc ABC transporter [Listeria monocytogenes F6900]
 gi|293596542|ref|ZP_05262132.2| zinc ABC transporter [Listeria monocytogenes J2818]
 gi|47016218|gb|EAL07141.1| zinc ABC transporter, permease protein [Listeria monocytogenes str.
           1/2a F6854]
 gi|258600113|gb|EEW13438.1| zinc ABC transporter [Listeria monocytogenes FSL N3-165]
 gi|258609040|gb|EEW21648.1| zinc ABC transporter [Listeria monocytogenes F6900]
 gi|293590091|gb|EFF98425.1| zinc ABC transporter [Listeria monocytogenes J2818]
          Length = 295

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 9   LQYDFIRNTFIVGLVIGVVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 68

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 69  AALNPLYLGFGFSVVGSLLMEKLRNVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 128

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 129 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 188

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 189 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 248

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 249 AYYLNLAPGGAIVIISVLLLIVTILYQK 276


>gi|295095545|emb|CBK84635.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 170/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + IL   W+ LLA TV+ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVAVVLGILLWQWRNLLAMTVSPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVIIGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI S   K
Sbjct: 243 VVLCAAVLFIFSMMKK 258


>gi|217963999|ref|YP_002349677.1| manganese transport system membrane protein MntB [Listeria
           monocytogenes HCC23]
 gi|217333269|gb|ACK39063.1| manganese transport system membrane protein MntB [Listeria
           monocytogenes HCC23]
 gi|307571431|emb|CAR84610.1| manganese ABC transporter, permease protein [Listeria monocytogenes
           L99]
          Length = 280

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGINFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLVATIIFFIAFLF 264


>gi|322514788|ref|ZP_08067811.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
 gi|322119250|gb|EFX91380.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Actinobacillus ureae ATCC 25976]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 169/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +G+ + + T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   DILFPAWLAGLLLAVITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQVDPYIAVII 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L+L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTLILALLLVWLEHRTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D++ I     L   +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 123 DFSDVIFIGVGSLLIASVLAFFWKKLLSITISPELAQIEGLNVARLRLLLMVLTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A +  IL +  GL  S   DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSAIARRFARTPEAMVGYAIVFSILSVTGGLLFSGWKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I +  LF+LS   K
Sbjct: 243 VVICAGILFLLSLAKK 258


>gi|307130463|ref|YP_003882479.1| Manganese ABC transporter inner membrane permease SitD [Dickeya
           dadantii 3937]
 gi|306527992|gb|ADM97922.1| Manganese ABC transporter, inner membrane permease protein SitD
           [Dickeya dadantii 3937]
          Length = 275

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 53/252 (21%), Positives = 118/252 (46%), Gaps = 1/252 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F ++A+ +   + +    L CF++ +  +  GD ++H+ L GV L+ +  +PL I  F 
Sbjct: 14  PFMVKAMLAAGVVGMVCAVLSCFMVLKGWSLMGDAVSHAVLPGVVLAWLAGIPLAIGAFA 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L    +++   +  D ++G++     ++ LV+ S +      L+  LFG++L +
Sbjct: 74  SGLFCALATGYVKERCRIKEDTVMGILFSGMFAVGLVLFSRVN-TEQHLSHILFGNVLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              ++     I  L + ++   W+ L+    +   A+  G+  + +    + + SL I  
Sbjct: 133 TRYELQQTLVISLLVLAVVIIKWRDLVLYCFDPTQAQICGLPVKLLHYGLLTLLSLTIVA 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +++ +G+ L+ ++LI P +T          M ++A        + G + S   D  +GP 
Sbjct: 193 ALQAVGVILVIAMLITPGITGFVLCKRFGAMMLVAVTSATFSSVFGTWLSYFLDGATGPC 252

Query: 244 IIITSLFLFILS 255
           I+I    +FI++
Sbjct: 253 IVIIQSLIFIIA 264


>gi|323186866|gb|EFZ72185.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli RN587/1]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL +V++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGMVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|204931076|ref|ZP_03221902.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|204320120|gb|EDZ05325.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|322616893|gb|EFY13801.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618131|gb|EFY15023.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322625802|gb|EFY22621.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322626254|gb|EFY23064.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322632668|gb|EFY29413.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322639012|gb|EFY35705.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322640452|gb|EFY37105.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644217|gb|EFY40762.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649540|gb|EFY45972.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322655447|gb|EFY51755.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660226|gb|EFY56464.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322662907|gb|EFY59114.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322668092|gb|EFY64251.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322674148|gb|EFY70242.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322675498|gb|EFY71572.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322683088|gb|EFY79104.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686782|gb|EFY82760.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323195327|gb|EFZ80507.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323199219|gb|EFZ84314.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204056|gb|EFZ89071.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207476|gb|EFZ92424.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323210661|gb|EFZ95539.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323217459|gb|EGA02178.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219948|gb|EGA04421.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224440|gb|EGA08728.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323231482|gb|EGA15595.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323235923|gb|EGA20002.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323240493|gb|EGA24536.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323245385|gb|EGA29385.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246749|gb|EGA30721.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323253605|gb|EGA37433.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255373|gb|EGA39143.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323260266|gb|EGA43887.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323266857|gb|EGA50343.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269063|gb|EGA52519.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|26248125|ref|NP_754165.1| high-affinity zinc transporter membrane component [Escherichia coli
           CFT073]
 gi|74311811|ref|YP_310230.1| high-affinity zinc transporter membrane component [Shigella sonnei
           Ss046]
 gi|170679836|ref|YP_001743385.1| high-affinity zinc transporter membrane component [Escherichia coli
           SMS-3-5]
 gi|218689797|ref|YP_002398009.1| high-affinity zinc transporter membrane component [Escherichia coli
           ED1a]
 gi|218705360|ref|YP_002412879.1| high-affinity zinc transporter membrane component [Escherichia coli
           UMN026]
 gi|227885713|ref|ZP_04003518.1| high-affinity zinc transporter membrane component [Escherichia coli
           83972]
 gi|291283041|ref|YP_003499859.1| Zinc uptake ABC transporter permease protein ZnuB [Escherichia coli
           O55:H7 str. CB9615]
 gi|293405354|ref|ZP_06649346.1| znuB [Escherichia coli FVEC1412]
 gi|293415174|ref|ZP_06657817.1| znuB [Escherichia coli B185]
 gi|298380996|ref|ZP_06990595.1| znuB [Escherichia coli FVEC1302]
 gi|300899109|ref|ZP_07117392.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 198-1]
 gi|300917564|ref|ZP_07134219.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 115-1]
 gi|300935834|ref|ZP_07150792.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 21-1]
 gi|300994112|ref|ZP_07180695.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 45-1]
 gi|301050787|ref|ZP_07197644.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 185-1]
 gi|331647456|ref|ZP_08348548.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M605]
 gi|331653268|ref|ZP_08354273.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M718]
 gi|331673389|ref|ZP_08374157.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA280]
 gi|26108528|gb|AAN80730.1|AE016761_305 High-affinity zinc uptake system membrane protein znuB [Escherichia
           coli CFT073]
 gi|73855288|gb|AAZ87995.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|170517554|gb|ACB15732.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli SMS-3-5]
 gi|209767494|gb|ACI82059.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|218427361|emb|CAR08256.2| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli ED1a]
 gi|218432457|emb|CAR13350.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli UMN026]
 gi|227837286|gb|EEJ47752.1| high-affinity zinc transporter membrane component [Escherichia coli
           83972]
 gi|281178927|dbj|BAI55257.1| zinc ABC transporter permease component [Escherichia coli SE15]
 gi|284921779|emb|CBG34852.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           042]
 gi|290762914|gb|ADD56875.1| Zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O55:H7 str. CB9615]
 gi|291427562|gb|EFF00589.1| znuB [Escherichia coli FVEC1412]
 gi|291432822|gb|EFF05801.1| znuB [Escherichia coli B185]
 gi|298278438|gb|EFI19952.1| znuB [Escherichia coli FVEC1302]
 gi|300297542|gb|EFJ53927.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 185-1]
 gi|300357266|gb|EFJ73136.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 198-1]
 gi|300406374|gb|EFJ89912.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 45-1]
 gi|300415218|gb|EFJ98528.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 115-1]
 gi|300458946|gb|EFK22439.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 21-1]
 gi|307553878|gb|ADN46653.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli ABU 83972]
 gi|315290338|gb|EFU49714.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 153-1]
 gi|320657957|gb|EFX25719.1| high-affinity zinc transporter membrane component [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320658530|gb|EFX26224.1| high-affinity zinc transporter membrane component [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|323165018|gb|EFZ50808.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           sonnei 53G]
 gi|323968627|gb|EGB64033.1| ABC 3 transporter [Escherichia coli M863]
 gi|323977957|gb|EGB73043.1| ABC 3 transporter [Escherichia coli TW10509]
 gi|327252983|gb|EGE64637.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli STEC_7v]
 gi|330911669|gb|EGH40179.1| zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli AA86]
 gi|331043180|gb|EGI15318.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M605]
 gi|331049366|gb|EGI21438.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli M718]
 gi|331069587|gb|EGI40974.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA280]
          Length = 261

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|332364847|gb|EGJ42616.1| Mn/Zn ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1059]
          Length = 287

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  ++ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYVKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|15802272|ref|NP_288296.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 EDL933]
 gi|15831823|ref|NP_310596.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. Sakai]
 gi|168747887|ref|ZP_02772909.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4113]
 gi|168757893|ref|ZP_02782900.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4401]
 gi|168762347|ref|ZP_02787354.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4501]
 gi|168770842|ref|ZP_02795849.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4486]
 gi|168777760|ref|ZP_02802767.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4196]
 gi|168788280|ref|ZP_02813287.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC869]
 gi|195940295|ref|ZP_03085677.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810636|ref|ZP_03252512.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4206]
 gi|208816531|ref|ZP_03257651.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4045]
 gi|209400842|ref|YP_002270942.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4115]
 gi|217328955|ref|ZP_03445036.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. TW14588]
 gi|254793483|ref|YP_003078320.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227640|ref|ZP_05941921.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258194|ref|ZP_05950727.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|12515915|gb|AAG56849.1|AE005408_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13362037|dbj|BAB35992.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187767082|gb|EDU30926.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4196]
 gi|188017398|gb|EDU55520.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4113]
 gi|189355200|gb|EDU73619.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4401]
 gi|189360312|gb|EDU78731.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4486]
 gi|189367340|gb|EDU85756.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4501]
 gi|189371965|gb|EDU90381.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC869]
 gi|208725152|gb|EDZ74859.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4206]
 gi|208730874|gb|EDZ79563.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4045]
 gi|209162242|gb|ACI39675.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. EC4115]
 gi|209767488|gb|ACI82056.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767490|gb|ACI82057.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767492|gb|ACI82058.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|209767496|gb|ACI82060.1| hypothetical protein ECs2569 [Escherichia coli]
 gi|217318302|gb|EEC26729.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli O157:H7 str. TW14588]
 gi|254592883|gb|ACT72244.1| High-affinity zinc uptake system membrane protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|320188560|gb|EFW63222.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. EC1212]
 gi|320641713|gb|EFX11101.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. G5101]
 gi|320647073|gb|EFX15906.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H- str. 493-89]
 gi|320652356|gb|EFX20654.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H- str. H 2687]
 gi|320668428|gb|EFX35255.1| high-affinity zinc transporter membrane component [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326342239|gb|EGD66020.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. 1044]
 gi|326343789|gb|EGD67551.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli O157:H7 str. 1125]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTDGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|199598885|ref|ZP_03212295.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus rhamnosus HN001]
 gi|229552774|ref|ZP_04441499.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus rhamnosus LMS2-1]
 gi|258509415|ref|YP_003172166.1| iron ABC transporter membrane protein [Lactobacillus rhamnosus GG]
 gi|258540610|ref|YP_003175109.1| iron ABC transporter membrane protein [Lactobacillus rhamnosus Lc
           705]
 gi|199590193|gb|EDY98289.1| ABC-type Mn2+/Zn2+ transport system, permease component
           [Lactobacillus rhamnosus HN001]
 gi|229313879|gb|EEN79852.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Lactobacillus rhamnosus LMS2-1]
 gi|257149342|emb|CAR88315.1| ABC transporter, iron transporter membrane protein [Lactobacillus
           rhamnosus GG]
 gi|257152286|emb|CAR91258.1| ABC transporter, iron transporter membrane protein [Lactobacillus
           rhamnosus Lc 705]
 gi|259650696|dbj|BAI42858.1| manganese ABC transporter permease component [Lactobacillus
           rhamnosus GG]
          Length = 297

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 143/257 (55%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 14  YDFLQSALITAIMVGIMSGLIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGVNVMIGAS 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   + +L++  +  N  + +D  +GV+  +  +L  +++S  +   T+L   LFG+ILA
Sbjct: 74  VFGIIAALLIGFVAANSKIKTDTSIGVVFSAFYALGFILISMAE-SATNLHHILFGNILA 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +DI+    +  + I+ +   +K LL T+ +   AK  G+    I    +++ +L+  
Sbjct: 133 VSDSDIMTTAVVLGIVILFVVLFYKELLITSFDNTFAKTYGLNTTAIHYALMLVLTLVTV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++   E M ++A  +G++  I GLY S  F+  SGP
Sbjct: 193 SALQTVGIILVVAMLITPAATAFLWTDRLETMLVMAASVGVISSITGLYFSFTFNWASGP 252

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +  LF +SF + 
Sbjct: 253 AIVLVAAVLFAISFVFS 269


>gi|116873283|ref|YP_850064.1| manganese ABC transporter permease protein [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116742161|emb|CAK21285.1| manganese ABC transporter permease protein [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 281

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 9   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 69  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 127

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  L I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 128 LAVRSSDMWMTIIIAILVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 187

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  I+GLY S IF+  S
Sbjct: 188 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAISAIVGLYFSYIFNLAS 247

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 248 GAAMVLVATVIFFIAFLF 265


>gi|16800552|ref|NP_470820.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria innocua Clip11262]
 gi|16413957|emb|CAC96715.1| metal (zinc) transport protein (ABC transporter, permease protein)
           [Listeria innocua Clip11262]
 gi|313618923|gb|EFR90778.1| 'zinc ABC transporter, permease protein' [Listeria innocua FSL
           S4-378]
          Length = 292

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 67/268 (25%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       GI I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGIVIGVIAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKIFDII 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIITILYQK 273


>gi|241206144|ref|YP_002977240.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860034|gb|ACS57701.1| ABC-3 protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 281

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 62/253 (24%), Positives = 118/253 (46%), Gaps = 1/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F + AL   + + +    L CF++ +  +  GD I+H+   GV ++ I  +P  +  F  
Sbjct: 15  FMVNALVISVLVAIPMALLSCFLVLKGWSLMGDAISHAVFPGVVIAYIVGIPFAVGAFAA 74

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
               ++    ++ N  +  D ++G++      L LV+   ++  +  L   LFGD+L V+
Sbjct: 75  GMFCAVATGFLKDNSRIKQDTVMGIVFSGMFGLGLVLYVRIQ-SDVHLDHILFGDMLGVS 133

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DI     I  +   IL   WK  L    +   A+A G++   +    + + SL I  +
Sbjct: 134 WRDIGQSAVIAAITAAILGVKWKDFLLHAFDPAQARAVGLRINLLHYGLLALISLTIVGA 193

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  ++LI P   A   +     M +L+  I ++G  +G+Y S   D+   P+I
Sbjct: 194 LQAVGIILSIAMLIAPGAIAFLLTRKFSTMLLLSVAIAVIGSFVGVYLSFFIDSAPAPTI 253

Query: 245 IITSLFLFILSFF 257
           ++     F+L+F 
Sbjct: 254 VLVLAIGFVLAFI 266


>gi|193066078|ref|ZP_03047135.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E22]
 gi|194429676|ref|ZP_03062194.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli B171]
 gi|218695425|ref|YP_002403092.1| high-affinity zinc transporter membrane component [Escherichia coli
           55989]
 gi|256017937|ref|ZP_05431802.1| high-affinity zinc transporter membrane component [Shigella sp. D9]
 gi|260844203|ref|YP_003221981.1| zinc transporter subunit ZnuB [Escherichia coli O103:H2 str. 12009]
 gi|260855799|ref|YP_003229690.1| zinc transporter subunit ZnuB [Escherichia coli O26:H11 str. 11368]
 gi|260868394|ref|YP_003234796.1| zinc transporter subunit ZnuB [Escherichia coli O111:H- str. 11128]
 gi|293446246|ref|ZP_06662668.1| znuB [Escherichia coli B088]
 gi|300816249|ref|ZP_07096471.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 107-1]
 gi|300824199|ref|ZP_07104317.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 119-7]
 gi|300924948|ref|ZP_07140875.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 182-1]
 gi|307314061|ref|ZP_07593673.1| ABC-3 protein [Escherichia coli W]
 gi|309794240|ref|ZP_07688664.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 145-7]
 gi|331668553|ref|ZP_08369401.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA271]
 gi|331677740|ref|ZP_08378415.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H591]
 gi|332278971|ref|ZP_08391384.1| zinc uptake ABC transporter [Shigella sp. D9]
 gi|192926315|gb|EDV80952.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E22]
 gi|194412318|gb|EDX28622.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli B171]
 gi|195182921|dbj|BAG66489.1| high-affinity zinc uptake system membrane protein [Escherichia coli
           O111:H-]
 gi|218352157|emb|CAU97896.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli 55989]
 gi|257754448|dbj|BAI25950.1| zinc transporter subunit ZnuB [Escherichia coli O26:H11 str. 11368]
 gi|257759350|dbj|BAI30847.1| zinc transporter subunit ZnuB [Escherichia coli O103:H2 str. 12009]
 gi|257764750|dbj|BAI36245.1| zinc transporter subunit ZnuB [Escherichia coli O111:H- str. 11128]
 gi|291323076|gb|EFE62504.1| znuB [Escherichia coli B088]
 gi|300418884|gb|EFK02195.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 182-1]
 gi|300523270|gb|EFK44339.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 119-7]
 gi|300530939|gb|EFK52001.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 107-1]
 gi|306906199|gb|EFN36716.1| ABC-3 protein [Escherichia coli W]
 gi|308122145|gb|EFO59407.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 145-7]
 gi|315061164|gb|ADT75491.1| zinc transporter subunit: membrane component of ABC superfamily
           [Escherichia coli W]
 gi|320198053|gb|EFW72661.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Escherichia coli EC4100B]
 gi|323152652|gb|EFZ38928.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli EPECa14]
 gi|323158656|gb|EFZ44670.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli E128010]
 gi|323180656|gb|EFZ66201.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 1180]
 gi|323378259|gb|ADX50527.1| ABC-3 protein [Escherichia coli KO11]
 gi|324118919|gb|EGC12808.1| ABC 3 transporter [Escherichia coli E1167]
 gi|331063747|gb|EGI35658.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA271]
 gi|331074200|gb|EGI45520.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli H591]
 gi|332101323|gb|EGJ04669.1| zinc uptake ABC transporter [Shigella sp. D9]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|237731897|ref|ZP_04562378.1| high-affinity zinc transporter membrane component [Citrobacter sp.
           30_2]
 gi|226907436|gb|EEH93354.1| high-affinity zinc transporter membrane component [Citrobacter sp.
           30_2]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|125717137|ref|YP_001034270.1| Mn/Zn ABC transporter permease [Streptococcus sanguinis SK36]
 gi|125497054|gb|ABN43720.1| ABC-type Mn2+/Zn2+ transport systems, permease component, putative
           [Streptococcus sanguinis SK36]
 gi|324992232|gb|EGC24154.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK405]
 gi|324994323|gb|EGC26237.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK678]
 gi|327459149|gb|EGF05497.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1057]
          Length = 287

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|82776445|ref|YP_402794.1| high-affinity zinc transporter membrane component [Shigella
           dysenteriae Sd197]
 gi|309789255|ref|ZP_07683848.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 1617]
 gi|81240593|gb|ABB61303.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308923009|gb|EFP68523.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 1617]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHTSLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|16760843|ref|NP_456460.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29141465|ref|NP_804807.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213163231|ref|ZP_03348941.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213418775|ref|ZP_03351841.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426407|ref|ZP_03359157.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213649639|ref|ZP_03379692.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213855439|ref|ZP_03383679.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|289829034|ref|ZP_06546730.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25316147|pir||AI0742 high-affinity zinc uptake system membrane protein [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16503140|emb|CAD05644.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29137092|gb|AAO68656.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLASGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 TMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|301018305|ref|ZP_07182814.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 69-1]
 gi|331663355|ref|ZP_08364265.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA143]
 gi|300399741|gb|EFJ83279.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 69-1]
 gi|331059154|gb|EGI31131.1| high-affinity zinc uptake system membrane protein ZnuB [Escherichia
           coli TA143]
          Length = 261

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|311281724|ref|YP_003943955.1| ABC-3 protein [Enterobacter cloacae SCF1]
 gi|308750919|gb|ADO50671.1| ABC-3 protein [Enterobacter cloacae SCF1]
          Length = 285

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 66/254 (25%), Positives = 137/254 (53%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           + + A++    +      L  +++ +  +  GD ++HS + GVA + +  LP ++  F+ 
Sbjct: 12  YMLNAMWVSAMVGGLCAFLSGYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAFLS 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L+ DAI+G+I  S   L L ++S +   + ++ + + G+ILA+ 
Sbjct: 72  GGLAAGSMLFLNQRTRLNEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILAIA 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             DIL +  IG ++I +LF  WK L+ T  +   A+A G++PE++K++F  + ++    +
Sbjct: 131 PEDILQLTIIGAVSIAVLFFKWKDLMVTFFDENHARAIGLRPERLKILFFTLLAVSTVAA 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  L+ SL++ P  TA   +     + ++A  IG +   +G + S   D  +G  I
Sbjct: 191 LQTVGAFLVISLVVTPGATAWLLTDRFPRLLLIAVAIGSITSFLGAWLSYYLDGATGAII 250

Query: 245 IITSLFLFILSFFY 258
           ++    LF+L+F +
Sbjct: 251 VVAQTALFLLAFIF 264


>gi|238797390|ref|ZP_04640890.1| Chelated iron transport system membrane protein yfeC [Yersinia
           mollaretii ATCC 43969]
 gi|238718821|gb|EEQ10637.1| Chelated iron transport system membrane protein yfeC [Yersinia
           mollaretii ATCC 43969]
          Length = 294

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P K+K++F  + S    
Sbjct: 130 IADEDVLQVEIIILISFVILCLIWKDLLAVFFDESHAMSIGLSPLKLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + I+A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFGRLLIIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTVVFLLAFVF 265


>gi|313623759|gb|EFR93898.1| 'zinc ABC transporter, permease protein' [Listeria innocua FSL
           J1-023]
          Length = 292

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 67/268 (25%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       GI I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGIVIGVIAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDII 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIITILYQK 273


>gi|28872377|ref|NP_794996.1| zinc ABC transporter permease [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971445|ref|ZP_03399558.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato T1]
 gi|301382162|ref|ZP_07230580.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060099|ref|ZP_07251640.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302132371|ref|ZP_07258361.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28855632|gb|AAO58691.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213923806|gb|EEB57388.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           tomato T1]
          Length = 262

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TCGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSALVLVLIVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|317495792|ref|ZP_07954155.1| ABC 3 transporter [Gemella moribillum M424]
 gi|316913969|gb|EFV35452.1| ABC 3 transporter [Gemella moribillum M424]
          Length = 279

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 142/254 (55%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFI+ + ++  GD I+H+ L GVA+S I  +   I     
Sbjct: 14  FLQNALITAIIIGIVAGAVGCFIVLRGMSLMGDAISHAVLPGVAVSYILGIDFFIGAIAF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITFIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++++   +K LL T+ +  LAKA GM+      + +++ +L+   +
Sbjct: 133 DIDMYITIGVGVFVLLVIKLFFKELLLTSFDELLAKAMGMKVNFYHYLLMILLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  L++ IG +  ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKTMIFLSSTIGAVCSVLGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++T   +F +SFF 
Sbjct: 253 VLTLATVFAISFFI 266


>gi|315282341|ref|ZP_07870770.1| 'zinc ABC transporter, permease protein' [Listeria marthii FSL
           S4-120]
 gi|313614002|gb|EFR87717.1| 'zinc ABC transporter, permease protein' [Listeria marthii FSL
           S4-120]
          Length = 292

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 6   LQYDFIRNTFIVGLVIGVIAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 66  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 126 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDII 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 186 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 246 AYYLNLAPGGAIVIISVLLLIVTILYQK 273


>gi|153011022|ref|YP_001372236.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
 gi|151562910|gb|ABS16407.1| ABC-3 protein [Ochrobactrum anthropi ATCC 49188]
          Length = 282

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 66/256 (25%), Positives = 116/256 (45%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL   + I + T  L CF++ +  +  GD I+H+ L GV ++ I  +P  I  F+
Sbjct: 14  EFMRYALAISVLIAIPTALLSCFLVLKGWSLMGDAISHAVLPGVVVAYIIGIPFGIGAFV 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L    + +N  +  D ++G++      L LV+   ++     L   LFGD+L +
Sbjct: 74  AGMACALATGYLTENSRIKQDTVMGIVFSGMFGLGLVLYVAIR-STVHLDHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D++    I  L   IL   W+  L    +   A+A G+    +    + + SL I  
Sbjct: 133 TLSDLIETAIIAALTAGILVVKWRDFLLHAFDPAQARAVGLPVRLLHYGLLCLISLTIVG 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +K +GI L   +LI P   A   +     M +LA  I +     G+Y +   D+   P+
Sbjct: 193 VLKAVGIILAIGMLIAPGAIAFLLTRKFSTMMLLAVTIAVTASFFGVYLAFFIDSAPAPT 252

Query: 244 IIITSLFLFILSFFYK 259
           I++    +F+ +F Y 
Sbjct: 253 IVLLMTAMFLAAFIYS 268


>gi|325693839|gb|EGD35758.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK150]
          Length = 287

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|307946706|ref|ZP_07662041.1| ABC transporter, membrane spanning protein [Roseibium sp.
           TrichSKD4]
 gi|307770370|gb|EFO29596.1| ABC transporter, membrane spanning protein [Roseibium sp.
           TrichSKD4]
          Length = 275

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 126/257 (49%), Positives = 193/257 (75%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M ++FF+RAL +GIG     GPLGCFI+W+R+AYFGDT+AH+ALLGVALSL+ +L  T+ 
Sbjct: 1   MLDDFFVRALVAGIGGAAVAGPLGCFIVWRRMAYFGDTLAHAALLGVALSLLLELNTTMT 60

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           +F ++   +L +L +++ + LSSDA+LG+++HS ++L LV L+FM WV  DLT  LFGDI
Sbjct: 61  VFGVSVTIALTMLGLRRTQTLSSDALLGLLSHSALALGLVCLAFMTWVRVDLTGLLFGDI 120

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV+ TDIL I+  G   ++ L+ IW+ L A TVN +LA AEGM+PEK+ ++F+++ + +
Sbjct: 121 LAVSKTDILTIYAGGSAVLVFLWLIWRRLFAATVNPDLAAAEGMEPEKVNIVFMLLMAAV 180

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I++++K +G+ LIT+LLI+P  +ARR +  PE+MA++A++IG + ++ GL  SL  DTP+
Sbjct: 181 IAIAMKVVGVLLITALLIIPAASARRIAVGPEHMAVIASVIGAVAVVGGLQASLRLDTPA 240

Query: 241 GPSIIITSLFLFILSFF 257
           GPSI++    LF++S  
Sbjct: 241 GPSIVVAGTILFLVSIL 257


>gi|153808703|ref|ZP_01961371.1| hypothetical protein BACCAC_03002 [Bacteroides caccae ATCC 43185]
 gi|149128529|gb|EDM19747.1| hypothetical protein BACCAC_03002 [Bacteroides caccae ATCC 43185]
          Length = 269

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 62/259 (23%), Positives = 130/259 (50%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +N TD+ ++  +  L     +   +P++    + E A+++ +  E  + + +M  +L 
Sbjct: 124 LTINQTDLWMLGILALLLTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYLLMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PS
Sbjct: 184 IVACLRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++ +    K
Sbjct: 244 GASIIFFSILIYAVCKIGK 262


>gi|332359369|gb|EGJ37190.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK49]
          Length = 287

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNIAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|331696852|ref|YP_004333091.1| ABC transporter integral membrane subunit [Pseudonocardia
           dioxanivorans CB1190]
 gi|326951541|gb|AEA25238.1| ABC-type transporter, integral membrane subunit [Pseudonocardia
           dioxanivorans CB1190]
          Length = 294

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 126/255 (49%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F +RAL + +   +    L C+++    +  GD ++H+ L GV L+ +   P  +   + 
Sbjct: 15  FMVRALVTTVVAAVVCALLSCWLVLVGWSLMGDAVSHAVLPGVVLAYVLGAPFALGAVVF 74

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L   ++  I+    +  DA +G++  +  +L LV++S      TDL   +FG++L V+
Sbjct: 75  GFLAVGLIGAIRDTSRVKEDAAIGIVFTTLFALGLVLISVTP-SQTDLNHIVFGNVLGVS 133

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D++ +  +G +    L    + L+    +   A A G+ P ++  + + + +L   V+
Sbjct: 134 VGDLVQVAALGAVVAAALLYKRRDLVLYAFDPGHAHAIGLSPRRLGALLLGLLALTAVVA 193

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G+ L+ ++LILP  TA+  +     M ++A ++ ++   +GLY S   D   G  +
Sbjct: 194 LQVVGVILVVAMLILPGATAQLLTDRFSRMLLIAPVLSVVCATVGLYLSYWLDAAPGGLV 253

Query: 245 IITSLFLFILSFFYK 259
           ++T    F L + + 
Sbjct: 254 VVTQGAAFALVYLFG 268


>gi|238787079|ref|ZP_04630879.1| Chelated iron transport system membrane protein yfeC [Yersinia
           frederiksenii ATCC 33641]
 gi|238724867|gb|EEQ16507.1| Chelated iron transport system membrane protein yfeC [Yersinia
           frederiksenii ATCC 33641]
          Length = 294

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFGRLLVIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 VIVTLQTLVFLLAFFF 265


>gi|324990407|gb|EGC22345.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK353]
          Length = 287

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|288555772|ref|YP_003427707.1| Mn2+/Zn2+ ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288546932|gb|ADC50815.1| ABC Mn2+/Zn2+ transporter (permease) [Bacillus pseudofirmus OF4]
          Length = 289

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 71/266 (26%), Positives = 135/266 (50%), Gaps = 8/266 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ-------- 54
            EF   A F+G+ I L    LG F++ +R++   D ++H  L G+A SL+          
Sbjct: 8   YEFLQNAFFTGVMIGLLAPMLGVFLVVRRLSLIADALSHITLSGIAASLLLGKHVVFFQG 67

Query: 55  LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTS 114
           L       + +   +L++ Q++       +  + +I    I L +V +S     N DL +
Sbjct: 68  LNPLYMGMVFSVGGALLIEQLRSVYQYYKEIAIPIILSGGIGLGVVFISLAYGFNNDLFN 127

Query: 115 FLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFI 174
           +LFG ++AV  +D+  I G+  + +++L   +K L   + + E A   G+  + +  IFI
Sbjct: 128 YLFGSVIAVTRSDLWTILGVTIVVLVVLTLFYKELFFLSFDEEQAVVSGLNRKLVHFIFI 187

Query: 175 MITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL 234
           ++ +L+I+ S++ +GI L++SL+ LP   A RF+   + M + + + G + +I GL  + 
Sbjct: 188 VMVALVIAASMRIVGILLVSSLMTLPVAAAMRFAKGFKQMFVYSILFGQISVIGGLILAY 247

Query: 235 IFDTPSGPSIIITSLFLFILSFFYKK 260
             D   G +I+I ++ + I S    K
Sbjct: 248 QLDLAPGGTIVILAVLILIGSIAVDK 273


>gi|5019735|gb|AAD37836.1|AF104349_2 hydrophobic membrane protein ZurM [Listeria monocytogenes]
          Length = 295

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 65/268 (24%), Positives = 139/268 (51%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+S          
Sbjct: 9   LQYDFIRNTFIVGLVIGVVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSWFLSKTYLPL 68

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 69  AALNPLYLGFGFSVVGSLLMEKLRNVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 128

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 129 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 188

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 189 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 248

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 249 AYYLNLAPGGAIVIISVLLLIVTILYQK 276


>gi|262283440|ref|ZP_06061206.1| hydrophobic membrane protein [Streptococcus sp. 2_1_36FAA]
 gi|262260931|gb|EEY79631.1| hydrophobic membrane protein [Streptococcus sp. 2_1_36FAA]
          Length = 283

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGIILISVAK-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G L ++++   +K LL T+ +  LA+A GM+      + +++ +L+   +
Sbjct: 138 DLDMWISIGVGILVLLVISIFFKQLLLTSFDPLLAQAMGMKVNFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGTGASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLVSFFI 271


>gi|327490750|gb|EGF22531.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1058]
          Length = 287

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIITLFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|254556072|ref|YP_003062489.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum JDM1]
 gi|254044999|gb|ACT61792.1| manganese ABC transporter, permease protein [Lactobacillus
           plantarum JDM1]
          Length = 291

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            +F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + + I   
Sbjct: 15  YDFLRSALITAIMVGVMSGIIGSFIILRGMSMMGDAISHAVLPGVAVAYMLGINVLIGAS 74

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L + ++  +     + +D  +G++  +  +L  +++S +   +T+L   LFG+ILA
Sbjct: 75  VFGILAASLIGFVASRSKIKTDTSIGIVFSAFYALGFILIS-LAESSTNLHHILFGNILA 133

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ TD++    +  L I+ +   +K LL T+ +   AK  G++ + +    +++ +L+  
Sbjct: 134 VSDTDMMTTTVVLGLVILFVVFFYKELLITSFDPTFAKTYGLKVQLLHYALMLVLTLVTV 193

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI L+ ++LI P  TA  ++     M  L+ +IG+L  ++GLY S   +  SGP
Sbjct: 194 SALQTVGIILVVAMLITPAATAFLWTERLAVMLGLSALIGVLSSVVGLYLSYTLNWASGP 253

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ +   F +SF   
Sbjct: 254 AIVLVAAIFFGISFIIS 270


>gi|194446294|ref|YP_002041158.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194404957|gb|ACF65179.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
          Length = 261

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|160885149|ref|ZP_02066152.1| hypothetical protein BACOVA_03147 [Bacteroides ovatus ATCC 8483]
 gi|156109499|gb|EDO11244.1| hypothetical protein BACOVA_03147 [Bacteroides ovatus ATCC 8483]
          Length = 274

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 129/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 9   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILS 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+I
Sbjct: 69  AAVFSVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +N  D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L 
Sbjct: 129 LTINQIDLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALT 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PS
Sbjct: 189 IVACLRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPS 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++ +    K
Sbjct: 249 GASIIFFSILIYAVCKIGK 267


>gi|325688578|gb|EGD30595.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK72]
 gi|328945315|gb|EGG39468.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK1087]
          Length = 287

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|330874112|gb|EGH08261.1| zinc ABC transporter permease [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 262

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 183/259 (70%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TFGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSALVLVLIVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   K
Sbjct: 241 PSIVVSAAALFLLSFVLPK 259


>gi|237708830|ref|ZP_04539311.1| zinc ABC transporter permease [Bacteroides sp. 9_1_42FAA]
 gi|229457256|gb|EEO62977.1| zinc ABC transporter permease [Bacteroides sp. 9_1_42FAA]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 123/251 (49%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   +   + 
Sbjct: 11  FFQHALLGSLFASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYADISPLLSAAIF 70

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L+S  +  + K + +  D+ + V     +++ ++          DL++FLFG+IL + 
Sbjct: 71  SVLSSFGVEWLSKRKDMREDSAIAVFWTFGMAVGIIFSFLAPGFTPDLSAFLFGNILTIT 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            TDILL+  +  L I+       P++    + E A ++ +     + I +M  +L I   
Sbjct: 131 PTDILLLAILSMLLILFFTLFLNPIICIAFDREFACSQRIPVALFEYILMMFIALTIVSC 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  SLL LP +TA  F+ S + +   + IIG  G + GL+ S     PSG +I
Sbjct: 191 LRMVGIVLAISLLTLPQMTANLFTHSFKKIIWWSVIIGYAGCLGGLFISYKLQVPSGAAI 250

Query: 245 IITSLFLFILS 255
           I  S+ ++   
Sbjct: 251 IFFSILIYTFC 261


>gi|212693667|ref|ZP_03301795.1| hypothetical protein BACDOR_03187 [Bacteroides dorei DSM 17855]
 gi|237724263|ref|ZP_04554744.1| zinc ABC transporter permease [Bacteroides sp. D4]
 gi|265755911|ref|ZP_06090378.1| zinc ABC transporter permease [Bacteroides sp. 3_1_33FAA]
 gi|212663779|gb|EEB24353.1| hypothetical protein BACDOR_03187 [Bacteroides dorei DSM 17855]
 gi|229437451|gb|EEO47528.1| zinc ABC transporter permease [Bacteroides dorei 5_1_36/D4]
 gi|263233989|gb|EEZ19590.1| zinc ABC transporter permease [Bacteroides sp. 3_1_33FAA]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 123/251 (49%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   +   + 
Sbjct: 11  FFQHALLGSLFASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYADISPLLSAAIF 70

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L+S  +  + K + +  D+ + V     +++ ++          DL++FLFG+IL + 
Sbjct: 71  SVLSSFGVEWLSKRKDMREDSAIAVFWTFGMAVGIIFSFLAPGFTPDLSAFLFGNILTIT 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            TDILL+  +  L I+       P++    + E A ++ +     + I +M  +L I   
Sbjct: 131 PTDILLLAILSILLILFFTLFLNPIICIAFDREFACSQRIPVALFEYILMMFIALTIVSC 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  SLL LP +TA  F+ S + +   + IIG  G + GL+ S     PSG +I
Sbjct: 191 LRMVGIVLAISLLTLPQMTANLFTHSFKKIIWWSVIIGYAGCLGGLFISYKLQVPSGAAI 250

Query: 245 IITSLFLFILS 255
           I  S+ ++   
Sbjct: 251 IFFSILIYTFC 261


>gi|297199542|ref|ZP_06916939.1| metal transport ABC transporter [Streptomyces sviceus ATCC 29083]
 gi|197713532|gb|EDY57566.1| metal transport ABC transporter [Streptomyces sviceus ATCC 29083]
          Length = 300

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 128/253 (50%), Gaps = 1/253 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F  RAL + + + ++   +G +++ +R A  GD I H A+ GV L  +          
Sbjct: 6   YAFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSWSPVWMAT 65

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMK-WVNTDLTSFLFGDIL 121
           +++ L ++++  I+       D  L ++ +  ++  ++ ++      N +LTS+LFG + 
Sbjct: 66  LVSVLGAVLMELIRWYGRTRGDIALAMLFYGGMAGGVMFINLAPGGSNANLTSYLFGSLS 125

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+ +D+  I  +    +++   + + L A + + E A+  G+    + L+  +  ++ +
Sbjct: 126 TVSQSDVTAICALAAFVVLVTLGLRRQLFAVSQDEEFARVTGLPVRALNLLTAVTAAVTV 185

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V+++ +G+ L+++L+++P   A++ + S      +A  IG+   I G   S   D P G
Sbjct: 186 TVAMRVVGLLLVSALMVVPVAAAQQLTRSFAATFAIAVAIGVTVTIGGTVTSYYQDVPPG 245

Query: 242 PSIIITSLFLFIL 254
            +I++ ++  FI+
Sbjct: 246 ATIVLLTIGAFIV 258


>gi|331017880|gb|EGH97936.1| zinc ABC transporter, permease protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 262

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 184/259 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALALVAGPLGAFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM+ V  DL ++LFGD+L
Sbjct: 61  TCGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMQEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSALVLVLIVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|224501352|ref|ZP_03669659.1| hypothetical protein LmonFR_02315 [Listeria monocytogenes FSL
           R2-561]
 gi|254831551|ref|ZP_05236206.1| metal cations ABC transporter (permease protein) [Listeria
           monocytogenes 10403S]
          Length = 279

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 7   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 67  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 125

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 126 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 185

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 186 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 245

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 246 GAAMVLVATIIFFIAFLF 263


>gi|323174751|gb|EFZ60367.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli LT-68]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|114705759|ref|ZP_01438662.1| ABC transporter, membrane spanning protein (iron) [Fulvimarina
           pelagi HTCC2506]
 gi|114538605|gb|EAU41726.1| ABC transporter, membrane spanning protein (iron) [Fulvimarina
           pelagi HTCC2506]
          Length = 297

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 125/254 (49%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           +   A++    +      L  +++ +  +  GD ++HS + GVA + I  LP  +  F+ 
Sbjct: 12  YMTNAIWVSALVGGVCAFLSAYLMLKGWSLIGDALSHSVVPGVAGAYILGLPFALGAFIA 71

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L +  +L + +   L  D I+G+I  +   L L ++S     +  + +   G+ILA+ 
Sbjct: 72  GGLAAGSMLFLSERSGLKIDVIIGLIFTAFFGLGLFLVSINPM-SVSIQTITMGNILAIT 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D   +  IG +++ +L   WK L+    +   A++ G++PE++K +F ++ S  +  +
Sbjct: 131 PEDTFQLALIGTISLGVLLLKWKDLMVVFFDENHARSVGLRPERLKALFFVLLSASVVAA 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           +  +G  L+ ++++ P  TA   +     + +L+ IIG L   +G Y S   D  +G  I
Sbjct: 191 MMTVGAFLVIAMVVTPGATAYLLADRFPKLIVLSVIIGALTSAVGAYVSYFLDGATGGVI 250

Query: 245 IITSLFLFILSFFY 258
           +     +F+L+F +
Sbjct: 251 VTLQTLIFLLAFVF 264


>gi|323353547|ref|ZP_08088080.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis VMC66]
 gi|322121493|gb|EFX93256.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis VMC66]
 gi|325689519|gb|EGD31524.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK115]
 gi|325697828|gb|EGD39712.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK160]
          Length = 287

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSAIIFLISFFI 271


>gi|152994335|ref|YP_001339170.1| ABC-3 protein [Marinomonas sp. MWYL1]
 gi|150835259|gb|ABR69235.1| ABC-3 protein [Marinomonas sp. MWYL1]
          Length = 263

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 108/241 (44%), Positives = 171/241 (70%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           +    GPLG F++W+R+AYFGDT+AHSALLGVAL  +  + L + I ++    +LVL+ +
Sbjct: 15  VAAVAGPLGAFVVWRRMAYFGDTLAHSALLGVALGFLLDINLNLAIIVLCVGLALVLVTL 74

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           QK   +++D +LG++ HS +SL LV +SF+  +  DL ++LFGD+LA++ TD+  I+G G
Sbjct: 75  QKKHIIATDTLLGILAHSALSLGLVAVSFLDNIRIDLMAYLFGDLLAISQTDVYWIYGGG 134

Query: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITS 195
              I +L   WKPLLA TVN ELAK EG   E I+L+ +++ +L+I+V++K +G+ LITS
Sbjct: 135 LAVITLLVAFWKPLLAVTVNEELAKVEGYPVEAIRLLLMLLVALVIAVAMKIVGVLLITS 194

Query: 196 LLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILS 255
           L+I+P  TAR+ S++P  MA  A++IG L +  GL+ S  +DTP+GPS+++ +  LF+++
Sbjct: 195 LMIIPAATARKLSSTPVQMASFASLIGCLAVCSGLWASYRWDTPTGPSVVVCAALLFLIA 254

Query: 256 F 256
           +
Sbjct: 255 Y 255


>gi|322386613|ref|ZP_08060238.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus cristatus ATCC 51100]
 gi|321269286|gb|EFX52221.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus cristatus ATCC 51100]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAK-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G L ++++   +K LL T+ +  LAKA GM+      + +++ +L+   +
Sbjct: 138 DLDMWISIGVGILVLLVIAIFFKQLLLTSFDPLLAKAMGMKVNFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M +L++ +G    ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVAMLITPAATAYLYAKSLKTMILLSSALGAGASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLVSFFI 271


>gi|187733450|ref|YP_001879636.1| high-affinity zinc transporter membrane component [Shigella boydii
           CDC 3083-94]
 gi|193069896|ref|ZP_03050845.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E110019]
 gi|187430442|gb|ACD09716.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella boydii
           CDC 3083-94]
 gi|192956796|gb|EDV87250.1| zinc uptake ABC transporter, permease protein ZnuB [Escherichia
           coli E110019]
 gi|320173571|gb|EFW48766.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella dysenteriae CDC 74-1112]
 gi|320182603|gb|EFW57492.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella boydii ATCC 9905]
 gi|332090036|gb|EGI95136.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           boydii 5216-82]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|327394171|dbj|BAK11593.1| high-affinity zinc uptake system membrane protein ZnuB [Pantoea
           ananatis AJ13355]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 96/256 (37%), Positives = 168/256 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             +D+  +       + ++   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L I V
Sbjct: 123 TPSDLWAMAAGVIFVLAVMAWQWRALLSMTISPELAQVDGVNIQRTRLMLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPEMMAAVAVLIGVIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LF+ S   K
Sbjct: 243 VVLCAAILFLFSMVRK 258


>gi|190149783|ref|YP_001968308.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263101|ref|ZP_07544723.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914914|gb|ACE61166.1| high-affinity zinc uptake system membrane protein ZnuB
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306871727|gb|EFN03449.1| Zinc (Zn2+) ABC superfamily ATP binding cassette transporter,
           membrane protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 100/256 (39%), Positives = 166/256 (64%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +++L+ ++   A S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D++ I         +L   WK LL+ T++ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 123 DFDDVVFIGSGMLFIAGVLGYFWKKLLSITISPELAQIEGLNVVRLRLVLMLLTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+  ARRF+ +PE M   A I  I  I  GL  S   DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSIFSITGGLLFSAWKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  +F+LS F K
Sbjct: 243 VVVCAGAIFLLSLFRK 258


>gi|219870455|ref|YP_002474830.1| high-affinity zinc uptake system membrane protein [Haemophilus
           parasuis SH0165]
 gi|219690659|gb|ACL31882.1| high-affinity zinc uptake system membrane protein [Haemophilus
           parasuis SH0165]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 167/256 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGVFLTFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ +++    S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTVILALCLVWLEQRSTHSVDTLLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+L I         +L   WK LLA TV+ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 123 GFNDVLFIGIGVIGIATLLALYWKKLLAITVSPELAQIEGLNVARLRLLLMLLTALSIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE M I A  + IL +  GL  S + DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPETMVIYAIGLSILSVSGGLLLSALKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LF+LS   K
Sbjct: 243 VVVCAGTLFLLSLIKK 258


>gi|82543692|ref|YP_407639.1| high-affinity zinc transporter membrane component [Shigella boydii
           Sb227]
 gi|81245103|gb|ABB65811.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|320187793|gb|EFW62467.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Shigella flexneri CDC 796-83]
 gi|332096678|gb|EGJ01669.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           boydii 3594-74]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLALDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|24378697|ref|NP_720652.1| putative Mn/Zn ABC transporter [Streptococcus mutans UA159]
 gi|24376561|gb|AAN57958.1|AE014869_3 putative Mn/Zn ABC transporter [Streptococcus mutans UA159]
          Length = 279

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 80/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   + 
Sbjct: 14  FLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L SL++  I++N  + SD  +G+   S ++L ++++  +   +TDL   LFG+ILAV 
Sbjct: 74  GLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILI-GLANSSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   +
Sbjct: 133 DMDKWITVGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SF +
Sbjct: 253 VLTSALIFLISFVF 266


>gi|254506871|ref|ZP_05119010.1| zinc ABC transporter, permease protein [Vibrio parahaemolyticus 16]
 gi|219550156|gb|EED27142.1| zinc ABC transporter, permease protein [Vibrio parahaemolyticus 16]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 105/256 (41%), Positives = 180/256 (70%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + +L +G+GI +  GPLG F++W+++AYFGDT+AH++L+G+A   +  + L + + +
Sbjct: 3   EFLLPSLLAGLGIAIIAGPLGSFVVWRKMAYFGDTLAHASLMGIAFGFLLNVNLYLALVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+L+V
Sbjct: 63  CCLALALILVTLQKQQLVATDTLLGILAHSALSLGLVAVSFLDDVRIDLMSYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD++ I+G   +   IL   W+ LLATTV+ +LA  +G   + ++L+ +++  L+I++
Sbjct: 123 TPTDLMYIYGGVIVVTAILAIFWRSLLATTVSEDLAAVDGQNVDLMRLVLMLMVGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P   ARRFS++PE MA+LA++IG L ++ GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAAAARRFSSTPEQMALLASLIGALAVVFGLSLSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I++  +F+LS   +
Sbjct: 243 VVISATAMFMLSQLVR 258


>gi|8925938|gb|AAF81673.1|AF232688_2 SloB [Streptococcus mutans]
          Length = 279

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 80/254 (31%), Positives = 144/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   + 
Sbjct: 14  FLQNALVTAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L SL++  I++N  + SD  +G+   S ++L ++++  +   +TDL   LFG+ILAV 
Sbjct: 74  GLLASLIITFIKENSIIKSDTAIGITFSSFLALGVILI-GLANSSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  GI  L ++ +   ++PLL T+ +  LAK+ G+       + +++ +L+   +
Sbjct: 133 DMDKWITLGISLLVLLFICLFFRPLLLTSFDPVLAKSMGLSVHFYHYLLMILLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G    + GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSTLGAFASVAGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SF +
Sbjct: 253 VLTSALIFLISFVF 266


>gi|330965528|gb|EGH65788.1| zinc ABC transporter permease [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 262

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 184/259 (71%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TLGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++ TD+  I G   L ++++  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPTDLAWILGGSALVLVLIVALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MA+ A+++G++ + +GL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGVIAVCVGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   K
Sbjct: 241 PSIVVSAAALFLLSFVLPK 259


>gi|238753697|ref|ZP_04615059.1| Chelated iron transport system membrane protein yfeC [Yersinia
           ruckeri ATCC 29473]
 gi|238708249|gb|EEQ00605.1| Chelated iron transport system membrane protein yfeC [Yersinia
           ruckeri ATCC 29473]
          Length = 293

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +     P     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGFPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDENHAMSIGISPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + I+A  IG +    G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFGRLLIIAIAIGAVTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+F +
Sbjct: 250 VIVTLQTLVFLLAFLF 265


>gi|238791720|ref|ZP_04635357.1| Chelated iron transport system membrane protein yfeC [Yersinia
           intermedia ATCC 29909]
 gi|238728824|gb|EEQ20341.1| Chelated iron transport system membrane protein yfeC [Yersinia
           intermedia ATCC 29909]
          Length = 294

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHVTRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILVSFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFSRLLMIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 VIVTLQTLVFLLAFFF 265


>gi|307154290|ref|YP_003889674.1| ABC-3 protein [Cyanothece sp. PCC 7822]
 gi|306984518|gb|ADN16399.1| ABC-3 protein [Cyanothece sp. PCC 7822]
          Length = 286

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 76/257 (29%), Positives = 134/257 (52%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF   AL   + + L    +G ++I QR+A  GD IAH  L G+++S    + + I  F
Sbjct: 11  YEFMRNALAIAMIVGLLCPVVGSYLIVQRMALLGDVIAHCVLPGLSISFFLGIDILIGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L + ++  I+    +  D+ + +   S  +L + ++S +K    DL SFLFGDIL 
Sbjct: 71  TSGILGAFLIAWIRSQSRIKVDSAMALTFSSFFALGVTLISVLK-NKLDLDSFLFGDILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V  TDI     I  L ++ +   +K LL    +   A+A G+    I   F+++ +L I 
Sbjct: 130 VTLTDITRTLIITLLILLTIKLFYKELLFYVFDRNGAQALGLPINTIYTGFMVVITLTII 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S++ +G+ L+ SLL+ P + A         M ++  +IG++  + G+Y S  ++ PSGP
Sbjct: 190 ASMQAVGVILVISLLVGPALAAYLLVKELHQMMMVGAVIGMIASVAGVYLSYYYNLPSGP 249

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ S  LF+++ F+ 
Sbjct: 250 AIVLVSSTLFLVALFFS 266


>gi|15602262|ref|NP_245334.1| YfeD [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720645|gb|AAK02481.1| YfeD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 279

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 59/259 (22%), Positives = 128/259 (49%), Gaps = 1/259 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F   ALF+ + + +    L C+++ +  +  GD I+H+ L G+ ++ +  LPLT   
Sbjct: 13  LYPFMQNALFTALIVAIICAVLSCYLVLKGWSLMGDAISHAVLPGIVIAFMLGLPLTFGA 72

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F      +L +  +++N  +  D ++G++     +  +V+ + ++     LT  LFG++L
Sbjct: 73  FGAGLFCALSVGYLKENSRIKEDTVMGIVFSGMFAFGIVLFTKVE-TEQHLTHILFGNLL 131

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            V+  +++  + I  +  +I+    +  L    +    +  G+ P  +    +++ +L I
Sbjct: 132 GVSRAELVQTFIIATIIFVIMMLKRRDFLLYCFDQSHTRVAGLSPRLLHYGLLVLLALTI 191

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            ++++ +G+ L+ ++LI P +TA   S   + M I+A  + ++  I G   S   D  +G
Sbjct: 192 IMAMQVVGVILVVAMLISPGITAFLLSKRFDIMLIIAICMSVITSIFGTIISYHIDAATG 251

Query: 242 PSIIITSLFLFILSFFYKK 260
           P II+     F L+  Y+K
Sbjct: 252 PCIILLQAMFFTLALGYQK 270


>gi|255007546|ref|ZP_05279672.1| putative ABC transporter membrane protein [Bacteroides fragilis
           3_1_12]
          Length = 269

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 64/259 (24%), Positives = 128/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   L   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYTGLSPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + K + +  D+ + +     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSKRKDMREDSAIAMFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +  TD+L++  +  L I+       P++    + E A+++G+    ++ I +M  +L 
Sbjct: 124 LTITQTDLLMLGILAILLILFFTLFIHPIIYIAFDREFARSQGIPVVVLEYILMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+   + +  L+  IG L  + GL  S   + PS
Sbjct: 184 IVSCLRMVGIVLAISLLTIPQMTANLFTNKFKRIIWLSIAIGYLSCLGGLLISYRLNVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++I     K
Sbjct: 244 GASIIFFSILIYIACKIGK 262


>gi|229844431|ref|ZP_04464571.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae 6P18H1]
 gi|229812680|gb|EEP48369.1| 23S rRNA pseudouridylate synthase C [Haemophilus influenzae 6P18H1]
          Length = 261

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 112/256 (43%), Positives = 176/256 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S ++DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIGGLILSALYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLFILS F K
Sbjct: 243 VVICSAFLFILSLFKK 258


>gi|167856240|ref|ZP_02478974.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           parasuis 29755]
 gi|167852627|gb|EDS23907.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           parasuis 29755]
          Length = 261

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 168/256 (65%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +G+ +   T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I + +
Sbjct: 3   EILFPAWLAGVFLTFITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQIDPYIAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +L L+ ++++   S D +LG+I H ++SL ++ +S +  V  DL S+LFGD+LA+
Sbjct: 63  MTVILALCLVWLEQHSTHSVDTLLGIIAHCSLSLGVITISLLDNVRVDLMSYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+L I         +L   WK LLA TV+ ELA+ EG+   +++L+ +++T+L I++
Sbjct: 123 GFNDVLFISFGVIGIATLLALYWKKLLAITVSPELAQIEGLNVARLRLLLMLLTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P+ TARRF+ +PE M I A  + IL +  GL  S + DTP+GPS
Sbjct: 183 SMKFVGALIITSLLIIPSATARRFAKTPETMVIYAIGLSILSVSGGLLLSALKDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LF+LS   K
Sbjct: 243 VVVCAGTLFLLSLIKK 258


>gi|304396233|ref|ZP_07378115.1| ABC-3 protein [Pantoea sp. aB]
 gi|304356602|gb|EFM20967.1| ABC-3 protein [Pantoea sp. aB]
          Length = 261

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 171/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S MK V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMKNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + ++++   W+ LL+ T++ ELA+ +G+  ++ +L+ +++T+L I V
Sbjct: 123 TPDDLWMMGGGVVIVLLVMAWQWRSLLSMTISPELAQVDGVNIQRTRLVLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF  SPE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFVRSPEGMAGVAVVIGVIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI S   K
Sbjct: 243 VVLCAAILFIFSMVRK 258


>gi|29347616|ref|NP_811119.1| Zinc ABC transporter permease [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|298383697|ref|ZP_06993258.1| zinc ABC transporter, permease [Bacteroides sp. 1_1_14]
 gi|29339517|gb|AAO77313.1| Zinc ABC transporter, permease [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|298263301|gb|EFI06164.1| zinc ABC transporter, permease [Bacteroides sp. 1_1_14]
          Length = 269

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 60/255 (23%), Positives = 128/255 (50%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   +   + 
Sbjct: 8   FFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILSAAVF 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+IL +N
Sbjct: 68  SVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNILTIN 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L I   
Sbjct: 128 QADLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALTIVAC 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PSG SI
Sbjct: 188 LRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPSGASI 247

Query: 245 IITSLFLFILSFFYK 259
           I  S+ ++ +    K
Sbjct: 248 IFFSILIYAVCKIGK 262


>gi|283786715|ref|YP_003366580.1| iron ABC transporter permease [Citrobacter rodentium ICC168]
 gi|282950169|emb|CBG89805.1| iron ABC transporter, permease protein [Citrobacter rodentium
           ICC168]
          Length = 286

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 132/256 (51%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F
Sbjct: 11  YQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAWMLGLPFSLGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   + L ++S     + ++ + + G++LA
Sbjct: 71  LSGGLAAGSMLFLSQRSRLKEDAIIGLIFSSFFGIGLFMVSLNPM-SVNIQTIILGNVLA 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DI+ +  IG ++++IL   WK L+ T  +   A++ G+ P ++KL+F  + S+   
Sbjct: 130 IAPEDIVQLAIIGTVSLLILLVKWKDLMVTFFDENHARSIGLHPGRLKLLFFTLLSVSTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +   A  IG L   +G + S   D  +G 
Sbjct: 190 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLAAAVAIGSLTSFLGAWLSYWLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 250 IIVVLQTLLFLLAFIF 265


>gi|325982342|ref|YP_004294744.1| ABC-type transporter, integral membrane subunit [Nitrosomonas sp.
           AL212]
 gi|325531861|gb|ADZ26582.1| ABC-type transporter, integral membrane subunit [Nitrosomonas sp.
           AL212]
          Length = 277

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 70/257 (27%), Positives = 145/257 (56%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EFF  AL + + +  S G +G +++ + ++Y G  ++H+A+ G  + +   L       
Sbjct: 10  YEFFRHALLAALMVGASGGLIGVYVVLRGMSYVGHGLSHAAIGGAVIGITLNLNFYAGAC 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
            +  L + ++ +I +N  +  DA +G++T +  +L + I+S M+    +  + LFG+IL 
Sbjct: 70  AMGLLAAFIINKITENNKIKLDAAIGIVTTAMFALGVAIVSKMRNFKQNFEAALFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+++I  + F  ++ +F  ++ LL +T + E A+  G++   ++ +F ++ +  + 
Sbjct: 130 ITEQDLMIIGLVAFFTLITMFITYRALLFSTFDNEAARVFGIKTVSVQWLFSLLLTFSVI 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            S+  IG+T++ + LI P +TAR  +    +M I +TIIG +  ++G+Y S IF+  SG 
Sbjct: 190 ASLNVIGVTMVAATLIAPAMTARMLTDRFSSMIIYSTIIGAVTGVMGMYLSYIFNVASGT 249

Query: 243 SIIITSLFLFILSFFYK 259
           +I++ S+ +F LS   K
Sbjct: 250 TIVLFSVLVFGLSMLVK 266


>gi|322411278|gb|EFY02186.1| integral membrane protein MtsC [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 282

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 82/259 (31%), Positives = 145/259 (55%), Gaps = 1/259 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F   AL + I I + +G +GCFII + ++  GD I+H+ L GVALS I  +   I 
Sbjct: 10  MSYHFLQNALVTAIVIGVVSGAVGCFIILRSMSLMGDAISHAVLPGVALSFILGINFFIG 69

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             +   L S+++  I++N  +  D  +G+   S ++L ++++      +TDL   LFG+I
Sbjct: 70  AIIFGLLASVIITYIKENSVIKGDTAIGITFSSFLALGIILIGVAN-SSTDLFHILFGNI 128

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV  +D  +  G+    + I+   +K LL T+ +  LAK+ GM       + +++ +L+
Sbjct: 129 LAVQDSDKWITIGVSVFVLGIIILFFKELLITSFDPILAKSMGMNVNAYHYMLMILLTLV 188

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +G  LI +LLI P  TA  ++ S + M ++++ IG L  ++GLY    F+  +
Sbjct: 189 SVTAMQSVGTILIVALLITPAATAYLYANSLKVMLVMSSAIGALSSVLGLYLGYTFNVAA 248

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SI++TS  +F++SFF  
Sbjct: 249 GSSIVLTSAAIFLISFFIS 267


>gi|313608104|gb|EFR84169.1| metal ion ABC transporter, permease protein [Listeria monocytogenes
           FSL F2-208]
          Length = 272

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 67/257 (26%), Positives = 142/257 (55%), Gaps = 1/257 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I  
Sbjct: 1   QYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGINFFIGA 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                  +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++L
Sbjct: 61  ATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNVL 119

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+ 
Sbjct: 120 AVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLVT 179

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  SG
Sbjct: 180 VSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLASG 239

Query: 242 PSIIITSLFLFILSFFY 258
            ++++ +  +F ++F +
Sbjct: 240 AAMVLVATIIFFIAFLF 256


>gi|253572076|ref|ZP_04849480.1| zinc ABC transporter [Bacteroides sp. 1_1_6]
 gi|251838256|gb|EES66343.1| zinc ABC transporter [Bacteroides sp. 1_1_6]
          Length = 269

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 60/255 (23%), Positives = 128/255 (50%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   +   + 
Sbjct: 8   FFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILSAAVF 67

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+IL +N
Sbjct: 68  SVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNILTIN 127

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L I   
Sbjct: 128 QADLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALTIVAC 187

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PSG SI
Sbjct: 188 LRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPSGASI 247

Query: 245 IITSLFLFILSFFYK 259
           I  S+ ++ +    K
Sbjct: 248 IFFSILIYAICKIGK 262


>gi|327472962|gb|EGF18389.1| metal ABC superfamily ATP binding cassette transporter, membrane
           protein [Streptococcus sanguinis SK408]
          Length = 287

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 143/254 (56%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   A  + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I     
Sbjct: 19  FLQNAFITAIVIGIVAGAVGCFIILRGMSLMGDAISHAVLPGVALSYILGVNFFIGAITF 78

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  + SD  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 79  GLLASIIITYIKGNSIIKSDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 137

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G   ++I+   +K LL T+ +  LA+A GM       + +++ +L+   +
Sbjct: 138 DIDMWISIGVGIAVLLIIILFFKQLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTA 197

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI +LLI P  TA  ++ S + M +L++ +G L  ++GL+    F+  +G SI
Sbjct: 198 MQSVGTILIVALLITPAATAYLYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSI 257

Query: 245 IITSLFLFILSFFY 258
           ++TS  +F++SFF 
Sbjct: 258 VLTSALIFLISFFI 271


>gi|290894112|ref|ZP_06557085.1| zurM protein [Listeria monocytogenes FSL J2-071]
 gi|290556367|gb|EFD89908.1| zurM protein [Listeria monocytogenes FSL J2-071]
          Length = 295

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 9   LQYDFIRNTFIVGLVIGIVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 68

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 69  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 128

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 129 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDVI 188

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 189 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 248

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 249 AYYLNLAPGGAIVIISVLLLIVTILYQK 276


>gi|16803888|ref|NP_465373.1| hypothetical protein lmo1848 [Listeria monocytogenes EGD-e]
 gi|224500078|ref|ZP_03668427.1| hypothetical protein LmonF1_10524 [Listeria monocytogenes Finland
           1988]
 gi|226224451|ref|YP_002758558.1| metal cations ABC transporter (permease protein) [Listeria
           monocytogenes Clip81459]
 gi|254826110|ref|ZP_05231111.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL J1-194]
 gi|254852753|ref|ZP_05242101.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL R2-503]
 gi|255521656|ref|ZP_05388893.1| metal cations ABC transporter (permease protein) [Listeria
           monocytogenes FSL J1-175]
 gi|284802294|ref|YP_003414159.1| hypothetical protein LM5578_2050 [Listeria monocytogenes 08-5578]
 gi|284995436|ref|YP_003417204.1| hypothetical protein LM5923_2001 [Listeria monocytogenes 08-5923]
 gi|300763839|ref|ZP_07073836.1| manganese ABC transporter, permease protein [Listeria monocytogenes
           FSL N1-017]
 gi|20455053|sp|Q8Y652|MNTC_LISMO RecName: Full=Manganese transport system membrane protein mntC
 gi|16411302|emb|CAC99926.1| lmo1848 [Listeria monocytogenes EGD-e]
 gi|225876913|emb|CAS05622.1| Putative metal cations ABC transporter (permease protein) [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258606078|gb|EEW18686.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL R2-503]
 gi|284057856|gb|ADB68797.1| hypothetical protein LM5578_2050 [Listeria monocytogenes 08-5578]
 gi|284060903|gb|ADB71842.1| hypothetical protein LM5923_2001 [Listeria monocytogenes 08-5923]
 gi|293595350|gb|EFG03111.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL J1-194]
 gi|300515575|gb|EFK42625.1| manganese ABC transporter, permease protein [Listeria monocytogenes
           FSL N1-017]
 gi|328466198|gb|EGF37355.1| hypothetical protein LM1816_11432 [Listeria monocytogenes 1816]
          Length = 280

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLVATIIFFIAFLF 264


>gi|254829156|ref|ZP_05233843.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL N3-165]
 gi|258601566|gb|EEW14891.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes FSL N3-165]
          Length = 280

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVVLFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLVATIIFFIAFLF 264


>gi|261340245|ref|ZP_05968103.1| zinc uptake ABC transporter, permease protein ZnuB [Enterobacter
           cancerogenus ATCC 35316]
 gi|288317330|gb|EFC56268.1| zinc uptake ABC transporter, permease protein ZnuB [Enterobacter
           cancerogenus ATCC 35316]
          Length = 261

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGVMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNINPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LLA T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVVVLGILFWQWRNLLAMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVIIGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++++  LF+ S   K
Sbjct: 243 VVLSAAVLFVFSMMKK 258


>gi|145628771|ref|ZP_01784571.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 22.1-21]
 gi|144979241|gb|EDJ88927.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 22.1-21]
          Length = 261

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 110/256 (42%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIGGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLF+LS F K
Sbjct: 243 VVICSAFLFVLSLFKK 258


>gi|227504448|ref|ZP_03934497.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium striatum ATCC 6940]
 gi|227199096|gb|EEI79144.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium striatum ATCC 6940]
          Length = 321

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 132/256 (51%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F  RA+   I   +  G +GC+++ + +A+ GD ++H+   G+A++   Q  + +   +
Sbjct: 19  DFLARAVGISILAAIVCGVVGCYVVLRGMAFIGDAVSHAVFPGLAVAFALQGSVLLGGAV 78

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
             T+ +L++    +   L  D+++G+   ++ +L +VI+S ++     LTSFLFG +  V
Sbjct: 79  AGTVVALLIAGFSQRRNLREDSVIGIFFAASFALGMVIISRVEGYTASLTSFLFGTLTGV 138

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           +  D+     +    + ++  +   L A  ++ E A+A G+    + L+  +  +  + +
Sbjct: 139 SRIDLYTAAAVTVCVVGVIVLLGPQLTAACLDKETARAMGLPVFALDLVLYLCVTAAVVI 198

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+  IG  L+ +LLI P  TAR  + S   M   +++IG      G+Y +   D P+G +
Sbjct: 199 SVGTIGNILVLALLITPAATARLLTNSLGAMMCASSLIGAAASFAGIYLAWAIDLPAGAT 258

Query: 244 IIITSLFLFILSFFYK 259
           I++    LF+L++   
Sbjct: 259 IVLVLTALFLLAWLVS 274


>gi|116872878|ref|YP_849659.1| zinc ABC transporter, permease protein [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116741756|emb|CAK20880.1| zinc ABC transporter, permease protein [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 295

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 140/268 (52%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F       G+ I +    LG FI+ ++++   D ++H  L G+A+SL         
Sbjct: 9   LQYDFIRNTFIVGLVIGIVAPLLGSFIVVRKLSLMADALSHVTLGGIAVSLFLSKTYLPL 68

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L      F  + + SL++ +++       +  + +I  + +  +++ +S     NTDL
Sbjct: 69  AALNPLYLGFGFSVVGSLLMEKLRTVYKHFEELAIPIIMSAGMGFSVIFISLANGFNTDL 128

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV+ TD++ I     +  +++  ++K L   + + E AK  G++ +   +I
Sbjct: 129 FSYLFGSVSAVSRTDMITIVVTAIIVFIVILSLYKELFLLSFDEEYAKVSGLKAKVFDII 188

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           F+++ +L+I+ S++ +GI L++SL+ LP   A R +   +   +L+ + G + +I GL+ 
Sbjct: 189 FMVLVALVIASSMRIVGILLVSSLMTLPVAAAIRIAKGFKQTILLSILFGEIAVIGGLFT 248

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           +   +   G +I+I S+ L I++  Y+K
Sbjct: 249 AYYLNLAPGGAIVIISVLLLIVTILYQK 276


>gi|322832702|ref|YP_004212729.1| ABC transporter [Rahnella sp. Y9602]
 gi|321167903|gb|ADW73602.1| ABC-3 protein [Rahnella sp. Y9602]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 96/255 (37%), Positives = 172/255 (67%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
            +    +G+ + ++ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  + 
Sbjct: 5   LLPGWLAGVLLAIAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYTVIAVT 64

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
            L +++L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  
Sbjct: 65  LLLAVLLVVLERKPHLAVDTLLGIMAHSALSLGLVVVSLMSGVRVDLMAYLFGDLLSVTY 124

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
           +DI +I     + I +L   W+ LL+ T++ ELA  +G++ ++ +++ +++T+L I +++
Sbjct: 125 SDIWMIGAGVTVVIAVLCWQWRALLSMTISPELAHVDGVKLQRTRIVLMLVTALTIGLAM 184

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +GI+ +  GL  S  +DTP+GPS++
Sbjct: 185 KFVGALIITSLLIIPAATARRFAKTPEQMACVAVAVGIIAVTGGLTFSAFYDTPAGPSVV 244

Query: 246 ITSLFLFILSFFYKK 260
           + +  LF+LS   K+
Sbjct: 245 LCAAVLFMLSLSKKQ 259


>gi|325282367|ref|YP_004254908.1| ABC-type transporter, integral membrane subunit [Deinococcus
           proteolyticus MRP]
 gi|324314176|gb|ADY25291.1| ABC-type transporter, integral membrane subunit [Deinococcus
           proteolyticus MRP]
          Length = 276

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 63/256 (24%), Positives = 129/256 (50%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF+RAL +   + +    +G +++ + ++Y GD ++H+ L G+  + +    + +   + 
Sbjct: 13  FFVRALAALSLVSVLCAVVGSWVVLRGLSYVGDAMSHAVLPGIVGAFLAGGNVLVGAVLA 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L +L +  IQ    L  D+   ++     +L +V+LS      +DL+ FL G+ L V 
Sbjct: 73  AVLAALGMNTIQARSGLKQDSATYIVFVGMFALGIVLLSRTPTFTSDLSHFLIGNPLGVT 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +          +L  + K LL  + +   A+A G+  ++++ + +++  L++ + 
Sbjct: 133 PADLWVTAAAALGVGGLLLGLQKELLLASFDPTEARAIGLPVQRLEQLLLVLIGLVVVLV 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           I  +G TL  SLLI     AR ++ S   M + A + G+LG  +GLY S    T +G ++
Sbjct: 193 IGLVGTTLSVSLLITGAAAARLYARSLRQMMLFAALFGVLGGAVGLYLSYYLGTAAGATV 252

Query: 245 IITSLFLFILSFFYKK 260
           ++ +  +F+L     +
Sbjct: 253 VLVNTVMFVLLLACSR 268


>gi|260174192|ref|ZP_05760604.1| Zinc ABC transporter, permease [Bacteroides sp. D2]
 gi|260642803|ref|ZP_05417361.2| ABC 3 transporter family protein [Bacteroides finegoldii DSM 17565]
 gi|260620503|gb|EEX43374.1| ABC 3 transporter family protein [Bacteroides finegoldii DSM 17565]
          Length = 270

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 129/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +N  D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L 
Sbjct: 124 LTINQIDLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PS
Sbjct: 184 IVACLRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++ +    K
Sbjct: 244 GASIIFFSILIYAVCKIGK 262


>gi|158338064|ref|YP_001519240.1| chelated iron ABC transporter permease [Acaryochloris marina
           MBIC11017]
 gi|158308305|gb|ABW29922.1| chelated iron ABC transporter, permease protein [Acaryochloris
           marina MBIC11017]
          Length = 282

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 136/248 (54%), Gaps = 1/248 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +  EF  R+L + + + +    +GC+++ QR+A  GD I+HS L G+ ++ I  + + + 
Sbjct: 9   LQAEFMQRSLLTAVLVGIVCATVGCYLMVQRLALLGDAISHSVLPGLVIAYIIGIDIFLG 68

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVN-TDLTSFLFGD 119
            F+    +++V+  I     +  DA +G++  +  +L + +++ ++  N  DL  FLFG+
Sbjct: 69  AFIAGVFSTIVIAWIHTQSQIKEDAAMGIVFSAFFALGITLMTVVQKENKIDLNHFLFGN 128

Query: 120 ILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSL 179
           IL+V  ++++    I  + ++++  ++K L+  T +   A+A G+    +    +++ +L
Sbjct: 129 ILSVTQSEVINTLVITLIVLVVIVLLFKELMLYTFDPVGAQAAGLPTNLLNFGLMVLIAL 188

Query: 180 MISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTP 239
            I  S+K +G+ L+ ++LI P  TA         M I+    G++  I G+Y S  F+ P
Sbjct: 189 TIVASLKSVGVILVLAMLITPGATAYLLVYRLHMMMIVGAAFGVISSITGMYLSFHFNLP 248

Query: 240 SGPSIIIT 247
           SGP+I++ 
Sbjct: 249 SGPAIVLV 256


>gi|308187170|ref|YP_003931301.1| ABC transport system membrane protein znuB [Pantoea vagans C9-1]
 gi|308057680|gb|ADO09852.1| ABC transport system membrane protein znuB [Pantoea vagans C9-1]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 100/256 (39%), Positives = 171/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +     G+ + L+ GPLG F++W++++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWIGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAVIL 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +    +L L+ +++   L+ D +LG++ HS +SL LV++S MK V  DL ++LFGD+LAV
Sbjct: 63  VTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMKNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+ ++ G   + ++++   W+ LL+ T++ ELA+ +G+  ++ +LI +++T+L I V
Sbjct: 123 TPDDLWMMGGGVIIVLLVMAWQWRSLLSMTISPELAQVDGVNIQRTRLILMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF  SPE MA +A +IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFVRSPEGMAAVAVVIGVIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI S   K
Sbjct: 243 VVLCAAILFIFSMVRK 258


>gi|47097625|ref|ZP_00235148.1| manganese ABC transporter, permease protein [Listeria monocytogenes
           str. 1/2a F6854]
 gi|254899455|ref|ZP_05259379.1| metal cations ABC transporter (permease protein) [Listeria
           monocytogenes J0161]
 gi|47014001|gb|EAL05011.1| manganese ABC transporter, permease protein [Listeria monocytogenes
           str. 1/2a F6854]
          Length = 279

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 7   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 67  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 125

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 126 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 185

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 186 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 245

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 246 GAAMVLIATIIFFIAFLF 263


>gi|215487072|ref|YP_002329503.1| high-affinity zinc transporter membrane component [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312967061|ref|ZP_07781279.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 2362-75]
 gi|215265144|emb|CAS09532.1| zinc transporter subunit ZnuB: membrane component of ABC
           superfamily [Escherichia coli O127:H6 str. E2348/69]
 gi|312288525|gb|EFR16427.1| high-affinity zinc uptake system membrane protein znuB [Escherichia
           coli 2362-75]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMMAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|283785597|ref|YP_003365462.1| high-affinity zinc uptake system membrane protein [Citrobacter
           rodentium ICC168]
 gi|282949051|emb|CBG88654.1| high-affinity zinc uptake system membrane protein [Citrobacter
           rodentium ICC168]
          Length = 262

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 99/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAAGLVWLEKRPHLAIDTLLGIMAHSVLSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + I+F  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPQDLIAIALGVMVVLAIIFWQWRNLLSMTISPDLAFVDGVKLQRVKLMLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  IG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVGIGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMLKKQ 259


>gi|237718294|ref|ZP_04548775.1| zinc ABC transporter [Bacteroides sp. 2_2_4]
 gi|293368806|ref|ZP_06615410.1| ABC 3 transport family protein [Bacteroides ovatus SD CMC 3f]
 gi|299147841|ref|ZP_07040904.1| zinc ABC transporter, permease [Bacteroides sp. 3_1_23]
 gi|229452478|gb|EEO58269.1| zinc ABC transporter [Bacteroides sp. 2_2_4]
 gi|292636111|gb|EFF54599.1| ABC 3 transport family protein [Bacteroides ovatus SD CMC 3f]
 gi|295084721|emb|CBK66244.1| ABC-type Mn2+/Zn2+ transport systems, permease components
           [Bacteroides xylanisolvens XB1A]
 gi|298514024|gb|EFI37910.1| zinc ABC transporter, permease [Bacteroides sp. 3_1_23]
          Length = 269

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 129/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +N  D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L 
Sbjct: 124 LTINQIDLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+ S + +  L+  IG LG + GL+ S  +  PS
Sbjct: 184 IVACLRMVGIVLAISLLTIPQMTANLFTYSFKKIIWLSIGIGFLGCLGGLFISYHWKVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++ +    K
Sbjct: 244 GASIIFFSILIYAVCKIGK 262


>gi|194433936|ref|ZP_03066208.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella
           dysenteriae 1012]
 gi|194417808|gb|EDX33905.1| zinc uptake ABC transporter, permease protein ZnuB [Shigella
           dysenteriae 1012]
 gi|332095255|gb|EGJ00282.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           dysenteriae 155-74]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFIDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|323499716|ref|ZP_08104682.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           sinaloensis DSM 21326]
 gi|323315218|gb|EGA68263.1| high-affinity zinc uptake system membrane protein ZnuB [Vibrio
           sinaloensis DSM 21326]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 182/256 (71%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF + ++ +G+GI L  GPLG F++W+++AYFGDT+AH++L+G+A   +  + L + + +
Sbjct: 3   EFLLPSILAGLGIALIAGPLGSFVVWRKMAYFGDTLAHASLMGIAFGFLLDVNLYLALVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              + +++L+ +QK + +++D +LG++ HS +SL LV +SF+  V  DL S+LFGD+LAV
Sbjct: 63  CCLILAVILVTLQKQQQVATDTLLGILAHSALSLGLVAVSFLDDVRIDLMSYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + TD++ I+    +  +IL   W+PLLATTV+ +LA  +G   + ++L+ +++  L+I++
Sbjct: 123 SPTDLMYIYSGAVIVAIILAFAWRPLLATTVSEDLAAVDGHNVDLMRLLLMLLIGLVIAI 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
            +KF+G  ++TSLLI+P  +AR FS +PE MA +A++IG + +++GL  S  FDTP+GPS
Sbjct: 183 GMKFVGALIMTSLLIIPAASARSFSKTPEQMAAIASVIGAIAVLLGLSMSWHFDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I++  +F+LS   K
Sbjct: 243 VVISATAMFMLSQLVK 258


>gi|56421005|ref|YP_148323.1| metal (zinc) ABC transporter permease [Geobacillus kaustophilus
           HTA426]
 gi|56380847|dbj|BAD76755.1| metal (zinc) ABC transporter (permease) [Geobacillus kaustophilus
           HTA426]
          Length = 277

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 132/267 (49%), Gaps = 8/267 (2%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------- 54
             EF   A  +G+    +   LG FI+ +R++   D ++H  L G+A  L+         
Sbjct: 7   QYEFLRNAFVAGVLTGFTAPLLGVFIVVRRLSLIADALSHVTLAGIAAGLLLSSSAPAAA 66

Query: 55  -LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLT 113
                      + + SL + +++       +  + ++  S + L+++ +S      TDL 
Sbjct: 67  SWNPLYIGMGFSVVGSLFIEKLRAVYRHYEELAIPIVLSSGLGLSVIFISMANGFTTDLF 126

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           S+LFG + AV+  D+   + +     +++   +K L   + + E A+  G++   I  +F
Sbjct: 127 SYLFGSVSAVSRADVWTAFAVAAAAAIVILTFYKELFLLSFDEEYARVSGVRTTLIHFLF 186

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
           I++ +L+I+ S++ +G+ LI+SL+ LP   + R + S + M  L+ + G L +I GL+ +
Sbjct: 187 IVLVALVIAASMRIVGVLLISSLMTLPVAASIRIAKSFKQMIGLSILFGELAVIAGLWAA 246

Query: 234 LIFDTPSGPSIIITSLFLFILSFFYKK 260
              D   G +I+I ++ + + +  +K+
Sbjct: 247 YELDWAPGGTIVIAAVVILLFALGWKR 273


>gi|318041238|ref|ZP_07973194.1| ABC transporter [Synechococcus sp. CB0101]
          Length = 279

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 122/247 (49%), Gaps = 1/247 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F ++AL     +    G L C++  +  A  GD ++H+ + GV ++    LP ++  F
Sbjct: 10  HAFMVKALLVSALVGGVCGLLSCYMTLKGWALMGDAVSHAVMPGVVVAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S ++  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRIKEDTVIGLVFTGFFALGLVLVSKVR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++++DI     I  L + +L    + LL    +   A++ G+    +  + + + SL   
Sbjct: 129 ISSSDIQQTLLISALVVGLLLVFRRDLLLFCFDPTHARSIGINTGVLHYMLLSVLSLTAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +G+ L+ ++L+ P  TA   +   + M +LA    +L  +IG+Y S   D+ +  
Sbjct: 189 AGLQTVGVILVVAMLVTPGATAYLLTDRFDRMTLLAIASSVLSSLIGVYVSYWSDSSTAG 248

Query: 243 SIIITSL 249
            I++   
Sbjct: 249 CIVLVQT 255


>gi|327396531|dbj|BAK13952.1| chelated iron transport system membrane protein YfeC [Pantoea
           ananatis AJ13355]
          Length = 286

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 131/256 (51%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F
Sbjct: 10  YQYMLNAMWISAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  D I+G+I  S   L L ++S +   + ++ + + G+ILA
Sbjct: 70  LSGGLAAGSMLLLNQRTRLKEDTIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +  +DI+ +   G  ++ ILF  WK L+ T  +   A+A G+ P ++K++F  + ++   
Sbjct: 129 IAPSDIIQLLITGLTSVAILFFKWKDLMVTFFDENHARAVGLNPVRLKILFFTLLAVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +  +A  IG +   +G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLAIAVAIGSITSFMGAWASYYLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVAQTLLFLLAFIF 264


>gi|301327648|ref|ZP_07220856.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 78-1]
 gi|300845796|gb|EFK73556.1| high-affinity zinc transporter membrane component [Escherichia coli
           MS 78-1]
          Length = 261

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ + K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLGKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFILS   K+
Sbjct: 243 VVLCAALLFILSMMKKQ 259


>gi|149176920|ref|ZP_01855529.1| manganese ABC transporter permease protein [Planctomyces maris DSM
           8797]
 gi|148844175|gb|EDL58529.1| manganese ABC transporter permease protein [Planctomyces maris DSM
           8797]
          Length = 501

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 123/265 (46%), Gaps = 15/265 (5%)

Query: 10  LFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTI---------- 59
           +     + +S G +G F + ++ A  GD ++H+ L G+AL+ I      +          
Sbjct: 62  ILGTTLLGMSAGMIGSFALLRKRALMGDALSHATLPGIALAFILATSFGMNGKTLPVLLS 121

Query: 60  CIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWV----NTDLTSF 115
              +   L    +L I+    L  DA LG++        + +L  ++ +       L SF
Sbjct: 122 GAAISGLLGIASILMIRNLTRLKEDAALGIVLSVFFGAGVALLGIVQQMQTGHAAGLESF 181

Query: 116 LFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIM 175
           ++G   ++  +D  LI   G   ++I   ++K L     +   A + G     + +I + 
Sbjct: 182 IYGKTASMVASDAWLIGSAGLTCMLISIFLYKELTLLCFDEGFAHSRGFPVVLLDMILMG 241

Query: 176 ITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI 235
           +  ++  + ++ +G+ L+ SLL++P   AR ++     ++ +ATI+G L  ++G   S I
Sbjct: 242 LVVVVTIIGLQAVGLILMISLLVIPPAAARFWTEKIFYLSFVATILGALSGMVGSAMSAI 301

Query: 236 F-DTPSGPSIIITSLFLFILSFFYK 259
           F + PSG  I++ +  +F++S  + 
Sbjct: 302 FPNLPSGAMIVLVATSMFLVSMVFG 326


>gi|145632654|ref|ZP_01788388.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 3655]
 gi|329122282|ref|ZP_08250870.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
 gi|144986849|gb|EDJ93401.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 3655]
 gi|327473843|gb|EGF19260.1| zinc ABC superfamily ATP binding cassette transporter, membrane
           protein [Haemophilus aegyptius ATCC 11116]
          Length = 261

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 111/256 (43%), Positives = 175/256 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLF+LS F K
Sbjct: 243 VVICSAFLFVLSLFKK 258


>gi|260904658|ref|ZP_05912980.1| ABC-3 protein [Brevibacterium linens BL2]
          Length = 297

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 125/257 (48%), Gaps = 1/257 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            EF IRAL + +   +    L C++I    +  GD ++H+ L GV ++ I  +P      
Sbjct: 13  YEFMIRALTTTVLAAIVCALLSCWLILVGWSLMGDAVSHAVLPGVVIAYIAGIPFAAGAL 72

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   +    +  ++    +  DA +G++  +  +L LV++S     +TDL   +FG+IL 
Sbjct: 73  VFGFIAVAAIGILRGTSRIKEDAAIGIVFTTLFALGLVLISTTP-SHTDLNHIIFGNILG 131

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+T+D+  I  +  +   +L    + L     +   A A G+ P  +  + + + +L   
Sbjct: 132 VSTSDLRQIALLAVIAFAVLIAKRRDLTLYAFDPTHAYAIGLSPRVLGALLLALLALTTV 191

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           V+++ +G+ L+ ++LI+P  TA   +     M ++A I+  L  ++G+Y S   D  SG 
Sbjct: 192 VALQVVGVILVVAMLIIPGATAHLLTDRFNRMLLIAPIMSALSSVLGIYLSYWLDASSGG 251

Query: 243 SIIITSLFLFILSFFYK 259
            +++    +F   + + 
Sbjct: 252 LVVLVQGVVFTGVYLFS 268


>gi|307545930|ref|YP_003898409.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307217954|emb|CBV43224.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 381

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 135/253 (53%), Gaps = 10/253 (3%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           +            + L +G LG F + ++ +  GDT++H+AL GV +  I      + I 
Sbjct: 9   DYTIRNVAIGAALLGLISGVLGSFAVLRKQSLLGDTMSHAALPGVCIGFIIAGAREMGII 68

Query: 63  MIATLTS-----LVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTD----LT 113
           ++  LT+     LV+L + +N  L +DA LG+   ++ +L +V+L+ ++ +N      L 
Sbjct: 69  LLGALTTGALAALVMLLLTRNSRLKTDAGLGITLSTSFALGVVLLTHIQNMNNAAQGGLD 128

Query: 114 SFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIF 173
           +FLFG   A   +D+ ++ GI  + ++++  +WK     + + E A + GM    ++++ 
Sbjct: 129 AFLFGQAAATLRSDLWIMGGITLVALVLVSALWKEFKLVSFDPEFAASLGMPVMWLEVVL 188

Query: 174 IMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGS 233
            ++ +L + V ++ +G+ L+ +++I P V AR++S   E M +LA +IG+ G + G   S
Sbjct: 189 TVMIALAVVVGLQMVGVVLMAAMIIAPAVAARQWSRRLEGMVMLAAVIGVSGGVFGAVLS 248

Query: 234 LIF-DTPSGPSII 245
            +     +GP II
Sbjct: 249 ALSRGLATGPLII 261


>gi|309972434|gb|ADO95635.1| Zinc transporter permease subunit ZnuB [Haemophilus influenzae
           R2846]
          Length = 261

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 112/256 (43%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A +I +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVISMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLFILS F K
Sbjct: 243 VVICSAFLFILSLFKK 258


>gi|329116555|ref|ZP_08245272.1| metal ion ABC transporter, permease protein [Streptococcus
           parauberis NCFD 2020]
 gi|326906960|gb|EGE53874.1| metal ion ABC transporter, permease protein [Streptococcus
           parauberis NCFD 2020]
          Length = 276

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 141/258 (54%), Gaps = 1/258 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              F   A  + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I  
Sbjct: 12  QYHFLQNAFITALIIGIVSGVVGCFIILRSMSLMGDAISHAVLPGVAISYILGINFFIGA 71

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            +   L+SL +  I++N  +  D  +G+   S ++L ++++   +   T+L S LFG+IL
Sbjct: 72  IVFGLLSSLFITYIKENSIIKGDTAIGITFSSFLALGVILIGIAQ-STTNLFSILFGNIL 130

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  +D  +  G+  L ++ +   +K L  T+ +  LA+  G+       + +++ +L+ 
Sbjct: 131 AVQDSDKWITIGVSCLVLLTIVLFFKELQLTSFDPVLAQTMGINVCAYHYLLMVLLTLVA 190

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
             +++ +G  LI +LLI P  TA  +  S + M +L+  +G +  ++GL+    F+  +G
Sbjct: 191 VTAMQSVGTILIVALLITPAATAYLYVNSLKEMLLLSATLGAVSSVLGLFIGYTFNIAAG 250

Query: 242 PSIIITSLFLFILSFFYK 259
            +I++T+ FLF +SFF  
Sbjct: 251 STIVLTAAFLFAISFFIS 268


>gi|228993024|ref|ZP_04152947.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           pseudomycoides DSM 12442]
 gi|228999074|ref|ZP_04158656.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           mycoides Rock3-17]
 gi|229006622|ref|ZP_04164257.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           mycoides Rock1-4]
 gi|228754671|gb|EEM04081.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           mycoides Rock1-4]
 gi|228760691|gb|EEM09655.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           mycoides Rock3-17]
 gi|228766672|gb|EEM15312.1| ABC-type Mn2+/Zn2+ transport system, permease component [Bacillus
           pseudomycoides DSM 12442]
          Length = 277

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/268 (25%), Positives = 143/268 (53%), Gaps = 8/268 (2%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQ------ 54
           +  +F   +L++GI I L    +G F++ +R++   D ++H  L G+A SL+ +      
Sbjct: 6   LQYDFLRNSLYAGILIGLVAPLIGVFVVIRRMSLIADALSHVTLSGIAASLLLEKTIFTG 65

Query: 55  --LPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDL 112
             L       + +   +L++ +++       +  + +I  + + L +V +S     NTDL
Sbjct: 66  GFLNPLYMGMIFSIGGALLIEKLRTVYKHYQELAIPIILSAGMGLGVVFISLANGFNTDL 125

Query: 113 TSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI 172
            S+LFG + AV +TD++LI  +  + I  +  ++K L   + + E A + G++ + I  I
Sbjct: 126 FSYLFGSVSAVTSTDLILIGIVAIVVIATIILLYKELFLLSFDEEYAVSTGLRAKWIHFI 185

Query: 173 FIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYG 232
           FI++ +L+I+VS++ +G+ L++SL+ LP   + R +   +     + + G + +I GL+ 
Sbjct: 186 FIILVALVIAVSMRVVGVLLVSSLMTLPVAASIRIAKGFKQTIFFSILFGEISVIGGLFA 245

Query: 233 SLIFDTPSGPSIIITSLFLFILSFFYKK 260
           S   D   G +I++ ++ + I +  +KK
Sbjct: 246 SYQLDLAPGGTIVMLAVLILIGAILWKK 273


>gi|256957532|ref|ZP_05561703.1| manganese transport system membrane protein [Enterococcus faecalis
           DS5]
 gi|256959731|ref|ZP_05563902.1| manganese transporter membrane protein [Enterococcus faecalis
           Merz96]
 gi|256964615|ref|ZP_05568786.1| manganese transporter membrane protein [Enterococcus faecalis
           HIP11704]
 gi|257089038|ref|ZP_05583399.1| ABC cation transporter permease [Enterococcus faecalis CH188]
 gi|257420871|ref|ZP_05597861.1| ABC cation transporter [Enterococcus faecalis X98]
 gi|256948028|gb|EEU64660.1| manganese transport system membrane protein [Enterococcus faecalis
           DS5]
 gi|256950227|gb|EEU66859.1| manganese transporter membrane protein [Enterococcus faecalis
           Merz96]
 gi|256955111|gb|EEU71743.1| manganese transporter membrane protein [Enterococcus faecalis
           HIP11704]
 gi|256997850|gb|EEU84370.1| ABC cation transporter permease [Enterococcus faecalis CH188]
 gi|257162695|gb|EEU92655.1| ABC cation transporter [Enterococcus faecalis X98]
 gi|323479778|gb|ADX79217.1| manganese transport system membrane spanning domain protein
           [Enterococcus faecalis 62]
          Length = 280

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 14  FLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 133 DIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 253 VLTAAFLFVISFLIS 267


>gi|145636324|ref|ZP_01791993.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittHH]
 gi|145638682|ref|ZP_01794291.1| RNA-binding protein Hfq [Haemophilus influenzae PittII]
 gi|145270489|gb|EDK10423.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittHH]
 gi|145272277|gb|EDK12185.1| RNA-binding protein Hfq [Haemophilus influenzae PittII]
 gi|309750175|gb|ADO80159.1| Zinc transporter permease subunit ZnuB [Haemophilus influenzae
           R2866]
          Length = 261

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 112/256 (43%), Positives = 175/256 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    AL +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPALLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLFILS F K
Sbjct: 243 VVICSAFLFILSLFKK 258


>gi|318605912|emb|CBY27410.1| manganese ABC transporter, inner membrane permease protein SitC
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 294

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILISFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFSRLLVIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 VIVTLQTVVFLLAFFF 265


>gi|315612700|ref|ZP_07887612.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis ATCC 49296]
 gi|315315287|gb|EFU63327.1| metal cation ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis ATCC 49296]
          Length = 282

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 83/254 (32%), Positives = 148/254 (58%), Gaps = 1/254 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + I I +  G +GCFII + ++  GD I+H+ L GVALS I  +   I   + 
Sbjct: 14  FLQNALITAIVIGVVAGAVGCFIILRGMSLMGDAISHAVLPGVALSFILGIDFFIGAIIF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             + S+++  I+ N  + SD  +G+   S ++L ++++S  K  +TDL   LFG+ILAV 
Sbjct: 74  GLMASIIITYIKGNSIIKSDTAIGITFSSFLALGVILISVAK-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D+ +  G+G + ++I+   +K LL T+ +  LAKA GM  +    + +++ +L+   +
Sbjct: 133 DMDMWITIGVGAIILLIIGIFFKQLLITSFDELLAKAMGMPVDFYHYLLMVLLTLVSVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S ++M  L++ +G L  ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKSMIFLSSSLGALASVVGLFIGYSFNLAAGSSI 252

Query: 245 IITSLFLFILSFFY 258
           ++TS   F++SFF 
Sbjct: 253 VLTSASFFLISFFI 266


>gi|256854536|ref|ZP_05559900.1| cation ABC transporter [Enterococcus faecalis T8]
 gi|256710096|gb|EEU25140.1| cation ABC transporter [Enterococcus faecalis T8]
          Length = 280

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 141/255 (55%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 14  FLQNALITSVVIGVVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++I+   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 133 DIDKWITIGVSVLVLVIVVLFFKELLITSFDPLMAKAIGMNVSFYHYLLMVLLTLVAVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGASSSLLGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 253 VLTAAFLFVISFLIS 267


>gi|30063270|ref|NP_837441.1| high-affinity zinc transporter membrane component [Shigella
           flexneri 2a str. 2457T]
 gi|110805803|ref|YP_689323.1| high-affinity zinc transporter membrane component [Shigella
           flexneri 5 str. 8401]
 gi|30041522|gb|AAP17250.1| hypothetical protein S1935 [Shigella flexneri 2a str. 2457T]
 gi|110615351|gb|ABF04018.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281601274|gb|ADA74258.1| High-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2002017]
 gi|313650645|gb|EFS15047.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2a str. 2457T]
 gi|332756759|gb|EGJ87106.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 4343-70]
 gi|332757636|gb|EGJ87969.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri 2747-71]
 gi|332758047|gb|EGJ88373.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-671]
 gi|332766835|gb|EGJ97036.1| fecCD transport family protein [Shigella flexneri 2930-71]
 gi|333003563|gb|EGK23103.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri VA-6]
 gi|333004712|gb|EGK24235.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-272]
 gi|333004751|gb|EGK24273.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-218]
 gi|333018432|gb|EGK37730.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-227]
 gi|333018546|gb|EGK37840.1| high-affinity zinc uptake system membrane protein znuB [Shigella
           flexneri K-304]
          Length = 261

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E       +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQQVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI+S   K+
Sbjct: 243 VVLCAALLFIISMMKKQ 259


>gi|260436061|ref|ZP_05790031.1| manganese transport system membrane protein MntB [Synechococcus sp.
           WH 8109]
 gi|260413935|gb|EEX07231.1| manganese transport system membrane protein MntB [Synechococcus sp.
           WH 8109]
          Length = 274

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 125/255 (49%), Gaps = 1/255 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
           + F ++AL     +    G L CF+  +  A  GD ++H+ L GV ++    LP ++  F
Sbjct: 10  HAFMLKALMISALVGGVCGLLSCFMTLKGWALMGDAVSHAVLPGVVVAYALGLPFSLGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +    +   +  +++   +  D ++G++     +L LV++S  +  N DLT  LFG++L 
Sbjct: 70  VFGVGSVAAIGFVKQKSRVKEDTVIGLVFTGFFALGLVLVSKTR-SNIDLTHILFGNVLG 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           ++  D+     I  L +++L    + L+    +   A++ G+    +  + + + SL   
Sbjct: 129 ISAGDVQQTLMISVLVLVLLLLFRRDLMLFCFDPTHARSIGINTGLLHYMLLGLLSLAAV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
             ++ +GI L+ S+L+ P  TA   +   + M +LA    +L  ++G++ S   D+ +  
Sbjct: 189 AGLQTVGIILVVSMLVTPGATAYLLTDRFDRMTLLAVTSSVLSSVLGVFISYWTDSSTAG 248

Query: 243 SIIITSLFLFILSFF 257
            I++     F+L+F 
Sbjct: 249 CIVLAQTAQFVLAFL 263


>gi|198245595|ref|YP_002215193.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|197940111|gb|ACH77444.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|134102467|ref|YP_001108128.1| ABC transporter [Saccharopolyspora erythraea NRRL 2338]
 gi|291004142|ref|ZP_06562115.1| ABC transporter [Saccharopolyspora erythraea NRRL 2338]
 gi|133915090|emb|CAM05203.1| ABC transporter component, possibly Mn transport [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 292

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 123/253 (48%), Gaps = 1/253 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F  RAL   +   L    L C++     +  GD ++H+ L GV L+ +  LP +   F+ 
Sbjct: 16  FMQRALLISVVAGLVCAVLSCWVTLIGWSLLGDAVSHAVLPGVVLAYVLSLPFSAGAFLF 75

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
            TL   ++  ++    L  DA +GV+     +L LV++S +     DL   LFG++L V+
Sbjct: 76  GTLAVGLIAAVRSTTKLKGDAAIGVVFTGLFALGLVLVSRIP-SQVDLNHILFGNVLGVS 134

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            +DI+ +  I  L + +     + L     +   A A G+ P +I  + + + +L + V+
Sbjct: 135 DSDIIQVLVIAGLVLTVALLKRRDLTLYAFDPTHAHAIGLNPRRIAALLLTMLALTVVVA 194

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G+ L+T++LI P  TA   +     M  +A  + +   ++G Y S   DT +G  I
Sbjct: 195 LQAVGVILVTAMLITPGATAFLLTRRFSRMLAVAAALSVFSGVLGTYLSFHVDTSTGGMI 254

Query: 245 IITSLFLFILSFF 257
           ++    LF + + 
Sbjct: 255 VLCQACLFGVVYL 267


>gi|95931250|ref|ZP_01313969.1| ABC-3 [Desulfuromonas acetoxidans DSM 684]
 gi|95132686|gb|EAT14366.1| ABC-3 [Desulfuromonas acetoxidans DSM 684]
          Length = 271

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 132/257 (51%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            + F   AL  G+   L+ G +G F++ +RI Y    IAH+ L G+ ++        +  
Sbjct: 9   QHTFLQNALLGGVLASLTCGVVGSFVVVRRIGYLAGGIAHAVLGGMGVAFFLGKAPLLGA 68

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
            + A + ++++  + +      D I+  +    ++  ++ ++     N DL S+LFG++L
Sbjct: 69  LIAALMAAIIISFVNRRGHQQEDTIISALWAVGMATGILFIAKTPGYNVDLMSYLFGNVL 128

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            ++  D+LLI G+  + ++     +K LLA   + E A   G++ E +  + + + ++ +
Sbjct: 129 MISRQDLLLIAGLDGIILVFTGLFFKQLLALCYDPEFATLRGIRVETLNTLLLCLVAVTV 188

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            + I+ +G+ L+ +LL LP  TAR ++ +   M  LAT+IG+     GL  S  +D P+G
Sbjct: 189 VILIQIVGLILVIALLTLPAATARLYAATLVVMMALATLIGLGITSGGLALSYNYDLPAG 248

Query: 242 PSIIITSLFLFILSFFY 258
            +I + S   ++++   
Sbjct: 249 ATIALLSGLCYLIAIII 265


>gi|330957156|gb|EGH57416.1| hypothetical protein PMA4326_01115 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 262

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 180/259 (69%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
             +F + AL +G+ + L  GPLG F++W+R+AYFGDT++H+ALLGVAL  +  +  TI +
Sbjct: 1   MADFLLYALLAGVALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDISPTIAV 60

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
                L +++L+ +Q+ + L+SD +LG++  ST+SL LV+LSFM  V  DL ++LFGD+L
Sbjct: 61  TCGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHEVRIDLMAYLFGDLL 120

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           A++  D+  I G   L ++ +  +W+PLLA TV+ ELA+ EG+    +++  +++ +++I
Sbjct: 121 AISPADLAWIMGGSSLVLVTIIALWRPLLAMTVHEELARVEGLPVAALRMALMLLIAVVI 180

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           +V++K +G+ LITSLLI+P   A+R + SPE MAI A+++G+  + IGL  S   DTP+G
Sbjct: 181 AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAIGASLLGVTAVCIGLSLSWFKDTPAG 240

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI++++  LF+LSF   +
Sbjct: 241 PSIVVSAAALFLLSFVLPR 259


>gi|16765235|ref|NP_460850.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167552473|ref|ZP_02346226.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167994194|ref|ZP_02575286.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168234046|ref|ZP_02659104.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238523|ref|ZP_02663581.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168241521|ref|ZP_02666453.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168259834|ref|ZP_02681807.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168462576|ref|ZP_02696507.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168820716|ref|ZP_02832716.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194449891|ref|YP_002045946.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194470572|ref|ZP_03076556.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737285|ref|YP_002114928.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197249045|ref|YP_002146130.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197262375|ref|ZP_03162449.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|200389939|ref|ZP_03216550.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205352401|ref|YP_002226202.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856586|ref|YP_002243237.1| high-affinity zinc transporter membrane protein [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|238912047|ref|ZP_04655884.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|16420429|gb|AAL20809.1| ABC superfamily high affinity Zn transport protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|194408195|gb|ACF68414.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194456936|gb|EDX45775.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712787|gb|ACF92008.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195634593|gb|EDX52945.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197212748|gb|ACH50145.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197240630|gb|EDY23250.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288647|gb|EDY28022.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|199602384|gb|EDZ00930.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205272182|emb|CAR37040.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205322932|gb|EDZ10771.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327896|gb|EDZ14660.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205331999|gb|EDZ18763.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339430|gb|EDZ26194.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205342733|gb|EDZ29497.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205351260|gb|EDZ37891.1| zinc uptake ABC transporter, permease protein ZnuB [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708389|emb|CAR32693.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261247064|emb|CBG24883.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267993875|gb|ACY88760.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301158414|emb|CBW17921.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312912887|dbj|BAJ36861.1| high-affinity zinc ABC transporter permease protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320085490|emb|CBY95271.1| Chelated iron transport system membrane protein yfeD [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321224536|gb|EFX49599.1| Zinc ABC transporter, inner membrane permease protein ZnuB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323130177|gb|ADX17607.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326622942|gb|EGE29287.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326627453|gb|EGE33796.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332988787|gb|AEF07770.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 170/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|170717770|ref|YP_001784836.1| ABC transporter [Haemophilus somnus 2336]
 gi|168825899|gb|ACA31270.1| ABC-3 protein [Haemophilus somnus 2336]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 108/256 (42%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT+AHSALLGV L +   +   + I +
Sbjct: 3   EILFPAWLTGILLSLITAPLGSFVVWRKMAYFGDTLAHSALLGVTLGIFLHINPYVAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +++++ ++ N   S D +LG+I HS +SL +V ++ ++ V  DL ++LFGD+LA+
Sbjct: 63  LTVLLAILMVWLESNTQYSIDTLLGIIAHSCLSLGVVTVALLQNVRVDLMAYLFGDLLAL 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+  I     + + IL   W+PLL+ TV+ ELA+ EG+  ++++ + +++T+L I++
Sbjct: 123 GFDDLYFIAIGVSIVLGILIFFWQPLLSITVSPELAQVEGINIKRMQFLLMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TA+RF+ SPE M I+A  + ++ I +GL  S  +DTPSGPS
Sbjct: 183 SMKFVGALIITSLLIIPAATAKRFARSPEMMVIIAIFVSMISITLGLTLSAFYDTPSGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I+S FLFILS F K
Sbjct: 243 VVISSTFLFILSLFKK 258


>gi|123442179|ref|YP_001006160.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122089140|emb|CAL11982.1| chelated iron transport system membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 294

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             + ++A++    +      L  +++ +  +  GD ++HS + GVA +    LP     F
Sbjct: 11  YNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGLPYAAGAF 70

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L +  ++    L  DAI+G I  +  ++  +++  +   + ++ S +FG+IL 
Sbjct: 71  FTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAIG-LLIVSLNPTSVNVQSIIFGNILG 129

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D+L +  I  ++ +IL  IWK LLA   +   A + G+ P ++K++F  + S    
Sbjct: 130 IADEDVLQVEIIILISFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTV 189

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+ ++++ P  TA   +     + ++A  IG      G Y S   D  +G 
Sbjct: 190 AALQTVGAILVIAMVVTPGATAYLLTDRFSRLLVIAIAIGAFTSAFGAYLSFYLDGATGG 249

Query: 243 SIIITSLFLFILSFFY 258
            I+     +F+L+FF+
Sbjct: 250 VIVTLQTVVFLLAFFF 265


>gi|238792586|ref|ZP_04636219.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           intermedia ATCC 29909]
 gi|238728221|gb|EEQ19742.1| High-affinity zinc uptake system membrane protein znuB [Yersinia
           intermedia ATCC 29909]
          Length = 257

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 96/251 (38%), Positives = 168/251 (66%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
            +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  + 
Sbjct: 1   MLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIAMT 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
            + +++L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V  
Sbjct: 61  MVLAVILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMHNVRVDLMAYLFGDLLSVTL 120

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
           +DI LI     + + +L   W+ LL+ TV+ ELA  +G+  E+++++ +++T+L I +S+
Sbjct: 121 SDIWLIAAGVIVVLAVLGWQWRALLSMTVSPELAHVDGVNLERVRMLLMLVTALTIGLSM 180

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           KF+G  +ITSLLI+P   ARRF+ +PE MA +A  IGI+ +  GL  S  +DTP+GPS++
Sbjct: 181 KFVGALIITSLLIIPAAAARRFAQTPEQMAGIAIGIGIVAVTGGLTFSAFYDTPAGPSVV 240

Query: 246 ITSLFLFILSF 256
           + +  +F+LS 
Sbjct: 241 LCAAVMFVLSL 251


>gi|257880418|ref|ZP_05660071.1| cation ABC transporter [Enterococcus faecium 1,230,933]
 gi|257891747|ref|ZP_05671400.1| cation ABC transporter [Enterococcus faecium 1,231,410]
 gi|257894493|ref|ZP_05674146.1| cation ABC transporter [Enterococcus faecium 1,231,408]
 gi|260559382|ref|ZP_05831563.1| cation ABC transporter [Enterococcus faecium C68]
 gi|293564024|ref|ZP_06678430.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|294620402|ref|ZP_06699711.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|294623817|ref|ZP_06702645.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|314937455|ref|ZP_07844790.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|314942626|ref|ZP_07849457.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|314949273|ref|ZP_07852618.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
 gi|314952464|ref|ZP_07855468.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|314993651|ref|ZP_07859002.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|314998211|ref|ZP_07863084.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|257814646|gb|EEV43404.1| cation ABC transporter [Enterococcus faecium 1,230,933]
 gi|257828107|gb|EEV54733.1| cation ABC transporter [Enterococcus faecium 1,231,410]
 gi|257830872|gb|EEV57479.1| cation ABC transporter [Enterococcus faecium 1,231,408]
 gi|260074481|gb|EEW62802.1| cation ABC transporter [Enterococcus faecium C68]
 gi|291593315|gb|EFF24880.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1679]
 gi|291596771|gb|EFF27994.1| manganese transport system membrane protein MntB [Enterococcus
           faecium U0317]
 gi|291603942|gb|EFF33470.1| manganese transport system membrane protein MntB [Enterococcus
           faecium E1162]
 gi|313587775|gb|EFR66620.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a01]
 gi|313591914|gb|EFR70759.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133B]
 gi|313595446|gb|EFR74291.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133A]
 gi|313598636|gb|EFR77481.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133C]
 gi|313643189|gb|EFS07769.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0133a04]
 gi|313644346|gb|EFS08926.1| metal ion ABC transporter, permease protein [Enterococcus faecium
           TX0082]
          Length = 280

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 140/255 (54%), Gaps = 1/255 (0%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL + + I + +G +GCFII + ++  GD I+H+ L GVA+S I  +   I   + 
Sbjct: 14  FLQNALITSVVIGIVSGTVGCFIILRGMSLMGDAISHAVLPGVAISYILGINFFIGAIVF 73

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
             L S+++  I+ N  +  D  +G+   S ++L ++++      +TDL   LFG+ILAV 
Sbjct: 74  GLLASIIITFIKSNSVIKGDTAIGITFSSFLALGVILIGVAN-SSTDLFHILFGNILAVQ 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
             D  +  G+  L ++ +   +K LL T+ +  +AKA GM       + +++ +L+   +
Sbjct: 133 DIDKWITIGVSVLVLVTVVLFFKELLITSFDPLMAKAMGMNVSFYHYLLMILLTLVAVTA 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +G  LI ++LI P  TA  ++ S + M  ++  +G    ++GL+    F+  +G SI
Sbjct: 193 MQSVGTILIVAMLITPAATAYLYANSLKTMIFISATVGACSSLLGLFIGYSFNIAAGSSI 252

Query: 245 IITSLFLFILSFFYK 259
           ++T+ FLF++SF   
Sbjct: 253 VLTAAFLFVISFLIS 267


>gi|53712014|ref|YP_098006.1| zinc ABC transporter permease [Bacteroides fragilis YCH46]
 gi|60680214|ref|YP_210358.1| putative ABC transporter membrane protein [Bacteroides fragilis
           NCTC 9343]
 gi|253563950|ref|ZP_04841407.1| zinc ABC transporter permease [Bacteroides sp. 3_2_5]
 gi|265765353|ref|ZP_06093628.1| zinc ABC transporter permease [Bacteroides sp. 2_1_16]
 gi|52214879|dbj|BAD47472.1| zinc ABC transporter permease [Bacteroides fragilis YCH46]
 gi|60491648|emb|CAH06400.1| putative ABC transporter membrane protein [Bacteroides fragilis
           NCTC 9343]
 gi|251947726|gb|EES88008.1| zinc ABC transporter permease [Bacteroides sp. 3_2_5]
 gi|263254737|gb|EEZ26171.1| zinc ABC transporter permease [Bacteroides sp. 2_1_16]
 gi|301161740|emb|CBW21280.1| putative ABC transporter membrane protein [Bacteroides fragilis
           638R]
          Length = 269

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 63/259 (24%), Positives = 128/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYAGISPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + K + +  D+ + +     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSKRKDMREDSAIAMFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +  TD+L++  +  L I+       P++    + E A+++G+    ++ I +M  +L 
Sbjct: 124 LTITQTDLLMLGILAILLILFFTLFIHPIIYVAFDREFARSQGIPVVVLEYILMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+   + +  L+  IG L  + GL  S   + PS
Sbjct: 184 IVSCLRMVGIVLAISLLTIPQMTANLFTNKFKRIIWLSIAIGYLSCLGGLLISYRLNVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++I     K
Sbjct: 244 GASIIFFSILIYIACKIGK 262


>gi|254912406|ref|ZP_05262418.1| manganese ABC transporter [Listeria monocytogenes J2818]
 gi|254936733|ref|ZP_05268430.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes F6900]
 gi|258609330|gb|EEW21938.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes F6900]
 gi|293590388|gb|EFF98722.1| manganese ABC transporter [Listeria monocytogenes J2818]
          Length = 280

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLIATIIFFIAFLF 264


>gi|300717082|ref|YP_003741885.1| Zinc uptake ABC transporter permease [Erwinia billingiae Eb661]
 gi|299062918|emb|CAX60038.1| Zinc uptake ABC transporter, permease protein [Erwinia billingiae
           Eb661]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 172/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +   F+G  + L+ GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWFAGFLLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNISPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           I  L SL+L+ +++   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+L+V
Sbjct: 63  ITLLLSLLLVWLERRPHLAIDTLLGILAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
             TD+  I     + + +L   W+ LL+ T++ ELA+ +G+  ++ K++ +++T+L I V
Sbjct: 123 TPTDLYTIGAGVAIVLAVLAFYWRSLLSMTISPELAQVDGVNIQRTKMVLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ SPE MA +A ++GIL +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARSPEQMAGIAILVGILAVTAGLTFSAWYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  +F+LS   +
Sbjct: 243 VVLGASLMFMLSMMKR 258


>gi|288941288|ref|YP_003443528.1| ABC-3 protein [Allochromatium vinosum DSM 180]
 gi|288896660|gb|ADC62496.1| ABC-3 protein [Allochromatium vinosum DSM 180]
          Length = 284

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 67/256 (26%), Positives = 136/256 (53%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           F   AL +G+   +  G +G F++ +RIA+    IAHS L G+  +L F +       + 
Sbjct: 13  FLQSALIAGLLASVGCGVIGTFVVVKRIAFMAGGIAHSVLGGMGAALYFGVDPFAGALIA 72

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           A L++L++  ++ +     D ++G +    +++ ++ ++     ++DL SFLFG+IL V 
Sbjct: 73  AILSALLIGAVRLSWKTQEDTLIGALWAIGMAVGVLFIAKTPGYSSDLMSFLFGNILLVP 132

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
           T ++  + G+  + +  +   ++  LA T + E A+  G+      L+ + + ++ + + 
Sbjct: 133 TRELWWMAGLDLVLVATVALFYRQFLAVTFDEEFARLRGVPVTLFYLLLLCLVAVTVVLL 192

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           I+ +G+ L+ +LL LP   A  +  S   M ++AT +G L   +GL  S   D P+GP++
Sbjct: 193 IQVVGLILVIALLTLPAAIAGHYVHSLGAMMLIATGLGALFTTLGLALSFGPDLPAGPTM 252

Query: 245 IITSLFLFILSFFYKK 260
           I+ +  ++ILS    +
Sbjct: 253 ILLAGGVYILSALISR 268


>gi|160902451|ref|YP_001568032.1| ABC-3 protein [Petrotoga mobilis SJ95]
 gi|160360095|gb|ABX31709.1| ABC-3 protein [Petrotoga mobilis SJ95]
          Length = 272

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 77/258 (29%), Positives = 148/258 (57%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   AL   I     +  L  FI+ +++ + G+  AH A   +A +L F L + +   
Sbjct: 7   YPFMRYALIGAILSGFGSALLSNFIVLKKMEFIGNGAAHVAFGAIAFALFFGLNMNLLSI 66

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           ++A + ++ + Q+ K E +  ++++G++   ++++ +++LSF K    ++ SFLFGD+L 
Sbjct: 67  IVAIIFAITIHQLGKKERVQENSVIGMLLSLSMAIGIILLSFKKGYVPEIDSFLFGDVLM 126

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   D++L+     L + ++  + K L   + N  L+K  G+    I L+F+ ITS+ I 
Sbjct: 127 ITQEDLILLGIFDLLILFMVIFLNKELKYYSFNQRLSKIFGVPANIINLVFLTITSVTIV 186

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
           VS+K IGI LIT+LLI P V A+ ++ S   M I++ I+G+   ++G++ S   + PSGP
Sbjct: 187 VSVKIIGIILITALLITPGVIAKLYAKSINQMLIISVIVGVFSSVLGIFLSYYLNVPSGP 246

Query: 243 SIIITSLFLFILSFFYKK 260
            I++T   +F++++  +K
Sbjct: 247 MIVLTMFLIFLIAYLLRK 264


>gi|283835530|ref|ZP_06355271.1| iron chelate ABC transporter, permease protein AfeC [Citrobacter
           youngae ATCC 29220]
 gi|291068738|gb|EFE06847.1| iron chelate ABC transporter, permease protein AfeC [Citrobacter
           youngae ATCC 29220]
          Length = 285

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 128/256 (50%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
            ++ + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP  +  F
Sbjct: 10  YQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFALGAF 69

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
           +   L +  +L + +   L  DAI+G+I  S   + L ++S     + ++ + + G++LA
Sbjct: 70  LSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGIGLFMVSLNPM-SVNIQTIILGNVLA 128

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           +   DI+ +  IG +++ IL   WK L+    +   A++  + P ++KL+F  + S+   
Sbjct: 129 IAPEDIVQLAIIGVISLTILLLKWKDLMVVFFDENHARSIALNPGRLKLLFFTLLSVSTV 188

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +G  L+  L++ P  TA   +     +  +A  IG L    G + S   D  +G 
Sbjct: 189 AALQTVGAFLVICLVVTPGATAWLLTDRFPRLLTIAVAIGSLTSFFGAWLSYWLDGATGG 248

Query: 243 SIIITSLFLFILSFFY 258
            I++    LF+L+F +
Sbjct: 249 IIVVLQTLLFLLAFVF 264


>gi|114705758|ref|ZP_01438661.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitD [Fulvimarina
           pelagi HTCC2506]
 gi|114538604|gb|EAU41725.1| ABC Mn+2/Fe+2 transporter, inner membrane subunit SitD [Fulvimarina
           pelagi HTCC2506]
          Length = 284

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 113/256 (44%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
            F   A      + + T  L CF++ +  A  GD I+H+ L GV L+ I  LPL +  F 
Sbjct: 12  PFMQNAFLIAAIVAVPTALLSCFLVLKGWALMGDAISHAILPGVVLAWITGLPLILGAFG 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+   +  N  +  D ++GV+      + +++ + +   N  L   LFG++L V
Sbjct: 72  AGMTCALLTGYLSANSRVKQDTVMGVVFSGMFGVGIILYTSI-HTNEHLDHVLFGNMLGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+     I      +L   WK  L    +   AKA G+    +    + + SL I  
Sbjct: 131 GGEDLWTAGLISLAVSGVLALKWKDFLLHAFDPAQAKASGLPVYWLHYGLLTLLSLTIVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++   G+ L   L+I P   A     S   M  +A  I ++ +I+G+Y S   D+   P+
Sbjct: 191 TLSATGLILAVGLIIAPGAIAFLLVRSFGKMLFVAVTICLVSMIVGVYLSFFLDSAPAPT 250

Query: 244 IIITSLFLFILSFFYK 259
           I++    +FI +F  +
Sbjct: 251 IVLVLTLVFIFAFALR 266


>gi|46202381|ref|ZP_00208499.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Magnetospirillum magnetotacticum MS-1]
          Length = 266

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 169/259 (65%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
            ++F IRAL +G  + L  GPLGCFI+W+R+AYFGD +AHSALLG+   L+  +   + +
Sbjct: 7   MDDFLIRALMAGAAVALVAGPLGCFIVWRRMAYFGDALAHSALLGIVAGLLLGVAPLVGV 66

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
             +  + +L+L + + + A   D++LG++ H +++L LV+LS M  V  DL  +LFGDIL
Sbjct: 67  AALCVIAALILARAEVDRATGGDSLLGILAHGSLALGLVLLSLMDRVRVDLMGWLFGDIL 126

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
           AV  +D+  +WG     + +L   W+ L+A  V+ +LA  EG +  +++++ +++ +L +
Sbjct: 127 AVGASDLAWLWGGACFVLAMLVWQWRSLVAAAVDEDLAVVEGHKVARVRMLLMLLVALGV 186

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
           + ++K +GI L+T++LI+P    RR S +PE MA LA + G++ + +GL GS I+DTPSG
Sbjct: 187 AGAMKVVGIMLVTAMLIIPAAAVRRLSRTPEQMAGLAALAGLIAVALGLAGSWIWDTPSG 246

Query: 242 PSIIITSLFLFILSFFYKK 260
           PSI+  +  LF+LS    +
Sbjct: 247 PSIVTVATALFLLSRTLSR 265


>gi|332708674|ref|ZP_08428646.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
 gi|332352528|gb|EGJ32096.1| ABC-type Mn2+/Zn2+ transport system, permease component [Lyngbya
           majuscula 3L]
          Length = 297

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 129/244 (52%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   A+ + + + +    +G ++I Q+++     IAHS L G++++    + ++I   +
Sbjct: 11  EFMRNAIATAVLLGILGAVVGSYLIVQQMSLISSVIAHSVLPGLSIAFFLGINISIGALI 70

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  +++LV+  I K   +  DA + +   S + L +++++ +K    DL   LFGDIL V
Sbjct: 71  VGIISALVVAVIPKRTRVKVDAAMALTLSSFLGLGVILITVLKTNQLDLEDILFGDILGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D+     I  + +++    +K LL  T +   A+A G+  + I    I+  +L I  
Sbjct: 131 RPADVWQTLVITGVILVLTKLFYKELLFYTFDPLGAQASGLPVKLIYFGLILAITLTIVA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ SLLI P  TA        +M  L ++IGI+  + G+Y S  F+ PSGP+
Sbjct: 191 SMQTVGVLLVISLLIGPATTAYLLVKELHHMMGLGSMIGIISSVSGMYISYYFNWPSGPA 250

Query: 244 IIIT 247
           I++ 
Sbjct: 251 IVMV 254


>gi|296101802|ref|YP_003611948.1| high-affinity zinc transporter membrane component [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295056261|gb|ADF60999.1| high-affinity zinc transporter membrane component [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 170/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +GI +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     + +
Sbjct: 3   ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + IL   W+ LLA TV+ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLIAIAIGVVVVLGILLWQWRNLLAMTVSPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A IIG++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVIIGMIAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFI S   K
Sbjct: 243 VVLCAAVLFIFSMMKK 258


>gi|294647186|ref|ZP_06724785.1| ABC 3 transport family protein [Bacteroides ovatus SD CC 2a]
 gi|294809202|ref|ZP_06767918.1| ABC 3 transport family protein [Bacteroides xylanisolvens SD CC 1b]
 gi|292637473|gb|EFF55892.1| ABC 3 transport family protein [Bacteroides ovatus SD CC 2a]
 gi|294443596|gb|EFG12347.1| ABC 3 transport family protein [Bacteroides xylanisolvens SD CC 1b]
          Length = 269

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/259 (22%), Positives = 129/259 (49%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +   FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   + 
Sbjct: 4   LQYTFFQHALLGSLLASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLFAGISPILS 63

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
             + + L++  +  + + + +  D+ + V     ++L ++          DL+++LFG+I
Sbjct: 64  AAVFSVLSAFGVEWLSRRKDMREDSAIAVFWTLGMALGIMFSFLSPGFAPDLSAYLFGNI 123

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           L +N  D+ ++  +  +     +   +P++    + E A+++ +  E  + + +M  +L 
Sbjct: 124 LTINQIDLWMLGILALILTGFFYLFIRPIVYIAFDREFARSQKIPVEIFEYVLMMFIALT 183

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           I   ++ +GI L  SLL +P +TA  F+ S + +  ++  IG LG + GL+ S  +  PS
Sbjct: 184 IVACLRMVGIVLAISLLTIPQMTANLFTYSFKKIIWVSIGIGFLGCLGGLFISYHWKVPS 243

Query: 241 GPSIIITSLFLFILSFFYK 259
           G SII  S+ ++ +    K
Sbjct: 244 GASIIFFSILIYAVCKIGK 262


>gi|254931982|ref|ZP_05265341.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes HPB2262]
 gi|293583533|gb|EFF95565.1| manganese transport system membrane protein mntC [Listeria
           monocytogenes HPB2262]
 gi|332312289|gb|EGJ25384.1| Manganese transport system membrane protein mntC [Listeria
           monocytogenes str. Scott A]
          Length = 280

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 8   MQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 67

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 68  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 126

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 127 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 186

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 187 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 246

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 247 GAAMVLVATIIFFIAFLF 264


>gi|150004444|ref|YP_001299188.1| zinc ABC transporter permease [Bacteroides vulgatus ATCC 8482]
 gi|254882832|ref|ZP_05255542.1| zinc ABC transporter permease [Bacteroides sp. 4_3_47FAA]
 gi|294775518|ref|ZP_06741030.1| ABC 3 transport family protein [Bacteroides vulgatus PC510]
 gi|319643407|ref|ZP_07998033.1| zinc ABC transporter permease [Bacteroides sp. 3_1_40A]
 gi|149932868|gb|ABR39566.1| zinc ABC transporter permease [Bacteroides vulgatus ATCC 8482]
 gi|254835625|gb|EET15934.1| zinc ABC transporter permease [Bacteroides sp. 4_3_47FAA]
 gi|294450663|gb|EFG19151.1| ABC 3 transport family protein [Bacteroides vulgatus PC510]
 gi|317385036|gb|EFV65989.1| zinc ABC transporter permease [Bacteroides sp. 3_1_40A]
          Length = 283

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 63/251 (25%), Positives = 122/251 (48%)

Query: 5   FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64
           FF  AL   +   ++ G +G +I+ +R+ +    I H++  G+ L L   +   +   + 
Sbjct: 11  FFQHALLGSLFASIACGIIGTYIVTRRLVFISGGITHASFGGIGLGLYAGISPLLSAAIF 70

Query: 65  ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124
           + L+S  +  + K + +  D+ + V     +++ ++          DL++FLFG+IL + 
Sbjct: 71  SVLSSFGVEWLSKRKDMREDSAIAVFWTFGMAVGIIFSFLAPGFTPDLSAFLFGNILTIT 130

Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184
            TDILL+  +  L  +       P++    + E A+++ +     + I +M  +L I   
Sbjct: 131 PTDILLLAILSVLLTLFFTLFLNPIICIAFDREFARSQRIPVALFEYILMMFIALTIVSC 190

Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244
           ++ +GI L  SLL LP +TA  F+ S + +   + I G  G + GL+ S     PSG +I
Sbjct: 191 LRMVGIVLAISLLTLPQMTANLFTHSFKKIIWWSVITGYAGCLGGLFISYKLQVPSGAAI 250

Query: 245 IITSLFLFILS 255
           I  S+ ++   
Sbjct: 251 IFFSILIYTFC 261


>gi|116618060|ref|YP_818431.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116096907|gb|ABJ62058.1| ABC-type Mn2+/Zn2+ transport systems, permease component
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 280

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 142/256 (55%), Gaps = 1/256 (0%)

Query: 3   NEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIF 62
             F   AL + I + + +G +G FII + ++  GD I+H+ L GVA++ +  + L +   
Sbjct: 14  YNFLQTALVTSILVGIMSGIIGSFIILRGMSLMGDAISHAVLPGVAVAYMLGINLLLGAS 73

Query: 63  MIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILA 122
               L +L++  +     L +D  +G++  +  +L  +++S +    T+L   LFG++LA
Sbjct: 74  AFGILAALLIGVVTMKSKLKNDTAIGIVFSAFFALGFILIS-LAESATNLHHILFGNVLA 132

Query: 123 VNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMIS 182
           V+ +D++    +  + ++ +   +K LL T+ +   AKA G++ + +    +++ +L+  
Sbjct: 133 VSDSDLITTAIVLSIVLLFVVTFYKELLITSFDNTFAKAYGLKTQIMHYALMLVLTLVTV 192

Query: 183 VSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGP 242
            +++ +GI LI ++LI P  TA   +    +M I+A I  ++  I+GLY S  F+  SGP
Sbjct: 193 TALQTVGIILIVAMLITPAATAYLLTNRMSHMMIVAAIFSVISSIVGLYLSFTFNWASGP 252

Query: 243 SIIITSLFLFILSFFY 258
           +I++T+   F L+F +
Sbjct: 253 AIVLTAAIFFTLAFIF 268


>gi|148827608|ref|YP_001292361.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittGG]
 gi|229846494|ref|ZP_04466602.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 7P49H1]
 gi|319775665|ref|YP_004138153.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae F3047]
 gi|148718850|gb|ABQ99977.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae PittGG]
 gi|229810587|gb|EEP46305.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae 7P49H1]
 gi|317450256|emb|CBY86472.1| high-affinity zinc uptake system membrane protein ZnuB [Haemophilus
           influenzae F3047]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 110/256 (42%), Positives = 174/256 (67%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E    A  +GI + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   EILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLGVALGIFLQVNPYIAIVV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + ++ ++ ++ N   S D +LG+I HS +SL +V +  ++ V  DL ++LFGD+LA+
Sbjct: 63  LTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLLRNVRVDLMNYLFGDLLAI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N TD++ I     + +  L   W+ LL+TTV+ ELA+ EG+  +K++ I +++T+L I++
Sbjct: 123 NYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGINIKKMRFILMILTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P  TARRF+ +PE+M   A ++ +L II GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSMLSIIAGLILSAFYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           ++I S FLF+LS F K
Sbjct: 243 VVICSAFLFVLSLFKK 258


>gi|260598334|ref|YP_003210905.1| high-affinity zinc transporter membrane component [Cronobacter
           turicensis z3032]
 gi|260217511|emb|CBA31687.1| High-affinity zinc uptake system membrane protein znuB [Cronobacter
           turicensis z3032]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 96/256 (37%), Positives = 171/256 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+F +     + +
Sbjct: 3   ELLLPGWMAGMLLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLFDVNPFYAVIV 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  + +  L+ ++K   L+ D +LG++ HS +SL LV++S M  +  DL ++LFGD+LAV
Sbjct: 63  VTLMLAGGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMGNIRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ +     + + +L   W+ LL+ T++ +LA  +G+  +++K++ +M+T+L I V
Sbjct: 123 TPADLISVGLGVAVVLGVLCWQWRNLLSMTISPDLAFVDGVPLQRVKILLMMVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A ++G++ +  GL  S  +DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGIAVVLGMVAVTGGLTFSAFYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYK 259
           +++ +  LFILS   +
Sbjct: 243 VVLCAALLFILSMTKR 258


>gi|322515099|ref|ZP_08068106.1| iron ABC superfamily ATP binding cassette transporter, permease
           protein [Actinobacillus ureae ATCC 25976]
 gi|322118905|gb|EFX91087.1| iron ABC superfamily ATP binding cassette transporter, permease
           protein [Actinobacillus ureae ATCC 25976]
          Length = 284

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 62/257 (24%), Positives = 131/257 (50%), Gaps = 1/257 (0%)

Query: 2   YNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICI 61
              +  +A+F  +G+ +    L  F++ +  +  GD ++H+ + GVA++   +LP     
Sbjct: 10  QYNYMQKAIFVSMGVGVVCAFLSAFLMLKGWSLIGDALSHAVVPGVAIAYALKLPYAFGA 69

Query: 62  FMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDIL 121
           F    L +L +L ++    +  D+++G I  +  +L + I+S +   + D+ + + G+IL
Sbjct: 70  FFSGILAALSILWVKSITRIKEDSVIGFIFTTFFALGMFIVS-LNPTSVDVDAIVMGNIL 128

Query: 122 AVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMI 181
            +   D+  +  I  L+++ L   WK LL T  +   A + G+ P + K++F  + S  +
Sbjct: 129 GIADEDLWQVAIIIGLSLLGLIFFWKDLLLTFFDEHHALSVGLSPLRYKILFFTLLSACV 188

Query: 182 SVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSG 241
            V+++ +G  L+ ++++ P  TA   +     +  +A +IG L   IG Y S   +  +G
Sbjct: 189 VVALQTVGAILVIAMVVTPGATAYLLTDRFPRLVTIAILIGSLSSGIGAYLSYFLNGATG 248

Query: 242 PSIIITSLFLFILSFFY 258
             I+    F+F+L+F +
Sbjct: 249 GVIVCLQTFIFLLAFCF 265


>gi|301019436|ref|ZP_07183610.1| ABC 3 transport family protein [Escherichia coli MS 196-1]
 gi|299882226|gb|EFI90437.1| ABC 3 transport family protein [Escherichia coli MS 196-1]
 gi|332095019|gb|EGJ00055.1| chelated iron transport system membrane protein yfeC [Shigella
           boydii 3594-74]
          Length = 273

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 134/253 (52%), Gaps = 1/253 (0%)

Query: 6   FIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIA 65
            + A++    +      L C+++ +  +  GD ++HS + GVA + +  LP ++  F   
Sbjct: 1   MLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYMLGLPFSLGAFFSG 60

Query: 66  TLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNT 125
            L +  +L + +   L  DAI+G+I  S   L L ++S +   + ++ + + G+ILA++ 
Sbjct: 61  GLAAGSMLFLNQRTRLKEDAIIGLIFSSFFGLGLFMVS-LNPTSVNIQTIVLGNILAIDP 119

Query: 126 TDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSI 185
            DIL +  IG L+I++LF  WK L+ T  +   A+A G+ P ++K++F  + S+    ++
Sbjct: 120 ADILQLTIIGILSIIVLFFKWKDLMVTFFDENHARAIGLHPGRLKILFFTLLSVSTVAAL 179

Query: 186 KFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSII 245
           + +G  L+  L++ P  TA   +     + I+A  IG +   +G + S   D  +G  I+
Sbjct: 180 QTVGAFLVICLVVTPGATAWLLTDRFPRLLIIAVTIGSVTSFLGAWVSYFLDGATGGIIV 239

Query: 246 ITSLFLFILSFFY 258
           +    LF+L+F +
Sbjct: 240 VAQTLLFLLAFVF 252


>gi|227823620|ref|YP_002827593.1| putative iron transmembrane ABC transporter component
           [Sinorhizobium fredii NGR234]
 gi|227342622|gb|ACP26840.1| putative iron transmembrane ABC transporter component
           [Sinorhizobium fredii NGR234]
          Length = 283

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 122/256 (47%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL   + + + T  L CF++ +  +  GD I+H+   GV +S I  LPL +  F 
Sbjct: 14  EFMRNALLISVLVAIPTAMLSCFLVLKGWSLMGDAISHAVFPGVVISYIVGLPLALGAFT 73

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
                +L+   +++N  +  D ++GV+      L LV+ + ++  +  L   LFGD+L +
Sbjct: 74  AGMCCALLTGYLKENSRIKQDTVMGVVFSGMFGLGLVLYTKIQ-SDVHLDHILFGDMLGI 132

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              DIL    I      IL   W+ LL    +   A+A G+    +    + I SL I  
Sbjct: 133 GWGDILETGLIALFAAGILSFKWRDLLLHAFDPAQARAVGLPVGWLHYGLLAILSLTIVG 192

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++K +G+ L  ++LI P   A   + +   M I+A  + +     G+Y S   D+   P+
Sbjct: 193 ALKAVGLILAIAMLIAPGAIAFLVTRTFRGMLIVAVAVAVAASFSGVYLSFFIDSAPAPT 252

Query: 244 IIITSLFLFILSFFYK 259
           I++    +F+++F + 
Sbjct: 253 IVLLMTAIFLVAFAWS 268


>gi|172036401|ref|YP_001802902.1| Mn(2+)/Zn(2+) family ABC transporter permease [Cyanothece sp. ATCC
           51142]
 gi|171697855|gb|ACB50836.1| Mn2+/Zn2+ family ABC transporter, permease protein [Cyanothece sp.
           ATCC 51142]
          Length = 293

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 78/256 (30%), Positives = 131/256 (51%), Gaps = 1/256 (0%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           EF   AL   I + +     G ++I Q++   GD IAH+ L G+A++    + + +  F+
Sbjct: 12  EFMRNALIIIILLGILCAITGSYLIVQKMGLLGDVIAHAVLPGLAIAFYLGIDIFLGAFI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L++LV+  IQ    +  D  + ++    ++L +++++ +K    DL SFLFGDIL V
Sbjct: 72  SGLLSTLVISWIQSQSKIKVDVAMALVFSGFLALGIMLITLLK-SKIDLHSFLFGDILGV 130

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D      I    ++ +   +K LL  T N   A+A G+  + I L  I   +L I  
Sbjct: 131 TKNDFFRTLIIVVFIVIFVKLFYKELLFYTFNPLGAQAMGLPVKWIHLGLISAITLTIIA 190

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S++ +G+ L+ SLL+ P++TA         M I+  IIG L  IIG+Y S   + PSG +
Sbjct: 191 SMQAVGVVLVVSLLVGPSITAYLLVKELHQMMIIGGIIGSLSGIIGIYLSYYLNVPSGAA 250

Query: 244 IIITSLFLFILSFFYK 259
           I++    LF+L+    
Sbjct: 251 IVLVVTGLFLLALLVS 266


>gi|224583602|ref|YP_002637400.1| high-affinity zinc transporter membrane component [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|224468129|gb|ACN45959.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322714946|gb|EFZ06517.1| high-affinity zinc uptake system membrane protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 171/257 (66%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           E  +    +G+ +  + GPLG F++W+R++YFGDT+AH++LLGVA  L+  +     +  
Sbjct: 3   ELLLPGWLAGMMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L +  L+ ++K   L+ D +LG++ HS +SL LV++S M  V  DL ++LFGD+LAV
Sbjct: 63  VTLLLAAGLVWLEKRPHLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
              D++ I     + + ILF  W+ LL+ T++ +LA  +G++ +++KL+ +++T+L I V
Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           ++KF+G  +ITSLLI+P  TARRF+ +PE MA +A  +G++ +  GL  S ++DTP+GPS
Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVGVGMIAVTGGLTFSALYDTPAGPS 242

Query: 244 IIITSLFLFILSFFYKK 260
           +++ +  LFI S   K+
Sbjct: 243 VVLCAALLFIFSMMKKQ 259


>gi|255025444|ref|ZP_05297430.1| metal cations ABC transporter (permease protein) [Listeria
           monocytogenes FSL J2-003]
          Length = 279

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           M   F  +AL + + + + +G +G FII + ++  GD I+H+ L GVA+S +  +   I 
Sbjct: 7   MQXSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDAISHAVLPGVAISYMMGMNFFIG 66

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
                   +L +  + +   + +D  +G++  +  +L ++++SF K  +TDL   LFG++
Sbjct: 67  AATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFALGIILISFAK-SSTDLYHILFGNV 125

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LAV ++D+ +   I  + I ++   +K  L ++ +  +A+A G+  + +    +++ +L+
Sbjct: 126 LAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPVMAEAYGLNVKFLHYFLMLLLTLV 185

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
              +++ +GI L+ ++LI P  TA   +     M +LA+  G +  IIGLY S IF+  S
Sbjct: 186 TVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIVLASTFGAVSAIIGLYFSYIFNLAS 245

Query: 241 GPSIIITSLFLFILSFFY 258
           G ++++ +  +F ++F +
Sbjct: 246 GAAMVLVATIIFFIAFLF 263


>gi|251792104|ref|YP_003006824.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533491|gb|ACS96737.1| high-affinity zinc uptake system membrane protein ZnuB
           [Aggregatibacter aphrophilus NJ8700]
          Length = 261

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 175/256 (68%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +    A  +G+ + L T PLG F++W+++AYFGDT++HSALLGVAL +  Q+   I I +
Sbjct: 3   DILFPAWLTGMILSLITAPLGAFVVWRKMAYFGDTLSHSALLGVALGIFLQINPYIAILI 62

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
           +  L S+ ++ ++ N   S D +LG+I HS +S+ +V +  ++ V  DL S+LFGD+L++
Sbjct: 63  LTLLLSVAMVWLENNTQFSVDTLLGIIAHSCLSIGVVTVGLLQNVRVDLMSYLFGDLLSI 122

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           N  D++ I     + +  LF  WKPL++TT++ ELA+ EG+  ++++ I +++T+L I++
Sbjct: 123 NYEDLIYIGIGAVIVLATLFYFWKPLISTTISPELAQVEGINVKRMRFILMVLTALTIAL 182

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           S+KF+G  +ITSLLI+P   A+RF+ +PE+M I+A+II ++ + +GL  S  +DT +GPS
Sbjct: 183 SMKFVGALIITSLLIIPAAAAKRFARTPESMVIIASIISMIAVSMGLTLSAYYDTAAGPS 242

Query: 244 IIITSLFLFILSFFYK 259