Query         gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 329
No_of_seqs    154 out of 1349
Neff          8.6 
Searched_HMMs 13730
Date          Wed Jun  1 09:10:19 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780721.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1jr3a1 a.80.1.1 (A:243-368) g  49.7     5.2 0.00038   15.2   2.9   80  179-263    15-95  (126)
  2 d1gpja1 a.151.1.1 (A:303-404)   43.6     5.2 0.00038   15.2   1.8   94  174-276     4-98  (102)
  3 d1xkpa1 a.243.1.3 (A:73-269) O  33.3     9.3 0.00067   13.5  10.1  105  175-283    83-194 (197)
  4 d2ezla_ a.4.1.2 (A:) Ibeta sub  30.6      10 0.00075   13.2   6.8   56  169-225    22-77  (99)
  5 d2e9xb1 a.278.1.2 (B:62-173) D  20.0      16  0.0012   11.9   3.2   44  251-294    31-74  (112)
  6 d2jf2a1 b.81.1.1 (A:1-262) UDP  15.1      21  0.0015   11.2   5.2   46  216-261   209-256 (262)
  7 d2pv7a1 a.100.1.12 (A:244-371)  13.1      24  0.0017   10.8   5.2   30  235-264    80-109 (128)
  8 d2cxxa1 c.37.1.8 (A:2-185) GTP  10.4      29  0.0021   10.3   0.4   23  260-282   162-184 (184)
  9 d2atva1 c.37.1.8 (A:5-172) Ras   9.9      30  0.0022   10.1   2.1   43  233-283   124-167 (168)
 10 d1ppjc2 f.21.1.2 (C:15-260) Mi   8.8      34  0.0025    9.8   1.0   61  143-203    99-159 (246)

No 1  
>d1jr3a1 a.80.1.1 (A:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
Probab=49.67  E-value=5.2  Score=15.17  Aligned_cols=80  Identities=11%  Similarity=0.115  Sum_probs=50.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH-HCCCCHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             999999999999999974996899999999840778778999999999999-6599989999999986399589999999
Q gi|254780721|r  179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL-SFLPNRQVAFENFYNRTQMDCVRNATQA  257 (329)
Q Consensus       179 i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~-~~G~~~~~Al~~~a~r~~~~~~~~~~~~  257 (329)
                      ++.+.+.+++.+....+.|..+.+-+....+.+..    +.- .+....+. ....+..+.+..++++++..++..+...
T Consensus        15 ~~~d~~~~L~~l~~i~~~G~d~~~~l~~L~~~~r~----l~~-~k~~~~~~~~~~~~~~~~~~~~a~~~~~~~L~~~~~i   89 (126)
T d1jr3a1          15 VEANGERVMALINEAAARGIEWEALLVEMLGLLHR----IAM-VQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQT   89 (126)
T ss_dssp             HHTCHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHH----HHH-HTTCTTCCCSGGGGTHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH----HHH-HHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             90899999999999998597899999999999999----999-9863000000107788999999971899999999999


Q ss_pred             HHHHHH
Q ss_conf             999997
Q gi|254780721|r  258 LIQSDR  263 (329)
Q Consensus       258 l~~~~~  263 (329)
                      +..+.+
T Consensus        90 l~~~~~   95 (126)
T d1jr3a1          90 LLIGRK   95 (126)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999999


No 2  
>d1gpja1 a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dimerization domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}
Probab=43.60  E-value=5.2  Score=15.17  Aligned_cols=94  Identities=12%  Similarity=0.075  Sum_probs=56.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHH
Q ss_conf             99999999999999999999974996899999999840778778999999999999659998999999998639958999
Q gi|254780721|r  174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN  253 (329)
Q Consensus       174 ~r~~~i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~  253 (329)
                      +-..-++.+...|..-+-.  ..-.|.-.+++.-++++      -..|+.+..+.+..| +.++.++.++.++-..-++.
T Consensus         4 ~AE~II~ee~~~F~~w~~~--~~~~p~I~~lr~~~e~i------r~~Elekal~kl~~~-~~e~vie~l~~~l~nKllH~   74 (102)
T d1gpja1           4 KVEKLIEEELSTVEEELEK--LKERRLVADVAKSLHEI------KDRELERALRRLKTG-DPENVLQDFAEAYTKRLINV   74 (102)
T ss_dssp             HHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHH------HHHHHHHHHSCSCC------CCTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHH------HHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999986--63237999999999999------999999999764789-98999999999999988877


Q ss_pred             HHHHHHHHHHCCC-CHHHHHHHHH
Q ss_conf             9999999997199-5899999999
Q gi|254780721|r  254 ATQALIQSDRYGT-SIGDSLRVLV  276 (329)
Q Consensus       254 ~~~~l~~~~~~G~-~l~~~L~~~a  276 (329)
                      .+..+.+....|- .....|+.+.
T Consensus        75 pt~~lr~~~~e~~~~~~~~lr~~~   98 (102)
T d1gpja1          75 LTSAIMELPDEYRRAASRALRRAS   98 (102)
T ss_dssp             HHHHHHSSCTTTTTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999888754489999999986


No 3  
>d1xkpa1 a.243.1.3 (A:73-269) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
Probab=33.30  E-value=9.3  Score=13.51  Aligned_cols=105  Identities=10%  Similarity=0.040  Sum_probs=68.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH-HHCCCCHHHHHHHHHHHCCCHHHHH
Q ss_conf             999999999999999999997499689999999984077877899999999999-9659998999999998639958999
Q gi|254780721|r  175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE-LSFLPNRQVAFENFYNRTQMDCVRN  253 (329)
Q Consensus       175 r~~~i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~-~~~G~~~~~Al~~~a~r~~~~~~~~  253 (329)
                      ....+++.+-...+--...++||..+.-+...-++......    ..++.+.++ +....+....++.+.++++..+...
T Consensus        83 ~l~~l~~al~~l~~~~g~~i~AG~Nia~~a~~f~~~~~~~~----~~LR~lYr~~v~~~~~~~~~y~~~~~~~g~~~~~~  158 (197)
T d1xkpa1          83 LSHLVEQALVSMAEEQGETIVLGARITPEAYRESQSGVNPL----QPLRDTYRDAVMGYQGIYAIWSDLQKRFPNGDIDS  158 (197)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCCH----HHHHHHHHHHHHCCCCHHHHHHHHHHHCTTSCHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHCCCCCHHHHHHHHHHHHCHHHHHH
T ss_conf             89999999999987037677702865787999987415899----99999999998077659999999999838077999


Q ss_pred             HHHHHHHHHH-----CCCCHH-HHHHHHHHHHHHHH
Q ss_conf             9999999997-----199589-99999999999999
Q gi|254780721|r  254 ATQALIQSDR-----YGTSIG-DSLRVLVSETRSER  283 (329)
Q Consensus       254 ~~~~l~~~~~-----~G~~l~-~~L~~~a~~~r~~~  283 (329)
                      .+.-|..+.-     .|.|+. .-|..+-.++++.+
T Consensus       159 ~l~fl~rALa~DL~s~~pSi~~~~l~~lm~~l~~Lr  194 (197)
T d1xkpa1         159 VILFLQKALSADLQSQQSGSGREKLGIVISDLQKLK  194 (197)
T ss_dssp             HHHHHHHHHHHHHHHCCCSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999999999878852589999899999999999988


No 4  
>d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage mu [TaxId: 10677]}
Probab=30.63  E-value=10  Score=13.23  Aligned_cols=56  Identities=18%  Similarity=0.188  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             999999999999999999999999997499689999999984077877899999999
Q gi|254780721|r  169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT  225 (329)
Q Consensus       169 ~~~~~~r~~~i~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~  225 (329)
                      .+.-++.+++-+.-+. ++.-+...+++|.|...|+..|+++..-+.+.+..=+..+
T Consensus        22 e~~s~k~k~~Ak~RL~-~l~~V~~L~~~G~~~~~A~~~VA~~~~vs~~TL~nW~~~V   77 (99)
T d2ezla_          22 DNASDSQRRLAEKWLP-AVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQV   77 (99)
T ss_dssp             HTSCHHHHHHHHHHHH-HHHHHHHHHHTTCCHHHHHHHHHHHSSSCHHHHHHHHHHH
T ss_pred             HHCCHHHHHHHHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             8578999999999999-9999999998697089999999999598899999999997


No 5  
>d2e9xb1 a.278.1.2 (B:62-173) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=20.02  E-value=16  Score=11.94  Aligned_cols=44  Identities=20%  Similarity=0.267  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999971995899999999999999999999999843
Q gi|254780721|r  251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL  294 (329)
Q Consensus       251 ~~~~~~~l~~~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~  294 (329)
                      +-..+..+.......-+-.+-++.+-+++|+.|..+.+....+.
T Consensus        31 ~~Eia~~ll~~a~ddi~~~~~vr~Lv~DI~~vR~~Klr~~~~~l   74 (112)
T d2e9xb1          31 YMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSF   74 (112)
T ss_dssp             HHHHHHHHHHHHGGGSTTHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999986355799899999999999999999999999999


No 6  
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
Probab=15.14  E-value=21  Score=11.19  Aligned_cols=46  Identities=7%  Similarity=-0.132  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHHH-HCCCCHHHHHHHHHHHC-CCHHHHHHHHHHHHH
Q ss_conf             78999999999999-65999899999999863-995899999999999
Q gi|254780721|r  216 VPLSEEMLLTIAEL-SFLPNRQVAFENFYNRT-QMDCVRNATQALIQS  261 (329)
Q Consensus       216 ~~l~~e~~~~~~~~-~~G~~~~~Al~~~a~r~-~~~~~~~~~~~l~~~  261 (329)
                      +....+++...+.+ +.+.+++++++++.+.. .+|+++.|.+-+..+
T Consensus       209 ~e~i~~lk~~~k~L~~~~~~l~~~~~~l~~~~~~~~~v~~~i~Fi~~s  256 (262)
T d2jf2a1         209 REAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARS  256 (262)
T ss_dssp             HHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHTTCGGGHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHC
T ss_conf             999999999999998669979999999986502889999999999748


No 7  
>d2pv7a1 a.100.1.12 (A:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}
Probab=13.10  E-value=24  Score=10.82  Aligned_cols=30  Identities=3%  Similarity=0.030  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             899999999863995899999999999971
Q gi|254780721|r  235 RQVAFENFYNRTQMDCVRNATQALIQSDRY  264 (329)
Q Consensus       235 ~~~Al~~~a~r~~~~~~~~~~~~l~~~~~~  264 (329)
                      +.+.+.++.+.+...+...+...+..+.+.
T Consensus        80 ~~~~l~~l~~~i~~~D~~~l~~~~~~a~~~  109 (128)
T d2pv7a1          80 LKQTYDEALTFFENNDRQGFIDAFHKVRDW  109 (128)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             999999999999839999999999999999


No 8  
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}
Probab=10.42  E-value=29  Score=10.27  Aligned_cols=23  Identities=17%  Similarity=0.265  Sum_probs=17.9

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             99971995899999999999999
Q gi|254780721|r  260 QSDRYGTSIGDSLRVLVSETRSE  282 (329)
Q Consensus       260 ~~~~~G~~l~~~L~~~a~~~r~~  282 (329)
                      .+.++|.++.+.++.+.+.+++|
T Consensus       162 vSA~~g~gi~~L~~~i~~~l~e~  184 (184)
T d2cxxa1         162 ISAKFGDNIERLKNRIFEVIRER  184 (184)
T ss_dssp             CCTTTCTTHHHHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHHCCCC
T ss_conf             97788989999999999875699


No 9  
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}
Probab=9.87  E-value=30  Score=10.14  Aligned_cols=43  Identities=19%  Similarity=0.149  Sum_probs=28.9

Q ss_pred             CCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHH
Q ss_conf             998999999998639958999999999999719-958999999999999999
Q gi|254780721|r  233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYG-TSIGDSLRVLVSETRSER  283 (329)
Q Consensus       233 ~~~~~Al~~~a~r~~~~~~~~~~~~l~~~~~~G-~~l~~~L~~~a~~~r~~~  283 (329)
                      .+.+++ ++++++.+.+-       ...+.++| ||+.+++..+++.+.++|
T Consensus       124 V~~~e~-~~~a~~~~~~~-------~e~Saktg~gnV~e~F~~l~~~i~~~r  167 (168)
T d2atva1         124 VSTEEG-EKLATELACAF-------YECSACTGEGNITEIFYELCREVRRRR  167 (168)
T ss_dssp             SCHHHH-HHHHHHHTSEE-------EECCTTTCTTCHHHHHHHHHHHHHHHH
T ss_pred             CCHHHH-HHHHHHHCCEE-------EEECCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             769999-99999809959-------997554188199999999999999845


No 10 
>d1ppjc2 f.21.1.2 (C:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
Probab=8.75  E-value=34  Score=9.76  Aligned_cols=61  Identities=18%  Similarity=0.113  Sum_probs=0.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             1215899999999999999999999999999999999999999999999999749968999
Q gi|254780721|r  143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA  203 (329)
Q Consensus       143 ~~~~~~~~~~~~~~~~~g~~~P~~~l~~~~~~r~~~i~~~lP~~ld~l~~~~~aG~~l~~A  203 (329)
                      +.............+..||.+|.--.....-.-...+-..+|..=+.++.-+..|.++.++
T Consensus        99 w~~G~~l~~l~m~~af~GY~Lpw~qms~wa~~V~t~l~~~iP~iG~~l~~wi~GG~~v~~~  159 (246)
T d1ppjc2          99 WNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKA  159 (246)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCBHHHHHHHHHHHGGGGGSTTTHHHHHHHHHTSSSSCHH
T ss_pred             HHHHHHHHHHHHHHHHEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9999999999999988013478851368999999999999998788778640178607741


Done!