BLAST/PSIBLAST alignment of GI: 254780721 and GI: 190889886 at iteration 1
>gi|190889886|ref|YP_001976428.1| pilus component protein [Rhizobium etli CIAT 652] Length = 328
>gi|190695165|gb|ACE89250.1| pilus component protein [Rhizobium etli CIAT 652] Length = 328
 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 234/311 (75%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  +  + +  LR
Sbjct: 16  IAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARERARMNANPGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  SQNNRSVRQIVERFNLRQALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLAERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALENLATRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326