RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780719|ref|YP_003065132.1| zinc uptake ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] (260 letters) >gnl|CDD|181938 PRK09543, znuB, high-affinity zinc transporter membrane component; Reviewed. Length = 261 Score = 202 bits (517), Expect = 5e-53 Identities = 103/256 (40%), Positives = 171/256 (66%) Query: 4 EFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFM 63 E + +GI + + GPLG F++W+R++YFGDT+AH++LLGVA L+ + + Sbjct: 3 ELLLPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIA 62 Query: 64 IATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAV 123 + L + L+ ++K L+ D +LG++ HS +SL LV++S M V DL ++LFGD+LAV Sbjct: 63 VTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLAV 122 Query: 124 NTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISV 183 D++ I + + ILF W+ LL+ T++ +LA +G++ +++KL+ +++T+L I V Sbjct: 123 TPEDLISIAIGVVIVLAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGV 182 Query: 184 SIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPS 243 ++KF+G +ITSLLI+P TARRF+ +PE MA +A ++G+L + GL S +DTP+GPS Sbjct: 183 AMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMLAVTGGLTFSAFYDTPAGPS 242 Query: 244 IIITSLFLFILSFFYK 259 +++ + LFILS K Sbjct: 243 VVLCAALLFILSMMKK 258 >gnl|CDD|163482 TIGR03770, anch_rpt_perm, anchored repeat-type ABC transporter, permease subunit. This protein family is the permease subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in the adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous permease subunits outside the scope of this family include manganese transporter MntB in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. Length = 270 Score = 107 bits (269), Expect = 3e-24 Identities = 69/253 (27%), Positives = 136/253 (53%) Query: 5 FFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMI 64 F +AL + + G +G ++ + +A+ GD +AH+ G+A++ Q L + + Sbjct: 16 FLPKALLVAVLSSIVCGVVGTHVVLRGMAFIGDAVAHAVFPGLAVAFALQGSLLLGGAVA 75 Query: 65 ATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVN 124 T++++ +N L D+I+G+ + +L LVI+S + L FLFG I + Sbjct: 76 GVATAILIAVFSQNRRLKEDSIIGIFFVAAFALGLVIISRVPGYTGSLQQFLFGSITGIP 135 Query: 125 TTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS 184 +DI++ +G + ++ + + K L+A +++ E A+A G+ + L+ ++ + + +S Sbjct: 136 DSDIVVAAVVGAVVLLAVAALHKELVAVSLDRETARAMGLPVFLLDLVLYVLVTAAVVIS 195 Query: 185 IKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSI 244 ++ IG L+ +LLI P TAR + M L+ +IG +G +GLY S D P+G +I Sbjct: 196 VQTIGNILVLALLITPAATARLLTDRLGVMMALSPVIGGVGSFLGLYLSWSIDVPTGGTI 255 Query: 245 IITSLFLFILSFF 257 ++ +F+ S+F Sbjct: 256 VLVLTAVFLASWF 268 >gnl|CDD|178754 PLN03215, PLN03215, ascorbic acid mannose pathway regulator 1; Provisional. Length = 373 Score = 26.8 bits (59), Expect = 5.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 89 VITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTD 127 +I H + AL + + W+N+DL FG L N TD Sbjct: 205 IIVHKGQTYALDSIGIVYWINSDLEFSRFGTSLDENITD 243 >gnl|CDD|178734 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional. Length = 823 Score = 26.8 bits (59), Expect = 5.9 Identities = 13/36 (36%), Positives = 23/36 (63%) Query: 96 SLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLI 131 SL + +S + W T +T+ +GD+ AVNT +++ I Sbjct: 246 SLWIRYISAIYWSITTMTTVGYGDLHAVNTIEMIFI 281 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.331 0.145 0.424 Gapped Lambda K H 0.267 0.0653 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,205,765 Number of extensions: 276701 Number of successful extensions: 1219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1185 Number of HSP's successfully gapped: 147 Length of query: 260 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 169 Effective length of database: 4,028,145 Effective search space: 680756505 Effective search space used: 680756505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 56 (25.5 bits)