HHsearch alignment for GI: 254780721 and conserved domain: COG1459

>COG1459 PulF Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=99.07  E-value=6e-08  Score=70.67  Aligned_cols=112  Identities=18%  Similarity=0.121  Sum_probs=88.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             99999999999999749968999999998407787789999999999996599989999999986399589999999999
Q gi|254780721|r  181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ  260 (329)
Q Consensus       181 ~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~~~~l~~  260 (329)
T Consensus       261 ~~~arf~rtl~~Ll~sGvpl~~aL~i~~~~~--~~~~~~~~~~~~~~~v~~G~sl~~al~~------~~~Fp~~~~~mi~  332 (397)
T COG1459         261 YALARFARTLGTLLSSGVPLLEALDIAAETV--SNAFLRQALEEIIQEVREGGSLSQALEK------TGLFPPLLLQMIA  332 (397)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHCCHHHHHHHHH------CCCCHHHHHHHHH
T ss_conf             9999999999999978983999999987623--7499999999999999857569999873------6898199999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9971995899999999999999999999999843336999
Q gi|254780721|r  261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV  300 (329)
Q Consensus       261 ~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~~~k~~~  300 (329)
T Consensus       333 ~GEesG~L~~mL~~~A~~~~~~~~~~i~~l~~llEP~l~i  372 (397)
T COG1459         333 VGEESGKLDEMLEKVADFYEEEVERKIDKLTSLLEPLLII  372 (397)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8343166899999999999999999999999999899999