HHsearch alignment for GI: 254780721 and conserved domain: COG4965

>COG4965 TadB Flp pilus assembly protein TadB [Intracellular trafficking and secretion].
Probab=100.00  E-value=1.5e-30  Score=220.29  Aligned_cols=167  Identities=22%  Similarity=0.305  Sum_probs=155.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999999999999999999999999999999999997499689999999984077877899999999999965999
Q gi|254780721|r  155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN  234 (329)
Q Consensus       155 ~~~~~g~~~P~~~l~~~~~~r~~~i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~  234 (329)
T Consensus       110 ~~~~~~~llp~~~~~~~~~rr~krf~~qlP~aLdlivr~l~aG~~l~dAl~~~~~e~~~---Pl~~ef~~i~~~~~~G~~  186 (309)
T COG4965         110 VALIGAALLPRLVLRSRRARRLKRFGQQLPEALDLIVRALRAGAPLPDALRLAAKETPE---PLGTEFTLITDRQQLGID  186 (309)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC---CHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999999999999976699999998865799879999999860898---567899999999983998


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             8999999998639958999999999999719958999999999999999999999998433369999999999999999-
Q gi|254780721|r  235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV-  313 (329)
Q Consensus       235 ~~~Al~~~a~r~~~~~~~~~~~~l~~~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~~~k~~~~~il~~~p~~~~~-  313 (329)
T Consensus       187 ~~~a~~~~~er~p~~el~fl~ivi~iq~~~GGnL~e~l~~ls~vireRkk~~~Kv~AlsaEaRmSA-~Il~~lP~~v~~l  265 (309)
T COG4965         187 LPAALLRMYERYPLEELYFLAIVISIQSRHGGNLSELLDNLSRVIRERKKMKAKVRALSAEARMSA-WILGALPLLVGLL  265 (309)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_conf             469999999837823688999999988762878999999999999999999999998634111688-9999835999999


Q ss_pred             --HHHHHHHHHHHH
Q ss_conf             --997799999999
Q gi|254780721|r  314 --IIGPAILSIIDT  325 (329)
Q Consensus       314 --~~~P~~~~~~~~  325 (329)
T Consensus       266 i~~~~P~~l~~lw~  279 (309)
T COG4965         266 IYLLSPDYLSFLWT  279 (309)
T ss_pred             HHHCCCHHHHHHHC
T ss_conf             99819378999835