Query         gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 329
No_of_seqs    154 out of 1349
Neff          8.6 
Searched_HMMs 33803
Date          Wed Jun  1 14:25:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780721.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3c1q_A General secretion path  99.3 1.2E-10 3.7E-15   88.0  12.2  108  180-294    11-118 (123)
  2 >3c1q_A General secretion path  93.9    0.37 1.1E-05   25.3   8.4   79  217-295    13-93  (123)
  3 >1j2z_A Acyl-[acyl-carrier-pro  38.9      19 0.00055   14.1   4.0   34  230-263    16-50  (67)
  4 >2j69_A Bacterial dynamin-like  34.7      22 0.00064   13.7   3.6   25  167-191   232-256 (300)
  5 >1jr3_A DNA polymerase III sub  33.8      22 0.00066   13.6   2.9   88  179-273    14-107 (130)
  6 >1eu8_A Trehalose/maltose bind  32.0      24 0.00071   13.4   3.3   60  185-247    39-100 (107)
  7 >2ejw_A HDH, homoserine dehydr  28.1      25 0.00075   13.2   1.3   47  196-242     1-48  (164)
  8 >1jr3_D DNA polymerase III, de  27.1      28 0.00082   12.9   1.3   85  179-263    11-99  (132)
  9 >1zmd_A Dihydrolipoyl dehydrog  26.2      30 0.00089   12.7   4.6   49  182-235    75-123 (125)
 10 >2cr7_A Paired amphipathic hel  24.2      33 0.00096   12.5   5.6   46  180-226    28-73  (80)
 11 >2e9x_B DNA replication comple  22.7      35   0.001   12.3   3.2   45  250-294    38-82  (132)
 12 >2hl7_A Cytochrome C-type biog  22.6      35   0.001   12.3   4.5   39  211-249    37-76  (84)
 13 >2q5z_A MAZG, hypothetical pro  22.2      36  0.0011   12.2   3.9   34  177-210    73-107 (114)

No 1  
>>3c1q_A General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* (A:)
Probab=99.26  E-value=1.2e-10  Score=88.04  Aligned_cols=108  Identities=13%  Similarity=0.137  Sum_probs=95.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             99999999999999974996899999999840778778999999999999659998999999998639958999999999
Q gi|254780721|r  180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI  259 (329)
Q Consensus       180 ~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~~~~l~  259 (329)
                      ..++|++++.++.++++|+|+.+|+..++++  ..++++++++..+.++++.|.++.+||.+++.+++     .++..++
T Consensus        11 ~~~~~~f~~~l~~ll~~G~~l~~al~~~~~~--~~~~~l~~~~~~i~~~l~~G~~~~~Al~~~~~~~~-----~~~~~~i   83 (123)
T 3c1q_A           11 TPDLALITRQLATLVQSGXPLEECLRAVAEQ--SEKPRIRTXLVAVRAKVTEGYTLSDSLGDYPHVFD-----ELFRSXV   83 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHT--CSCHHHHHHHHHHHHHHHTTCCHHHHHTTCTTTSC-----HHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCC-----HHHHHHH
T ss_conf             9999999999999998699899999999714--41289999999999999845539999987545586-----9999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99971995899999999999999999999999843
Q gi|254780721|r  260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL  294 (329)
Q Consensus       260 ~~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~  294 (329)
                      .+.+.||+++++|+..++.++++...+.+.+....
T Consensus        84 ~~ge~~G~L~~~l~~~a~~~~~~~~~~~~~~~~l~  118 (123)
T 3c1q_A           84 AAGEKSGHLDSVLERLADYAENRQKXRSKLQQASE  118 (123)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHTTC-
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99987477999999999999999999999999999


No 2  
>>3c1q_A General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* (A:)
Probab=93.90  E-value=0.37  Score=25.32  Aligned_cols=79  Identities=13%  Similarity=0.017  Sum_probs=59.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH--HHHHHHHHHHHHHHH
Q ss_conf             899999999999965999899999999863995899999999999971995899999999999--999999999999843
Q gi|254780721|r  217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET--RSERLMEAEKKAASL  294 (329)
Q Consensus       217 ~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~~~~l~~~~~~G~~l~~~L~~~a~~~--r~~~~~~~e~~a~~~  294 (329)
                      .+..-+..+..=++.|.|..+|++.+++.++.|.++.-...+....+.|.+++++|..++..+  ........-++.+.+
T Consensus        13 ~~~~f~~~l~~ll~~G~~l~~al~~~~~~~~~~~l~~~~~~i~~~l~~G~~~~~Al~~~~~~~~~~~~~~i~~ge~~G~L   92 (123)
T 3c1q_A           13 DLALITRQLATLVQSGXPLEECLRAVAEQSEKPRIRTXLVAVRAKVTEGYTLSDSLGDYPHVFDELFRSXVAAGEKSGHL   92 (123)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHHHHTCSCHHHHHHHHHHHHHHHTTCCHHHHHTTCTTTSCHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHCCH
T ss_conf             99999999999998699899999999714412899999999999998455399999875455869999999999874779


Q ss_pred             H
Q ss_conf             3
Q gi|254780721|r  295 G  295 (329)
Q Consensus       295 ~  295 (329)
                      +
T Consensus        93 ~   93 (123)
T 3c1q_A           93 D   93 (123)
T ss_dssp             H
T ss_pred             H
T ss_conf             9


No 3  
>>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} (A:204-270)
Probab=38.87  E-value=19  Score=14.09  Aligned_cols=34  Identities=12%  Similarity=0.131  Sum_probs=21.2

Q ss_pred             HCCCCHHHHHHHHHHHCC-CHHHHHHHHHHHHHHH
Q ss_conf             659998999999998639-9589999999999997
Q gi|254780721|r  230 SFLPNRQVAFENFYNRTQ-MDCVRNATQALIQSDR  263 (329)
Q Consensus       230 ~~G~~~~~Al~~~a~r~~-~~~~~~~~~~l~~~~~  263 (329)
                      +.|.++++|+..+.+..+ +|+++.++.-+..+.|
T Consensus        16 r~gl~~~eal~~i~~~~~~~pev~~~~~Fi~~S~R   50 (67)
T 1j2z_A           16 RPIPSLRESAKLELEEHANNPFVKEICSFILESSR   50 (67)
T ss_dssp             CSSSCHHHHHHHHHHHTSSCHHHHHHHHHHHHCSS
T ss_pred             HCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCC
T ss_conf             56876999999998773799899999999971899


No 4  
>>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A (A:358-657)
Probab=34.72  E-value=22  Score=13.66  Aligned_cols=25  Identities=12%  Similarity=0.116  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999
Q gi|254780721|r  167 WISNLVQKRQSSIKRAWPDALDLLL  191 (329)
Q Consensus       167 ~l~~~~~~r~~~i~~~lP~~ld~l~  191 (329)
                      .-+..++.-++++-+++|....-..
T Consensus       232 ~rk~~~k~~~ke~~k~l~q~~~e~~  256 (300)
T 2j69_A          232 ARRELVKTAKKELVKHLPQVAHEQS  256 (300)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999


No 5  
>>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} (A:244-373)
Probab=33.82  E-value=22  Score=13.57  Aligned_cols=88  Identities=9%  Similarity=0.096  Sum_probs=55.1

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH-HH--HHCCCCHHHHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999999999974996899999999840778778999999999-99--965999899999999863995899999
Q gi|254780721|r  179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI-AE--LSFLPNRQVAFENFYNRTQMDCVRNAT  255 (329)
Q Consensus       179 i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~-~~--~~~G~~~~~Al~~~a~r~~~~~~~~~~  255 (329)
                      .+.+...+++.+......|.++..-+....+.       +++-+..-. .+  .....+..+.+++.+.+++.+.+....
T Consensus        14 ~~~d~~~~l~~~~~l~~~G~d~~~~l~~L~~~-------~R~ll~~k~~~~~~~~~~~~~~~~~~~~a~~~s~~~L~~~l   86 (130)
T 1jr3_A           14 VEANGERVMALINEAAARGIEWEALLVEMLGL-------LHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYY   86 (130)
T ss_dssp             HHTCHHHHHHHHHHHHHTTCCHHHHHHHHHHH-------HHHHHHHTTCTTCCCSGGGGTHHHHHHHHHHSCHHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHH-------HHHHHHHHHCHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             71899999999999998099999999999999-------99999998274633044310899999999679999999999


Q ss_pred             HHHHHHHH---CCCCHHHHHH
Q ss_conf             99999997---1995899999
Q gi|254780721|r  256 QALIQSDR---YGTSIGDSLR  273 (329)
Q Consensus       256 ~~l~~~~~---~G~~l~~~L~  273 (329)
                      ..+..+..   ++.+-.-.++
T Consensus        87 ~~l~~~~~~lk~s~~~~~~lE  107 (130)
T 1jr3_A           87 QTLLIGRKELPYAPDRRMGVE  107 (130)
T ss_dssp             HHHHHHHHHTTTSSSHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHH
T ss_conf             999999999630899589999


No 6  
>>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} (A:175-230,A:359-409)
Probab=32.01  E-value=24  Score=13.38  Aligned_cols=60  Identities=18%  Similarity=0.096  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHHCC-CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHCC
Q ss_conf             9999999999749-968999999998407787789999999999996599-98999999998639
Q gi|254780721|r  185 DALDLLLICVESG-ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP-NRQVAFENFYNRTQ  247 (329)
Q Consensus       185 ~~ld~l~~~~~aG-~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~-~~~~Al~~~a~r~~  247 (329)
                      ++++.+...+.-| .+.+.+.   .+..-..++.+++.+.....+.-.|. +.++||++..+++.
T Consensus        39 eal~~~~dl~~~~~vsP~~a~---~rP~~p~~~~is~~l~~~i~~al~G~~tpeeAl~~a~~~i~  100 (107)
T 1eu8_A           39 EALQFMVDLIHKYKISPPNAV---PRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAE  100 (107)
T ss_dssp             HHHHHHHHHHHTSCCSCGTCB---CCCCCTTHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCHCC---CCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             999999999981785885284---07888878999999999999998599999999999999999


No 7  
>>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus HB8} (A:126-289)
Probab=28.07  E-value=25  Score=13.19  Aligned_cols=47  Identities=13%  Similarity=0.017  Sum_probs=28.8

Q ss_pred             CCCCHHHHHHHHHH-HCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             49968999999998-407787789999999999996599989999999
Q gi|254780721|r  196 SGISIDQALRRVAE-DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF  242 (329)
Q Consensus       196 aG~~l~~Al~~va~-e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~  242 (329)
                      ||.|+-+.++..+. ++....+-+......+..+++.|.++++|+++-
T Consensus         1 AGiPii~~l~~l~g~~I~~i~GIlNGT~NyIL~~m~~g~~f~~al~eA   48 (164)
T 2ejw_A            1 AGTPALSFLETLRGSELLELHGILNGTTLYILQEMEKGRTYAEALLEA   48 (164)
T ss_dssp             TTSSSHHHHHHHTTSEEEEEEEECCHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHHCHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             886378888743322214455420558889987876599889999999


No 8  
>>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} (D:212-343)
Probab=27.14  E-value=28  Score=12.95  Aligned_cols=85  Identities=16%  Similarity=0.076  Sum_probs=52.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHH----HHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHH
Q ss_conf             999999999999999974996899999999840778778----9999999999996599989999999986399589999
Q gi|254780721|r  179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP----LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA  254 (329)
Q Consensus       179 i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~----l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~  254 (329)
                      +..+.+.++..+......|.++..-+....+++...+--    =..................+-+++.+++++.+++...
T Consensus        11 ~~~d~~~al~~l~~l~~~g~~~~~il~~L~~~~r~l~~~k~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~L~~~   90 (132)
T 1jr3_D           11 LMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQA   90 (132)
T ss_dssp             TTSCHHHHHHHHTSSTTTTCCHHHHHHHHHHHHHHHHHHHTCSSSSCHHHHHHHHTCCSSHHHHHHHHHHHSCHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             82687999999999987799579999999999999999998744899999998859999999999999971999999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999997
Q gi|254780721|r  255 TQALIQSDR  263 (329)
Q Consensus       255 ~~~l~~~~~  263 (329)
                      ...+...+.
T Consensus        91 l~~l~~~d~   99 (132)
T 1jr3_D           91 VQLLTRTEL   99 (132)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999999


No 9  
>>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* (A:350-474)
Probab=26.24  E-value=30  Score=12.73  Aligned_cols=49  Identities=16%  Similarity=0.092  Sum_probs=38.5

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             999999999999974996899999999840778778999999999999659998
Q gi|254780721|r  182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR  235 (329)
Q Consensus       182 ~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~  235 (329)
                      +-.+.++.++.+++.|+++++.-     ++...||.+++.+..+..+...|.+.
T Consensus        75 ~A~elI~~~~~ai~~~~t~~~l~-----~~v~~hPT~sE~l~~a~~~~~~~~~~  123 (125)
T 1zmd_A           75 GAGEMVNEAALALEYGASCEDIA-----RVCHAHPTLSEAFREANLAASFGKSI  123 (125)
T ss_dssp             THHHHHHHHHHHHHHTCBHHHHH-----HSCCCTTCTHHHHHHHHHHHHHSCCS
T ss_pred             CHHHHHHHHHHHHHCCCCHHHHH-----CCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999998819799995-----05787998699999999865308899


No 10 
>>2cr7_A Paired amphipathic helix protein SIN3B; paired amphipathic helix repeat, transcriptional repressor, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rmr_A 2rms_A (A:)
Probab=24.25  E-value=33  Score=12.49  Aligned_cols=46  Identities=13%  Similarity=0.140  Sum_probs=36.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99999999999999974996899999999840778778999999999
Q gi|254780721|r  180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI  226 (329)
Q Consensus       180 ~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~  226 (329)
                      -.-.-+|++.|......+.+..+.+.+|++-+. .+++|-.+|....
T Consensus        28 p~~Y~~FL~il~~~~~~~i~~~~v~~~v~~Ll~-~hpdLl~~F~~FL   73 (80)
T 2cr7_A           28 PATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFH-EHPDLIVGFNAFL   73 (80)
T ss_dssp             HHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHGG-GCHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHC-CCHHHHHHHHHHC
T ss_conf             899999999999998768989999999999976-6889999999887


No 11 
>>2e9x_B DNA replication complex GINS protein PSF2; eukaryotic DNA replication; HET: DNA; 2.30A {Homo sapiens} (B:1-11,B:65-185)
Probab=22.69  E-value=35  Score=12.29  Aligned_cols=45  Identities=20%  Similarity=0.257  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999971995899999999999999999999999843
Q gi|254780721|r  250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL  294 (329)
Q Consensus       250 ~~~~~~~~l~~~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~  294 (329)
                      .+-..+..|......--+-.+-++.+-+++|+.|..+.+....+.
T Consensus        38 h~~Eia~lLl~~A~dDi~~~d~iR~Li~DI~evR~~Klr~gl~~l   82 (132)
T 2e9x_B           38 YYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSF   82 (132)
T ss_dssp             THHHHHHHHHHHHGGGSTTHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             899999999985356788889999999999999999999999998


No 12 
>>2hl7_A Cytochrome C-type biogenesis protein CCMH; three-helices bundle, oxidoreductase; HET: PG4; 1.70A {Pseudomonas aeruginosa} (A:)
Probab=22.58  E-value=35  Score=12.28  Aligned_cols=39  Identities=13%  Similarity=0.078  Sum_probs=30.4

Q ss_pred             CCCCCHHHHHHHHHHHHH-HHCCCCHHHHHHHHHHHCCCH
Q ss_conf             077877899999999999-965999899999999863995
Q gi|254780721|r  211 IGGQSVPLSEEMLLTIAE-LSFLPNRQVAFENFYNRTQMD  249 (329)
Q Consensus       211 ~~~~~~~l~~e~~~~~~~-~~~G~~~~~Al~~~a~r~~~~  249 (329)
                      +.+.+.+++..++..+++ +..|.+-++-..-|-+|+|.-
T Consensus        37 i~dSna~~A~dmR~~i~~~i~~G~sd~eI~~~lv~RYG~~   76 (84)
T 2hl7_A           37 IADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDF   76 (84)
T ss_dssp             TTTCCSHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHTTT
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCE
T ss_conf             3006778899999999999995999899999999970883


No 13 
>>2q5z_A MAZG, hypothetical protein; NTP-ppase, hydrolase; 2.30A {Vibrio SP} (A:)
Probab=22.24  E-value=36  Score=12.24  Aligned_cols=34  Identities=12%  Similarity=0.100  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHH-HHHHHHCCCCHHHHHHHHHHH
Q ss_conf             9999999999999-999997499689999999984
Q gi|254780721|r  177 SSIKRAWPDALDL-LLICVESGISIDQALRRVAED  210 (329)
Q Consensus       177 ~~i~~~lP~~ld~-l~~~~~aG~~l~~Al~~va~e  210 (329)
                      ..+..++-|.+-. +..|-..|..+++|+....+.
T Consensus        73 ~~l~eElgDvL~~l~~lA~~~giDle~al~~~~~k  107 (114)
T 2q5z_A           73 GSVAEELYDVLYYVCALANIHGVNLEKTRELKEVL  107 (114)
T ss_dssp             TCHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999999999999999999791999999999999


Done!