HHsearch alignment for GI: 254780721 and conserved domain: PRK10573

>PRK10573 type IV pilin biogenesis protein; Provisional.
Probab=99.20  E-value=4.7e-09  Score=78.00  Aligned_cols=110  Identities=21%  Similarity=0.183  Sum_probs=86.9

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHH-HHHHHHH
Q ss_conf             999999999999974996899999999840778778999999999999659998999999998639958999-9999999
Q gi|254780721|r  182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN-ATQALIQ  260 (329)
Q Consensus       182 ~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~-~~~~l~~  260 (329)
T Consensus       262 ~~~rf~~~L~~ll~sGv~l~~AL~~~~~~~--~n~~~~~~l~~~~~~v~~G~sls~al~~~~------~fp~~~~~mi~v  333 (397)
T PRK10573        262 KLSQIFTILALTQSAGIPFLQGLESAAESI--RCPYWQQALTQIQHQISQGHPIWLALKNHG------EFSPLCLQLVRT  333 (397)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHH--CCHHHHHHHHHHHHHHHCCCCHHHHHHHCC------CCCHHHHHHHHH
T ss_conf             999999999999868997999999999875--899999999999999876932899987379------998999999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9971995899999999999999999999999843336999
Q gi|254780721|r  261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV  300 (329)
Q Consensus       261 ~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~~~k~~~  300 (329)
T Consensus       334 GEes-G~L~~~L~~~a~~ye~~~~~~i~~l~~llEPili~  372 (397)
T PRK10573        334 GEES-GSLDLMLENLAHHHRQQTLALADNLAALLEPLLLI  372 (397)
T ss_pred             HHHH-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8652-64999999999999999999999999999899999