RPSBLAST alignment for GI: 254780719 and conserved domain: COG1108

>gnl|CDD|31305 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism]. Length = 274
 Score =  155 bits (393), Expect = 1e-38
 Identities = 88/257 (34%), Positives = 154/257 (59%)

Query: 4   EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63
           +F   AL + + I ++ G LG F++ +R++  GD ++H+ L GVAL  +  +   +  F+
Sbjct: 12  DFMQNALLASLLIGIACGLLGTFLVLRRMSLMGDALSHAVLPGVALGFLLGINPLLGAFI 71

Query: 64  IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123
              L +L++  +++   L  D  +G++  S ++L LV+LS +     DL  +LFGDILAV
Sbjct: 72  FGLLAALLIGYLRRRSKLKEDTAIGIVFSSGLALGLVLLSLVPSSRVDLMHYLFGDILAV 131

Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183
           + +D+LLI  IG L +++L   ++ LL  T + E A+  G+    +  + +++ +L I  
Sbjct: 132 SRSDLLLIAIIGALVLLLLLLFYRELLLLTFDPEFARVLGLNVRLLHYLLLVLLALTIVA 191

Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243
           +IK +G  L+++LLI+P  TAR  + S   M I+A +IG+L  ++GLY S   D PSGP+
Sbjct: 192 AIKAVGALLVSALLIIPAATARLLTKSFRQMLIIAVLIGLLSSVLGLYLSYYLDLPSGPA 251

Query: 244 IIITSLFLFILSFFYKK 260
           I++ +  LF+LSF +  
Sbjct: 252 IVLIAALLFLLSFLFGP 268