>TIGR00754 bfr bacterioferritin; InterPro: IPR002024 Bacterioferritin (BFR; also known as cytochrome b1 or cytochrome b557) , of Escherichia coli is an iron-storage protein consisting of 24 identical subunits that pack together to form a highly symmetrical, nearly spherical shell surrounding a central cavity of about 8 nm diameter , . X-ray crystallographic studies have revealed a close structural similarity between BFR and the ferritins, a family of iron-storage proteins found in both eukaryotes and bacteria . Common to both ferritins and BFRs is a capacity to store large quantities of iron within their hollow interior, in the form of a hydrated ferric oxide mineral containing variable amounts of phosphate anion. However, a major difference between them is that BFR contains up 12 b-type haem groups, while ferritins, as isolated, do not contain haem. The building block for the BFR shell is a protein dimer (subunits A and B) binding the single haem group. Each subunit consists of four nearly parallel alpha-helices. The haem is bound symmetrically to subunits A and B by Met(A)-52 and Met(B)-52 residues . Each subunit includes a binuclear metal-binding site linking together the four major helices of the subunit, which has been identified as the ferroxidase centre of BFR . BFR mutants with Met-52 replaced are haem-free, but appear to be correctly assembled and are capable of accumulating iron .; GO: 0008199 ferric iron binding, 0006826 iron ion transport, 0006879 cellular iron ion homeostasis.

Probab=99.59 E-value=5.9e-14 Score=104.53 Aligned_cols=147 Identities=16% Similarity=0.164 Sum_probs=131.7 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCC Q ss_conf 98999999999999999999999999998159947899999999999999999999999953997143782257204889 Q gi|254780720|r 2 TNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISAND 81 (164) Q Consensus 2 s~~~~~~Ln~qi~~El~as~~Yl~~a~~~~~~~~~g~a~~f~~~a~EE~~HA~~l~~yi~~rgg~~~~~~i~~p~~~~~~ 81 (164) T Consensus 4 ~~~~~~~ln~~l~~~l~~~n~yflh~~~~~~Wg~~~l~~~~~~~~~~~~~~~~~~~~~~l~l~g~pn~~~~g~l~~-g~~ 82 (157) T TIGR00754 4 DPDVLQHLNKLLGNELTAINQYFLHARMCKNWGLKELADHEYHESIDEMKHADELIERILFLEGLPNLQDLGKLLI-GET 82 (157) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCH T ss_conf 3789999999887677788788887665410251456666777668887667889988987615754344545430-311 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH Q ss_conf 89999999999999999999999999970998899999999999999999999999999952887516999 Q gi|254780720|r 82 VEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYM 152 (164) Q Consensus 82 ~~e~~~~al~~E~~vt~~~~~l~~~A~~~~D~~t~~fl~~fl~EQ~eee~~~~~ll~~l~~~g~~~~glyl 152 (164) T Consensus 83 ~~e~~~~dl~~~~~~~~~l~~~~~~~~~~~d~~~~~~~~~~~~~---~e~~~dwle~~~~l~~~~g~~~y~ 150 (157) T TIGR00754 83 VPELLEADLALELDVLDGLKEGIAYAEEVRDYVSRDLLEEILED---EEEHIDWLETQLWLIDKLGLENYL 150 (157) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 58875212344343210245667765444456779999999732---223456778889998752167788

HHsearch alignment for GI: 254780720 and conserved domain: TIGR00754