BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780721|ref|YP_003065134.1| pilus component protein
[Candidatus Liberibacter asiaticus str. psy62]
         (329 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040398|gb|ACT57194.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 329

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI
Sbjct: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
           TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR
Sbjct: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK
Sbjct: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE
Sbjct: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV
Sbjct: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           PMIIFFLPVLILVIIGPAILSIIDTMKDH
Sbjct: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329


>gi|315121886|ref|YP_004062375.1| pilus component protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495288|gb|ADR51887.1| pilus component protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 319

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 242/320 (75%), Positives = 284/320 (88%), Gaps = 2/320 (0%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +FD+  +AV + T++S+FSLIYAV+IPSLGS ELEKR+KSV++ERE LRKQQ+  L K  
Sbjct: 1   MFDSVTIAVVVATSISVFSLIYAVIIPSLGSDELEKRIKSVSIEREELRKQQLARLGK-- 58

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            SS LRT D+ SLR FV+K NLKAILVD+ +V+KLRAAGFRSEY+LNILL++RLV+PII 
Sbjct: 59  PSSGLRTHDNMSLRKFVEKFNLKAILVDKPMVDKLRAAGFRSEYALNILLIIRLVLPIIT 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L++GIIWIFG+DKL +Y F  R+  VILIGY GF APS++ISNLV KRQ SI+RAWPDAL
Sbjct: 119 LVIGIIWIFGFDKLEQYSFFNRLFVVILIGYAGFYAPSMFISNLVTKRQDSIRRAWPDAL 178

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLLLIC+ESGI++DQALRRVAE++GGQSV LSEE+LLT AELSFL NRQVAFENFYNRTQ
Sbjct: 179 DLLLICIESGIAVDQALRRVAEEVGGQSVALSEELLLTTAELSFLLNRQVAFENFYNRTQ 238

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           MDC+RN  QA IQSDRYGTSIGDSLRVLV+ETRSERLMEAEKKAA+L PKLTVPMI+FFL
Sbjct: 239 MDCIRNVMQAFIQSDRYGTSIGDSLRVLVAETRSERLMEAEKKAAALSPKLTVPMILFFL 298

Query: 308 PVLILVIIGPAILSIIDTMK 327
           PVL+LVIIGPAIL+I+DTMK
Sbjct: 299 PVLMLVIIGPAILNIMDTMK 318


>gi|327194689|gb|EGE61535.1| pilus component protein [Rhizobium etli CNPAF512]
          Length = 328

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 176/311 (56%), Positives = 234/311 (75%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  D  + +  LR
Sbjct: 16  IAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARERARMNADPGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  SQNNRSVRQIVERFNLRQALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLAERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALENLAMRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326


>gi|190889886|ref|YP_001976428.1| pilus component protein [Rhizobium etli CIAT 652]
 gi|190695165|gb|ACE89250.1| pilus component protein [Rhizobium etli CIAT 652]
          Length = 328

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 234/311 (75%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  +  + +  LR
Sbjct: 16  IAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARERARMNANPGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  SQNNRSVRQIVERFNLRQALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLAERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALENLATRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326


>gi|209551764|ref|YP_002283681.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537520|gb|ACI57455.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 328

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/311 (55%), Positives = 235/311 (75%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + +P    G+L KRMK+V+ ERE +R ++   +  ++ + +  LR
Sbjct: 16  IALLVAIAVFATFYTIAVPFFERGDLNKRMKAVSTEREQIRARERARMNTETGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  SQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLPERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALENLATRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVSD 326


>gi|241207162|ref|YP_002978258.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861052|gb|ACS58719.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 328

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 171/311 (54%), Positives = 233/311 (74%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  ++ + +  LR
Sbjct: 16  IALFVAIAVFATFYTIAIPFFERGDLNKRMKAVSTEREQIRARERARMNTETGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            ++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L  +
Sbjct: 76  NQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLTLAAV 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI +GY+GF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLAEKGTPIRLFAVIGVGYLGFYAPNIFISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS  L+EEM+LT AELSFLP+R+ A EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPALAEEMVLTTAELSFLPDRRAALENLATRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326


>gi|15887568|ref|NP_353249.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155105|gb|AAK86034.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 328

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 165/313 (52%), Positives = 234/313 (74%), Gaps = 4/313 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILR---KQQITSLQKDSASSRL 72
           +AI   +++F+ +Y +++P L   +L KRMK+V+ ERE++R   ++++ ++ +D  +S L
Sbjct: 16  IAILVTLAVFATLYTLIMPFLERKDLAKRMKAVSSERELIRSRERERLATVTRDGRTS-L 74

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R  ++KS R  V+K NL+  L D+N +NKLRAAGFRS+ +LN  L  R V+P IFL +  
Sbjct: 75  RGNNNKSARRIVEKFNLREALADQNTMNKLRAAGFRSQNALNTFLAARFVLPFIFLAVAF 134

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            W+F    L +  F +R+ AV++ GY+GF AP++++SN + KRQ+SIKRAWPDALDL+LI
Sbjct: 135 TWVFVLGNLADKAFVVRLMAVLVFGYIGFYAPNIYVSNRMTKRQASIKRAWPDALDLMLI 194

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C+ESG+S++ A+RRVAE++G QS  L+EEM+LT AELSFL +R+ A ENF  RTQ+D V+
Sbjct: 195 CIESGVSMESAMRRVAEEMGEQSPELAEEMILTTAELSFLQDRRTALENFGMRTQLDGVK 254

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +  QALIQ++RYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMIIFFLPVLI 
Sbjct: 255 SVVQALIQAERYGTPLAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMIIFFLPVLIA 314

Query: 313 VIIGPAILSIIDT 325
           VI+GPA + + DT
Sbjct: 315 VILGPAGIRVADT 327


>gi|222084474|ref|YP_002543003.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721922|gb|ACM25078.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 325

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 228/309 (73%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +A+  A+++F+  Y + +P L  G+L KRMK+V+ ERE +R ++   L  D + + LR++
Sbjct: 15  LAVFVAIAVFATFYTIAVPFLERGDLNKRMKAVSTEREQIRARERARLNTDGSKASLRSQ 74

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
           ++K++R  V++ NL+  LVD N VN+LRAAG RSE +LN+ LV R ++P +FL + +  +
Sbjct: 75  NNKNVRQIVERFNLRNALVDTNTVNRLRAAGLRSENALNMFLVARFLLPFLFLAVAVFLV 134

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           FG       PF  R+  VI   Y+GF +P+++ISN V KRQ SIKRAWPDALDL+LICVE
Sbjct: 135 FGLGYFAAKPFAFRLLGVIGTAYLGFYSPNIYISNRVTKRQKSIKRAWPDALDLMLICVE 194

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SGISI+  +RRV+E++  QS  L+EEM+LT AELSFL +R+ AF+N   RTQ++ V++ T
Sbjct: 195 SGISIEAGMRRVSEEMAEQSPALAEEMVLTTAELSFLQDRRTAFDNLAARTQIEIVKSVT 254

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           QALIQ++RYGT +  +LRV+  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVL+ VI+
Sbjct: 255 QALIQAERYGTPVSQALRVMAQEGRDERMNEAEKKAAALPPKLTVPMIVFFLPVLMAVIL 314

Query: 316 GPAILSIID 324
           GPAI+ ++D
Sbjct: 315 GPAIIQVMD 323


>gi|116249986|ref|YP_765824.1| component of pilus protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254634|emb|CAK05708.1| putative component of pilus protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 328

 Score =  342 bits (876), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 170/311 (54%), Positives = 234/311 (75%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + +P    G+L KRMK+V+ ERE +R ++   +  ++ + +  LR
Sbjct: 16  IALLVAIAVFATFYTIAVPFFERGDLNKRMKAVSTEREQIRARERARMNTETGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +++++S+R  V++ NL+  LVDEN +NKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  SQNNRSVRQIVERFNLRKALVDENTINKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L E    +R+ AVI +GY+GF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGNLAEKGTPIRLFAVIGVGYLGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESGISI+ A+RRV+E++G QS  L+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+
Sbjct: 196 VESGISIEAAMRRVSEELGEQSPALAEEMVLTTAELSFLPDRRVALENLATRTQIELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326


>gi|325291654|ref|YP_004277518.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059507|gb|ADY63198.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 328

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 232/313 (74%), Gaps = 4/313 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILR---KQQITSLQKDSASSRL 72
           +AI   +++F+ +Y +++P     +  KRMK+V+ ER+++R   ++++ +  +D  +S L
Sbjct: 16  IAILVTLAVFATLYTLIMPLFERKDFAKRMKAVSSERDLIRSRERERLAAATRDGKAS-L 74

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R  ++KS R  V+K NL+  L D+N +NKLRAAGFRS+ +LN  L  R V+P +FL L  
Sbjct: 75  RGNNNKSARRIVEKFNLQEALADKNTMNKLRAAGFRSQNALNTFLAARFVLPFVFLALAF 134

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            W+F    L +  F +R+ AV++ GY+GF AP++++SN + KRQ+SI+RAWPDALDL+LI
Sbjct: 135 TWVFVLGNLADKAFVVRLMAVLIFGYLGFYAPNIYVSNAMNKRQASIRRAWPDALDLMLI 194

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C+ESG+S++ A+RRVAE++G QS  L+EEM+LT AELSFL +R++A ENF  RTQ+D V+
Sbjct: 195 CIESGVSMEAAMRRVAEEMGEQSPELAEEMMLTTAELSFLQDRRIALENFGMRTQLDGVK 254

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +  QALIQ++RYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMIIFFLPVLI 
Sbjct: 255 SVVQALIQAERYGTPLAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMIIFFLPVLIA 314

Query: 313 VIIGPAILSIIDT 325
           VI+GPA + + DT
Sbjct: 315 VILGPAGIRVADT 327


>gi|86355869|ref|YP_467761.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279971|gb|ABC89034.1| probable pilus assembly protein [Rhizobium etli CFN 42]
          Length = 328

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 232/311 (74%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  +  + +  LR
Sbjct: 16  IAVFVAIAVFATFYTIAIPFFERGDLNKRMKAVSTEREQIRARERARMNTEPGAGKTSLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            ++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV R ++P +FL L   
Sbjct: 76  NQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLVARFLLPFLFLALAAF 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           W+FG   L +    +R+ AVI I Y+GF AP+++ISN + KRQ SIKRAWPDALDL+LIC
Sbjct: 136 WVFGLGGLADRGMPMRMLAVIGIAYLGFYAPNIYISNRMSKRQHSIKRAWPDALDLMLIC 195

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA +N   RTQ++ VR+
Sbjct: 196 VESGVSMEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALDNLAARTQLELVRS 255

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI V
Sbjct: 256 VTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAV 315

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 316 ILGPAGIQVAD 326


>gi|150398546|ref|YP_001329013.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150030061|gb|ABR62178.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 327

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 225/311 (72%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           VA+  ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  ++ + R  LR
Sbjct: 15  VAVLVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNTEAPTGRASLR 74

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           T+ + S+R  V++LNL+  LVD+N VN+L+ AGFRS+ +LN  L  R  +P +FL + ++
Sbjct: 75  TQHNSSVREVVERLNLRKALVDDNTVNRLKTAGFRSQNALNTFLFARFCLPFLFLTVSVL 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +IF      + P  +RV   I   YVGF AP+++I+N + KRQ SI+RAWPDALDLLLIC
Sbjct: 135 YIFVLGNFADKPVMVRVSFAIGFAYVGFYAPNIFIANAISKRQHSIRRAWPDALDLLLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R+VA EN   RT ++ V++
Sbjct: 195 VESGVSMELAMRRVADEIAVQSQPLAEELVLTTAELSFLPERRVALENLGRRTGLEEVKS 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             QALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL+ V
Sbjct: 255 VMQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMILFFLPVLVAV 314

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 315 ILGPAGIQVAD 325


>gi|15963899|ref|NP_384252.1| hypothetical protein SMc02822 [Sinorhizobium meliloti 1021]
 gi|307320431|ref|ZP_07599848.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|15073074|emb|CAC41533.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306893997|gb|EFN24766.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 327

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/311 (50%), Positives = 224/311 (72%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           VA   ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  ++ + R  LR
Sbjct: 15  VAALVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNAEATTGRASLR 74

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +P +FL + ++
Sbjct: 75  AQHNTSVREIVERLNLRKALVDDNTVNRLKTAGYRSQNALNTFLFARFCLPFLFLTVAVL 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +IF      + P  +RV   I   YVGF AP+++I+N + KRQ SI+RAWPDALDLLLIC
Sbjct: 135 YIFVLGNFADKPIMVRVSFAIGFAYVGFYAPNIFIANAISKRQQSIRRAWPDALDLLLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R++A EN   RT +D V++
Sbjct: 195 VESGVSMELAMRRVADEIAVQSPPLAEELVLTTAELSFLPERRIALENLGLRTGLDEVKS 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL+ V
Sbjct: 255 VTQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMILFFLPVLVAV 314

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 315 ILGPAGIQVAD 325


>gi|307315796|ref|ZP_07595310.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|306898564|gb|EFN29237.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 327

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/311 (50%), Positives = 223/311 (71%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           VA   ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  ++ + R  LR
Sbjct: 15  VAALVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNAEATTGRASLR 74

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +P +FL + ++
Sbjct: 75  AQHNTSVREIVERLNLRKALVDDNTVNRLKTAGYRSQNALNTFLFARFCLPFLFLTVAVL 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +IF      + P  +RV   I   YVGF AP ++I+N + KRQ SI+RAWPDALDLLLIC
Sbjct: 135 YIFVLGNFADKPIMVRVSFAIGFAYVGFYAPKIFIANAISKRQQSIRRAWPDALDLLLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R++A EN   RT +D V++
Sbjct: 195 VESGVSMELAMRRVADEIAVQSPPLAEELVLTTAELSFLPERRIALENLGLRTGLDEVKS 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            TQALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL+ V
Sbjct: 255 VTQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMILFFLPVLVAV 314

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 315 ILGPAGIQVAD 325


>gi|227823976|ref|YP_002827949.1| components of type IV pilus TadC [Sinorhizobium fredii NGR234]
 gi|227342978|gb|ACP27196.1| components of type IV pilus TadC [Sinorhizobium fredii NGR234]
          Length = 327

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 224/311 (72%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  ++++ +  Y++ +P    G+L KRMKSVA ERE +R ++   L  ++++ +  LR
Sbjct: 15  IAVLVSMAVLATFYSLAVPFFERGDLTKRMKSVATEREQIRARERARLNAEASAGKASLR 74

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +P +FL + ++
Sbjct: 75  AQHNTSVRQIVERLNLRQALVDDNTVNRLKTAGYRSQNALNTFLFARFCLPFLFLTVAVV 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +IF      + PF LR+   +   Y+GF AP+++I+N + KRQ SI+RAWPDALDLLLIC
Sbjct: 135 YIFVLGNFADKPFMLRICFALGFAYLGFYAPNIFIANAISKRQHSIRRAWPDALDLLLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRVA++I  QS  L+EE++LT AELSFLP+R++A EN   R+ ++ V+ 
Sbjct: 195 VESGVSMELAMRRVADEIAAQSSALAEELVLTTAELSFLPDRRIALENLGLRSGLEEVKA 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             QALIQ+DRYGT I  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL+ V
Sbjct: 255 VMQALIQADRYGTPIAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMILFFLPVLVAV 314

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 315 ILGPAGIQVAD 325


>gi|222147177|ref|YP_002548134.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734167|gb|ACM35130.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 326

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 222/311 (71%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L +A+  A+++F+ +Y ++ P L   +L KRMK+V+ ERE++R ++   +  +     LR
Sbjct: 14  LLIAVLVAIAVFATLYTLISPLLERSDLNKRMKAVSSERELIRARERARMNSEGGRGSLR 73

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
             D+ S R  V++ NL+  LVD+  +++L+ AG RS+ +LN+ L  R ++P +FL L   
Sbjct: 74  NTDNSSARKIVERFNLRKALVDDKTMDRLKTAGLRSQNALNMFLTARFLLPFLFLALATT 133

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           WIF    +   PF +R  A ++ GYVGF  P+++ISN + KRQ SI+RAWPDALDL+LIC
Sbjct: 134 WIFALHNMQSRPFAVRFLAAVVAGYVGFYLPNIYISNRITKRQHSIRRAWPDALDLMLIC 193

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ A+RRVA+++  QS  L+EEM+LT AELSFL +R+ A+EN  NRTQ++ V++
Sbjct: 194 VESGMSMEAAMRRVADEMASQSPALAEEMVLTTAELSFLQDRRTAYENLGNRTQLEIVKS 253

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             QALIQ++RYGT IG +LRVL  E R ER+  AEKKAA+L PKLTVPMI+FFLPVL+ V
Sbjct: 254 VCQALIQAERYGTPIGQALRVLAQEGRDERMNAAEKKAAALPPKLTVPMILFFLPVLVAV 313

Query: 314 IIGPAILSIID 324
           I+GPA + + D
Sbjct: 314 ILGPAGIRVSD 324


>gi|163757632|ref|ZP_02164721.1| putative component of pilus protein [Hoeflea phototrophica DFL-43]
 gi|162285134|gb|EDQ35416.1| putative component of pilus protein [Hoeflea phototrophica DFL-43]
          Length = 331

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 227/314 (72%), Gaps = 5/314 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD-----SASS 70
           V I  +V++F+ ++ ++ P    G+L+KRMKS A+ER+ +R ++   L  +     S S+
Sbjct: 16  VPILVSVAVFATLFTIMAPYFERGDLDKRMKSAALERDEIRARERARLHAEQSRGGSKSA 75

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR  ++ S+R  V++LNL+  L D+  V KLRAAG+R++ +LN+ L+ R V+P  F + 
Sbjct: 76  GLRAHNNASVRGIVEQLNLRKALADDATVAKLRAAGYRTQNALNMFLLARFVLPFFFFVA 135

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++++F  + + + P  +R+ A I+  Y GF AP+++ISN  +KRQ SIK AWPDALDLL
Sbjct: 136 AVVYVFVLENMTDKPTTVRLLACIVAAYAGFYAPNIFISNQSKKRQQSIKMAWPDALDLL 195

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LICVESG+SI+ A++RVAE+I  QS  L+EE LLT AELS+L +R+VAFEN  NRT ++ 
Sbjct: 196 LICVESGVSIEAAMKRVAEEIAIQSTALAEEFLLTTAELSYLQDRRVAFENLGNRTGLEA 255

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V++ TQALIQS+RYGT I  +LRVL  E+R  R+ EAEKKAA+L PKLTVPMI+FFLPVL
Sbjct: 256 VKSVTQALIQSERYGTPIAQALRVLAQESRDARMTEAEKKAAALPPKLTVPMILFFLPVL 315

Query: 311 ILVIIGPAILSIID 324
           I VI+GPA + ++D
Sbjct: 316 IGVILGPAAIQVMD 329


>gi|328545274|ref|YP_004305383.1| hypothetical protein SL003B_3658 [polymorphum gilvum SL003B-26A1]
 gi|326415016|gb|ADZ72079.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 325

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
           F DL + +++ +A+ T V++   ++ +V+P      L+ RMK+VA+ERE +R ++   L 
Sbjct: 3   FSDLAN-SQMVIAVLTMVAVAGTVFTLVMPVFERDGLKSRMKTVALEREKIRARERARLA 61

Query: 65  KDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
            +   +R  LR +  K ++N V KLNL+  L DEN  +KLR AG+R    L   L  R+V
Sbjct: 62  TEKGDTRVSLRNQPKKQVKNLVDKLNLRTALADENTQDKLRMAGYRGTGPLYTFLFARIV 121

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           +P+I  ++ + ++F +      P   +V A + +G +G  AP+V+I N + KRQ SI+RA
Sbjct: 122 MPLILFVIALFYVFAFLPA-TLPSFTKVCAALFVGGIGVFAPNVYIQNRITKRQQSIRRA 180

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           WPDALDL+LICVESG+SI+ A R+VA++IG QS+PL+EE+ LT AELSFL  R+ A+ NF
Sbjct: 181 WPDALDLMLICVESGMSIEAAFRKVADEIGIQSIPLAEELTLTNAELSFLQERRQAYLNF 240

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT +D V+N T ALIQ++RYGT IG +LRV+  + R +R+ EAEKKAASL PKLTVPM
Sbjct: 241 AKRTGVDGVKNVTMALIQAERYGTPIGHALRVMADDNREQRMQEAEKKAASLPPKLTVPM 300

Query: 303 IIFFLPVLILVIIGPAILSIIDTMK 327
           I+FFLPVL  VI+GPA++ II T +
Sbjct: 301 IVFFLPVLFFVIMGPAVMQIIATFR 325


>gi|153008064|ref|YP_001369279.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559952|gb|ABS13450.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
          Length = 333

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 213/302 (70%), Gaps = 1/302 (0%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS-ASSRLRTRDSKSL 80
           V++F+ +  +++P L    L+ RMKSVA ERE +R ++   L  +S   + LR +  + +
Sbjct: 22  VAVFATVVTILMPVLSGSALKSRMKSVATEREAIRSRERARLAAESDRRNSLRHQQKQGI 81

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
           R FV++L+LK  L DE  +  LR AGFR +  LNI L +R V+P   +++  I+IF    
Sbjct: 82  REFVERLDLKRALADEKTIASLRQAGFRGQNPLNIFLFLRFVLPFGAMLIAAIYIFMLGV 141

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
           L +  F +R+   I  GY GF AP++++SN   KR+ SI+RAWPDALDL+LICVESG+S 
Sbjct: 142 LADQTFFVRLLVCIFAGYAGFYAPNLYVSNRATKRKQSIRRAWPDALDLMLICVESGMST 201

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           + A RRVA++IG QSV L+EE++LT AELSFLP R+ A+EN  NRT +D V++ TQALIQ
Sbjct: 202 EAAFRRVADEIGIQSVELAEELMLTNAELSFLPERRQAYENLANRTGLDPVKSVTQALIQ 261

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           ++RYGT +  +LR L  E+R  RL++AEKKAA+L PKLTVPMI+FFLPVL +VI+GPA +
Sbjct: 262 AERYGTPVSQALRTLSQESRDLRLLDAEKKAAALPPKLTVPMIVFFLPVLFIVILGPAFI 321

Query: 321 SI 322
            I
Sbjct: 322 QI 323


>gi|239833232|ref|ZP_04681561.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825499|gb|EEQ97067.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
          Length = 333

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 154/302 (50%), Positives = 210/302 (69%), Gaps = 1/302 (0%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS-ASSRLRTRDSKSL 80
           V++F+ +  +++P L    L+ RMKSVA ERE +R ++   L  +S     LR +    +
Sbjct: 22  VAVFATVVTILLPVLSGSALKSRMKSVATEREAIRSRERARLAAESDRRGSLRHQQKPGI 81

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
           R FV+KL+LK  L DE  V  LR AGFR +  LNI L +R V+P   + +  I+IF    
Sbjct: 82  REFVEKLDLKRALADEKTVASLRQAGFRGQNPLNIFLFLRFVLPFGAMAIAAIYIFVLGV 141

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
           L +  F +R+   I  GY GF AP++++SN   KR+ SI+RAWPDALDL+LICVESG+S 
Sbjct: 142 LADQTFFVRLLVCIFAGYAGFYAPNLYVSNRATKRKQSIRRAWPDALDLMLICVESGMST 201

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           + A RRVA++IG QSV L+EE++LT AELSFLP R+ A+EN  NRT ++ V++ TQALIQ
Sbjct: 202 EAAFRRVADEIGIQSVELAEELMLTNAELSFLPERRQAYENLANRTGLEPVKSVTQALIQ 261

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           ++RYGT +  +LR L  E+R  RL+EAEKKAA+L PKLTVPMI+FFLPVL +VI+GPA +
Sbjct: 262 AERYGTPVAQALRTLSQESRDLRLLEAEKKAAALPPKLTVPMIVFFLPVLFIVILGPAFI 321

Query: 321 SI 322
            I
Sbjct: 322 QI 323


>gi|13474665|ref|NP_106234.1| hypothetical protein mlr5604 [Mesorhizobium loti MAFF303099]
 gi|14025420|dbj|BAB52020.1| mlr5604 [Mesorhizobium loti MAFF303099]
          Length = 339

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 220/311 (70%), Gaps = 3/311 (0%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR-- 71
           L +A+  A+++F+ ++  ++P+ G  +L+ RMKSVA+ER+ LR +Q   L  ++   R  
Sbjct: 14  LLIALLVAIAVFATVF-TLLPAFGGNQLKARMKSVALERDELRAKQRARLASEADRRRKG 72

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           LR + S  +RN V +L+L+  L DE+ + KL+ AGFR +  L   L  RLV+P +   LG
Sbjct: 73  LREQQSVGMRNIVDRLDLRRALADESTLQKLKVAGFRGQNPLTRFLFFRLVLPFVGFALG 132

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           +++IF    L + P  +R+   IL+ Y GF AP V+++N   KR+ SI+ AWPDALDL+L
Sbjct: 133 LVYIFVLGGLPDKPLVIRLFVCILVAYGGFYAPVVYVNNRATKRKQSIQMAWPDALDLML 192

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVESG+S++ ALR+VA++IG QSV L+EE +LT AELS+L  R+ A+EN  NRT ++ V
Sbjct: 193 ICVESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLQERKQAYENLANRTGLESV 252

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           ++ +QAL+Q++RYGT +  +LRVL +E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL 
Sbjct: 253 KSVSQALVQAERYGTPVAHALRVLAAESRDQRMNAAEKKAAALPPKLTVPMILFFLPVLF 312

Query: 312 LVIIGPAILSI 322
            +I+GPA + +
Sbjct: 313 AIILGPAGIQV 323


>gi|319785603|ref|YP_004145079.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171491|gb|ADV15029.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 340

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 213/309 (68%), Gaps = 3/309 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL--QKDSASSRLR 73
           +A+  A+++F+ ++  ++P+ G  +L+ RMKSVA+ER+ LR QQ   L  + D     LR
Sbjct: 16  IAMLVAIAVFATVF-TLLPAFGGNQLKSRMKSVALERDELRAQQRARLAVEADRRRKGLR 74

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
              S  +RN V +L+L+  L DE  + KL+ AGFR +  L   L  RLV+P +   L  I
Sbjct: 75  EEQSIGMRNIVDRLDLRRALADEGTLQKLKVAGFRGQNPLTRFLFFRLVLPFVGFALAAI 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +IF    L + P  +R+   IL+ Y GF AP ++++N   KR+ SI+ AWPD LDL+LIC
Sbjct: 135 YIFVLGGLPDKPLVIRLFVCILVAYGGFYAPVIYVNNRATKRKQSIQMAWPDGLDLMLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S++ ALR+VA++IG QSV L+EE +LT AELS+LP R+ A+EN  +RT +D V++
Sbjct: 195 VESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLPERKQAYENLASRTGLDSVKS 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            +QAL+Q++RYGT +  +LRVL +E+R  R+  AEKKAA+L PKLTVPMI+FFLPVL  +
Sbjct: 255 VSQALVQAERYGTPVAHALRVLAAESRDMRMNAAEKKAAALPPKLTVPMILFFLPVLFAI 314

Query: 314 IIGPAILSI 322
           I+GPA + +
Sbjct: 315 ILGPAGIQV 323


>gi|260461944|ref|ZP_05810189.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032191|gb|EEW33457.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 339

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/311 (46%), Positives = 218/311 (70%), Gaps = 3/311 (0%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR-- 71
           L +A+  A+++F+ ++  ++P+    +L+ RMKSVA+ER+ LR +Q   L  ++   R  
Sbjct: 14  LLIALLVAIAVFATVF-TLLPAFSGNQLKSRMKSVALERDELRAKQRARLATEADRRRKG 72

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           LR   S  +RN V +L+L+  L DE+ + KL+ AGFR +  L   L  RLV+P + L L 
Sbjct: 73  LREEQSVGMRNIVDRLDLRRALADESTLQKLKVAGFRGQNPLTRFLFFRLVLPFVGLALA 132

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           +++IF    L + P  +R+   IL+ Y GF AP V+++N   KR+ SI+ AWPDALDL+L
Sbjct: 133 LVYIFVLGGLPDKPLVIRLFVCILVAYAGFYAPVVYVNNRATKRKQSIQMAWPDALDLML 192

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVESG+S++ ALR+VA++IG QSV L+EE +LT AELS+L  R+ A+EN  +RT ++ V
Sbjct: 193 ICVESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLQERKQAYENLASRTGLESV 252

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R+ +QAL+Q++RYGT +  +LRVL +E+R +R+  AEKKAA+L PKLTVPMI+FFLPVL 
Sbjct: 253 RSVSQALVQAERYGTPVAHALRVLAAESRDQRMNAAEKKAAALPPKLTVPMILFFLPVLF 312

Query: 312 LVIIGPAILSI 322
            +I+GPA + +
Sbjct: 313 AIILGPAGIQV 323


>gi|90419769|ref|ZP_01227678.1| putative Flp pilus assembly protein TadC, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
 gi|90335810|gb|EAS49558.1| putative Flp pilus assembly protein TadC, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
          Length = 332

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 214/313 (68%), Gaps = 3/313 (0%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVERE--ILRKQQITSLQKDSASSR 71
           +A ++  A+++F+   A+ +P L   +L+ RMK+VA+ER+    R++   + + +   S 
Sbjct: 17  VAASLVMAIAVFTTFVAIAMPMLAGNQLKSRMKAVALERDEVRARERARMAAENERGRSG 76

Query: 72  LRTRDSKSLRNFV-KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           LR +DSK + + V ++LNL+  L D+  V+ LR AG+R +  L + L  R V+P++   L
Sbjct: 77  LRQQDSKGVASLVVERLNLRTALADDKTVSSLRNAGYRGQRPLTLFLFARAVLPLLMFAL 136

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            + ++FG   L  +P  +R+   + + YVGF AP  ++ N   KR+ SI RAWPDALDLL
Sbjct: 137 ALFYVFGLGLLDTHPTMMRIAICLGVAYVGFVAPIFFVKNRATKRRLSISRAWPDALDLL 196

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LICVESG SI+ A RRVAE+IG QS+PL+EE++L  AELS+LP+R+VA++N   RT +D 
Sbjct: 197 LICVESGNSIEAAFRRVAEEIGIQSIPLAEELVLVCAELSYLPDRKVAYDNLATRTGLDG 256

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    AL+Q++RYGT +G +LR L  E R +R+  AEKKAA+L PKLTVPMI+FFLPVL
Sbjct: 257 VRTVCTALVQAERYGTPLGTALRTLSQENRDQRMNLAEKKAAALPPKLTVPMIVFFLPVL 316

Query: 311 ILVIIGPAILSII 323
             VIIGPAI+ ++
Sbjct: 317 FAVIIGPAIIKVM 329


>gi|110636326|ref|YP_676534.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287310|gb|ABG65369.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 329

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 208/310 (67%), Gaps = 4/310 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR---L 72
           +A+  ++++F+ I+ VV P  G   L+ RMK+VA+ERE LR +Q   L  ++   R   L
Sbjct: 15  LALLVSIAVFATIFTVV-PVGGGDPLKARMKTVALEREELRAKQRARLAAEAERRRAGGL 73

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R  D  S+R  V +L+L+  L DE+ V  LR AG+R +  L   L  RLV+P   L+L +
Sbjct: 74  RREDRSSMRAIVDQLDLRRALADESTVAMLRTAGYRGQSPLTRFLFFRLVLPPAGLMLAL 133

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            +IF    L      +R+   IL  Y GF  P ++ISN   KR+ SI+ AWPDALDLLLI
Sbjct: 134 FYIFVMGGLAAQSLPIRIFVCILAAYGGFYLPVLYISNQASKRKKSIQLAWPDALDLLLI 193

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVESG+S++QA RRVA++IG QSV L+EE++LT AELSFL  R+ A+EN   RT ++ V+
Sbjct: 194 CVESGVSVEQAFRRVADEIGTQSVALAEELVLTTAELSFLQERRQAYENLAARTGLESVK 253

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           + +QALIQ++RYGT I  +LRVL  E+R  R+  AEKKAA+L PKLTVPMI+FFLPVL  
Sbjct: 254 SVSQALIQAERYGTPISQALRVLADESREARMNAAEKKAAALPPKLTVPMILFFLPVLFA 313

Query: 313 VIIGPAILSI 322
           +I+GPA + +
Sbjct: 314 IILGPAAIQL 323


>gi|118589708|ref|ZP_01547113.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
 gi|118437794|gb|EAV44430.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
          Length = 325

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 213/327 (65%), Gaps = 11/327 (3%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
           D   +++   A+   +++   ++++V+P L    L+ RMKSVA+ER+ LR ++   LQ  
Sbjct: 4   DTLASSQFLAAVLAMIAVTGTVFSLVMPLLSRDTLKSRMKSVAIERDKLRAKERARLQAT 63

Query: 67  SASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
            A ++  LR +    +++ V +LNLK  L D+  V+ LR AG+R    L   LV R+V+P
Sbjct: 64  HADAKASLRNQPKAQMKSLVDRLNLKEALSDQTTVDNLRMAGYRGAAPLYYFLVARIVIP 123

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVIL--IGYVGFCA--PSVWISNLVQKRQSSIK 180
                  + + F     L  P  L   + I   +G  G  A  P++++ N + KR+ +I+
Sbjct: 124 AGIFTFSVAYAF-----LVLPDDLPALSKICFCLGLAGLGAFMPNLYLKNKIDKRKLTIQ 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDL+LICVESG+SI++  RRVAE++G QSV L+EE+ LT AELS+L +R++A+E
Sbjct: 179 RAWPDALDLMLICVESGMSIEEGFRRVAEEVGVQSVELAEELSLTTAELSYLSDRRIAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D V+N   ALIQ++RYGT +G +LR +  +TR +R+  AE+KAASL PKLTV
Sbjct: 239 NLAKRTGVDGVKNVMMALIQAERYGTPVGTALRTMADDTREQRMQMAEQKAASLPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMK 327
           PMI+FFLPVL  +I+GPA++ ++DT +
Sbjct: 299 PMIMFFLPVLFFIIMGPAVIQVMDTFR 325


>gi|114705450|ref|ZP_01438358.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540235|gb|EAU43355.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 328

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 209/316 (66%), Gaps = 2/316 (0%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS-R 71
           E+  ++  ++++F+ + AVV+P L    L+ RMKSVA+ER+ +R ++   L +D      
Sbjct: 13  EVFFSVVLSLAVFASVLAVVLPQLERNRLQSRMKSVAIERDEMRARERARLGRDKGGKPS 72

Query: 72  LRTRDSKS-LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           LR  + +  +   V  LNL+  LVD+  + KLR AGFRS+  L + L +R+ + +     
Sbjct: 73  LRQVEERGFVSRVVTSLNLRKALVDDATIAKLRVAGFRSQRHLTLFLFLRIALALALFAF 132

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             +++ G   L E P  +R+ A +   Y+GF  P +++ N   KRQ+SI+RAWPDALDLL
Sbjct: 133 AALYVLGLGLLAEQPLMMRIVACVGAAYIGFVLPVMYLRNAATKRQASIQRAWPDALDLL 192

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LICVESG SI+ + R+VAE+IG QS+ L+EE++LT AELS+LP R+ A++N   RT ++ 
Sbjct: 193 LICVESGKSIEASFRKVAEEIGIQSIALAEELMLTCAELSYLPERRTAYDNLILRTDLEG 252

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    AL Q++RYGT IG +LR +  E R  R+  AEKKAA+L PKLTVPMI+FFLPVL
Sbjct: 253 VRATMTALTQAERYGTPIGSALRTMAQENRDLRMNAAEKKAAALPPKLTVPMIVFFLPVL 312

Query: 311 ILVIIGPAILSIIDTM 326
           + +I+ PA +S+ID M
Sbjct: 313 MAIILAPAAISMIDAM 328


>gi|220923700|ref|YP_002499002.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948307|gb|ACL58699.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 321

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 205/318 (64%), Gaps = 2/318 (0%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           L   ++L VA   A+S F     V  P L    L  R++ VA E E +R ++   LQ   
Sbjct: 5   LTSHSDLLVAGIAAISAFCACMVVSWPYLVRDPLASRLRQVADETEAIRIRERAKLQAGH 64

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S LRT   K  ++   +LNL     D  +V +LR AG+R +  +   L VRL++P + 
Sbjct: 65  GPS-LRTEPKKLFKDIFDRLNLARQAEDGAVVQRLRMAGYRGQGPVVTFLAVRLIMPFVM 123

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + + ++F   +L + PF L++G  + + Y+G+ AP++++ N + KRQ++I+RAWPDAL
Sbjct: 124 FAVAMFYVFVVLRL-DGPFVLKLGIALAVAYLGYYAPAIFVKNRISKRQTAIRRAWPDAL 182

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLLLICVESG+ ++ A R+VA++IG QS  L+EE+ LT AELS+LP+R+ A+EN   RT 
Sbjct: 183 DLLLICVESGMGVESAFRKVADEIGPQSPELAEELSLTTAELSYLPDRRKAYENLAERTG 242

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D V+    +LIQ+++YGT +G +LRVL  E R  R+ EAEKKAA+L PKLTVPMI+FFL
Sbjct: 243 LDGVKGVVTSLIQAEKYGTPVGQTLRVLAQENRDMRMTEAEKKAAALPPKLTVPMILFFL 302

Query: 308 PVLILVIIGPAILSIIDT 325
           PVL  VII PA + I +T
Sbjct: 303 PVLFAVIITPAAIQIANT 320


>gi|307943150|ref|ZP_07658495.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773946|gb|EFO33162.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 326

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 136/327 (41%), Positives = 212/327 (64%), Gaps = 12/327 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILR---KQQITS 62
           F   D T++  AI   + +   +Y +++P      L+ RMKSVA+ER+ +R   + ++ +
Sbjct: 3   FAGMDFTQVITAIMAMICVSGTLYVLIMPLFERDGLKSRMKSVALERDEIRMRERARLNN 62

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
             KD   S   ++ ++ +++  ++ NL+++L D+ +  +L  AGFR    +    + R+ 
Sbjct: 63  AGKDGRGSLRGSQPTQRMKDLTERFNLQSVLTDKEVKMRLAQAGFRGPGPIYKYALGRVF 122

Query: 123 VPIIFLILGIIW---IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
            P +  ++ + +   + GY  L      L VGA      +G+  P++++ N ++KRQ +I
Sbjct: 123 APPVLFVVSLFYATAVMGYGFLT----GLLVGAAF--AGLGYFVPNIYLQNTIEKRQKAI 176

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
            RAWPDALDL+LICVESG+SI+ A+++VA++IG QS  L+EE+ LT AELS+L +R++AF
Sbjct: 177 GRAWPDALDLMLICVESGMSIEVAMQKVADEIGVQSADLAEELTLTTAELSYLQDRRIAF 236

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN  NRT MD ++N   ALIQ++RYGT +  +LR +  +TR +R+ EAEKKAASL PKLT
Sbjct: 237 ENLGNRTGMDNIKNVVMALIQAERYGTPVAKALRAMSDDTRDQRMQEAEKKAASLPPKLT 296

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTM 326
           VPMI+FFLPVL  VI+ PAIL I+D M
Sbjct: 297 VPMIVFFLPVLFAVIMTPAILQIMDVM 323


>gi|254504440|ref|ZP_05116591.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222440511|gb|EEE47190.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 324

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 204/321 (63%), Gaps = 21/321 (6%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           + +   A    +++   I+++V+P L    L+ RMK+VA+ER+ LR ++   LQ     +
Sbjct: 8   SAQFLAAFLAMIAVTGTIFSLVMPLLSRDTLKSRMKNVALERDKLRAKERARLQTSQGDA 67

Query: 71  R--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           R  LR +    ++NFV +LNLK +L D++  ++LR AG+R    +   L  R+ +P    
Sbjct: 68  RMSLRNQPKAKMKNFVDRLNLKEMLADDSTQDRLRMAGYRGSAPIYYFLTARIAIP---- 123

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA---------PSVWISNLVQKRQSSI 179
             G +++F     L Y F L    +     V FC          P++++ N + KR+  I
Sbjct: 124 --GGLFVFA----LAYAFLLAPNTIPAFSKVLFCIVFSGLGAFFPNIYLKNQIDKRKLGI 177

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +RAWPDALDL+LICVESG+SI+ A ++VAE+IG QSV L+EE+ LT AELS+L  R++A+
Sbjct: 178 QRAWPDALDLMLICVESGMSIEAAFQKVAEEIGAQSVELAEELSLTTAELSYLSERRMAY 237

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN   RT +D V+N   ALIQ++RYGT +G ++R +  +TR+ER+  AE+KAASL PKLT
Sbjct: 238 ENLAKRTGVDGVKNVMMALIQAERYGTPVGTAIRNMADDTRAERMQFAEQKAASLPPKLT 297

Query: 300 VPMIIFFLPVLILVIIGPAIL 320
           VPMI+FFLPVL  VI+ PA++
Sbjct: 298 VPMIMFFLPVLFFVILTPAVI 318


>gi|254473723|ref|ZP_05087118.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957109|gb|EEA92314.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 324

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 203/307 (66%), Gaps = 3/307 (0%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LRTR 75
           + T +++   ++A++ P     +L+ RMKSVA+ER+ +R ++   L ++  + R  LR+ 
Sbjct: 15  VLTLIAVSGTVFALLSPLFERDDLKSRMKSVALERDKIRSRERNRLAQEKENQRVSLRSN 74

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +R FV K +LK +L  +N+  KL+ AG+R    L   L +++++P+ F      ++
Sbjct: 75  PKDGVREFVDKYDLKKLLSSDNVAKKLKMAGYRGVSPLYTYLFLQIILPVAFFAASFFYL 134

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
               +L + PF   V   + +  +GF  PS+ + N V KRQ SI+ AWPDA+DL+LICVE
Sbjct: 135 VVILQL-DIPFAGVVACSLGVAAIGFYGPSIIVQNKVMKRQESIRLAWPDAMDLMLICVE 193

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG+SI+ A ++VAE++G QS  L+EE++L  AELS+L  R+ A++N   RT +D V+N  
Sbjct: 194 SGMSIEAAFKKVAEEVGPQSTALAEELILANAELSYLDERRKAYQNLAERTGLDGVKNVV 253

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            AL Q+++YGT IG +LRVL  E+R ER+ EAE+KAA+L PKLTVPM++FFLPVL +V+I
Sbjct: 254 VALSQAEKYGTPIGYALRVLSEESRQERMQEAERKAAALPPKLTVPMMLFFLPVLFIVLI 313

Query: 316 GPAILSI 322
            PA++ +
Sbjct: 314 APAVIKV 320


>gi|188581665|ref|YP_001925110.1| type II secretion system protein [Methylobacterium populi BJ001]
 gi|179345163|gb|ACB80575.1| type II secretion system protein [Methylobacterium populi BJ001]
          Length = 323

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 202/316 (63%), Gaps = 8/316 (2%)

Query: 7   DLFDATELA----VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
           D F A  LA     A+ T ++  + ++ +V P L   +L KRMK V+ ERE +R+++   
Sbjct: 3   DEFVAIALAPRTVAAVLTGIAAAATVFTLVQPLLEGDQLAKRMKLVSDEREQIRQRERER 62

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           L   ++   LR      ++  V++ NL   L  E    KL  AG+R   +    L  RLV
Sbjct: 63  LNSRAS---LRVEPKAYMKRVVEQFNLSRWLGTETAKAKLVRAGYRGGGAETAFLFFRLV 119

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           +PI    + + ++F  + +L+ P  +R G V+  G+ GF  P V++SN+  KRQ+ I+RA
Sbjct: 120 MPIAVTAVALFYLFLLE-VLDQPLMVRAGLVLAAGFFGFKLPEVYLSNMTTKRQAEIRRA 178

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           WPDALDL LICVESG+S++ A RRV+ +I  QS  L+EE+ L  AELSFLP R+VA+EN 
Sbjct: 179 WPDALDLCLICVESGMSVENAFRRVSLEIASQSTVLAEELALLTAELSFLPERRVAYENL 238

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT ++ V++ T AL+Q++RYGT +G +LRVL  E+R  R+ EAEKKAA+L PKLTVPM
Sbjct: 239 ALRTGLESVKSLTTALMQAERYGTPVGQALRVLAQESRDFRMTEAEKKAAALPPKLTVPM 298

Query: 303 IIFFLPVLILVIIGPA 318
           I+FFLPVL +V++ PA
Sbjct: 299 ILFFLPVLFVVLLTPA 314


>gi|304392379|ref|ZP_07374320.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295483|gb|EFL89842.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 328

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 200/322 (62%), Gaps = 7/322 (2%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            FD+    +  +A+T  ++ F+   ++ +P L    LE RMKSVA+ER+ LR ++   +Q
Sbjct: 1   MFDIITQPQNLIAMTVTLACFATALSIAMPLLAKDPLEGRMKSVALERDKLRARERAKIQ 60

Query: 65  KDSASSRLRTRDSKSLRN-----FVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            D   +  R    K+  N      V+KLNL+  L DEN    L  AG+R    L I L +
Sbjct: 61  ADKQKAGQRVGAKKAEANSAITGLVEKLNLRTALADENTEAMLVHAGYRGSKPLFIFLAL 120

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI-GYVGFCAPSVWISNLVQKRQSS 178
           R  +P++FL L  I++    +  E    + +G   L+ G +GF  P + +   ++ RQ S
Sbjct: 121 RFALPLVFLALTAIYLLFLSERTEGD-TMTIGIKCLVAGAIGFYLPILVVKQKMKARQLS 179

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I ++WPDALDL LICVESG+SI+ A R+VA +IG QS PL+EE+++T AELSFL  R+ A
Sbjct: 180 ISQSWPDALDLSLICVESGMSIEVAFRKVASEIGAQSPPLAEELMITTAELSFLQERKHA 239

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           ++N   RT ++ V+N   +L+QS++YGT +  +LRVL  E R  R+  AEKKAA LGPKL
Sbjct: 240 YDNLVYRTGLESVKNVVLSLVQSEKYGTPLSVALRVLSQENRDTRMAMAEKKAAGLGPKL 299

Query: 299 TVPMIIFFLPVLILVIIGPAIL 320
           TVPM+I FLPVL  VI+GPA++
Sbjct: 300 TVPMMICFLPVLFCVILGPAVI 321


>gi|329847258|ref|ZP_08262286.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842321|gb|EGF91890.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 343

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 202/322 (62%), Gaps = 11/322 (3%)

Query: 12  TELAVAITT-----AVSIFSLIYAVVI---PSLGSGE-LEKRMKSVAVEREILRKQQITS 62
           TE A  I       A+++  L++  VI    S+ SGE L+KR+K+VA  RE LR+Q    
Sbjct: 2   TEFASTIMNPSNLIAIAVAVLVFFTVITLGKSMTSGEQLDKRLKAVAQRREELRRQSRQQ 61

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           + K+  S  LR +D    R FV K NL+ +L D  +   L  AGFR    ++     R +
Sbjct: 62  IVKEQ-SGGLRHKDDGMARGFVDKFNLRKLLEDPKVAENLAMAGFRGPKPISTFYFFRFL 120

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           +P +   L   +IF  +   +    +++   + +   G+ AP+++ISN   KR+ SI  A
Sbjct: 121 MPFVLGALATFYIFVVNDFGQ-KMNMKILICVAMFVAGYYAPNIYISNTASKRRQSIVAA 179

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALDLLLICVE+G+SI+ AL +V+++IGG S+PL+EEM L +AELS+LP R+ A+E F
Sbjct: 180 FPDALDLLLICVEAGMSIETALHKVSQEIGGTSIPLAEEMSLLVAELSYLPERRQAYEGF 239

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT    +++   A+IQ+++YGT +G +LRV+  E R  RL  AEKKAA+L  +LTVPM
Sbjct: 240 SKRTSHPGIKSVCTAMIQAEKYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTVPM 299

Query: 303 IIFFLPVLILVIIGPAILSIID 324
           I+FFLPVL +VI+GPA L +ID
Sbjct: 300 IVFFLPVLFVVILGPAALKVID 321


>gi|300021859|ref|YP_003754470.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523680|gb|ADJ22149.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 201/318 (63%), Gaps = 12/318 (3%)

Query: 2   PHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
           PH     F AT LA     AV +F+ + ++ +P L   ++ +RMK +AVER  +R  ++ 
Sbjct: 11  PH-----FVATMLA-----AVCVFATVLSIALPMLQRDQMNRRMKEMAVERGKMRSARLA 60

Query: 62  SL-QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            +  KD  S++LR      ++  V +L L+    ++ I   L+ AG R + ++   L  R
Sbjct: 61  EMSSKDRPSNKLRPTAKGFMQRIVDELKLRERFDNDEIRENLKRAGLRGQANIVTFLFFR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +  PII   L + ++F        P  + VG  +  G++GF  P+V+ISN VQKRQ+SIK
Sbjct: 121 VAAPIIIFFLALFYVFVLYDTGHAPI-VNVGIALGAGFLGFYLPNVFISNRVQKRQTSIK 179

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           +A+PDALD+LLICV+SG+S++ A  +V ++I  QS+ L+EEM LT AELS+L +R+ A+E
Sbjct: 180 QAFPDALDMLLICVQSGMSVEAAFAKVGKEIANQSIELAEEMALTTAELSYLQDRRQAYE 239

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +  V+    AL+Q++RYGT +G +LR +  E R  R  EAE+KA++L PKLTV
Sbjct: 240 NLAKRTGLPGVKGVATALVQAERYGTPVGQALRTMAKENREIRQSEAERKASALPPKLTV 299

Query: 301 PMIIFFLPVLILVIIGPA 318
           PMI+FFLPVL +VI+GPA
Sbjct: 300 PMIVFFLPVLFIVILGPA 317


>gi|83859362|ref|ZP_00952883.1| hypothetical protein OA2633_13195 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852809|gb|EAP90662.1| hypothetical protein OA2633_13195 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 326

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 202/308 (65%), Gaps = 4/308 (1%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LRT 74
           A+  A  +F+ ++ +  P++G   L KRMK+VA  RE LR++    L+K +   +  LR 
Sbjct: 16  AVIAAGLVFATVWTLSAPAMGGDNLNKRMKAVANRREELRRKAREELEKSANEKKGGLRG 75

Query: 75  RDSKSL-RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +D++SL R  V+KLNL  +L D N+  KL  AG+R +  +      R  +P +  +LG +
Sbjct: 76  KDTRSLYRKVVEKLNLATLLEDANLKTKLIQAGYRGQGPVYAFYFARFAIPPVMGLLGFV 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +++  +     P   R+  V+++  +G+ AP +++SN   KR+ SI +A+PD+LDL+LIC
Sbjct: 136 YLWVVNDF-GLPVMQRLTIVMVLAVLGYYAPGIYLSNQAAKRRDSIMQAFPDSLDLMLIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+SI+ AL +VA +IG  S+ L+EE+ LT AEL++L +R+ AFEN   RT +  V+ 
Sbjct: 195 VEAGMSIEAALHKVAAEIGTNSMELAEELSLTNAELAYLQDRRAAFENLGMRTNLPGVKA 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              ALIQ++RYGT +G +LRV+  E R  R+  AEKKAA+L  KLTVPMI+FFLPVL +V
Sbjct: 255 VATALIQAERYGTPLGQALRVMAKENRDMRMSNAEKKAAALPAKLTVPMILFFLPVLFVV 314

Query: 314 IIGPAILS 321
           IIGPA +S
Sbjct: 315 IIGPAAIS 322


>gi|163851908|ref|YP_001639951.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|218530659|ref|YP_002421475.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|240139031|ref|YP_002963506.1| hypothetical protein MexAM1_META1p2450 [Methylobacterium extorquens
           AM1]
 gi|254561626|ref|YP_003068721.1| hypothetical protein METDI3213 [Methylobacterium extorquens DM4]
 gi|163663513|gb|ABY30880.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|218522962|gb|ACK83547.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|240009003|gb|ACS40229.1| conserved hypothetical protein; putative membrane protein
           [Methylobacterium extorquens AM1]
 gi|254268904|emb|CAX24865.1| conserved hypothetical protein; putative membrane protein
           [Methylobacterium extorquens DM4]
          Length = 323

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 192/294 (65%), Gaps = 4/294 (1%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P +    L KRMK V+ ERE +R+++   L   ++ + LR      ++  V++ NL   L
Sbjct: 34  PLIEGDPLAKRMKLVSDEREQIRQRERERL---NSRTTLRAEPKAYMKRVVEQFNLGRWL 90

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             E    KL  AG+R   +    L  RLV+PI    + + ++F  + +L+ PF +R+G V
Sbjct: 91  GTETAKAKLIRAGYRGAGAETAFLFFRLVMPITLTAVALFYLFVLE-VLDQPFVIRLGLV 149

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
              G+ G   P V++SN+  KRQ+ I+RAWPDALDL LICVESG+S++ A RRV+ ++  
Sbjct: 150 FAAGFFGLKLPEVYLSNITSKRQAEIRRAWPDALDLCLICVESGMSVENAFRRVSLEVAS 209

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           QS  L+EE+ L  AELSFLP R+VA+EN   RT ++ V++ T AL+Q++RYGT +G +LR
Sbjct: 210 QSAVLAEELALLTAELSFLPERRVAYENLALRTGLEIVKSLTTALMQAERYGTPVGQALR 269

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           VL  E+R  R+ EAEKKAASL PKLTVPMI+FFLPVL +V++ PA + + + MK
Sbjct: 270 VLAQESRDYRMTEAEKKAASLPPKLTVPMILFFLPVLFVVLLTPAGIQVYEAMK 323


>gi|315497460|ref|YP_004086264.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415472|gb|ADU12113.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 136/326 (41%), Positives = 207/326 (63%), Gaps = 3/326 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M    F L     L +A+  A+  F  +  ++  SL   +L+KRMK+VA  RE LR+Q  
Sbjct: 1   MKELAFTLMQPANL-IALVVAILAFLAVLTLLRSSLSGEQLDKRMKAVAQRREELRRQSR 59

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            S+ + S +S LR  D    +  V +LNLK +L D  +V+KL  AGFR    +      R
Sbjct: 60  QSMVQAS-NSGLRQTDESLYKRIVDRLNLKTLLEDPKVVDKLAMAGFRGPKPITTFYFFR 118

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
            ++P +   L   +I+  +   + P  +++   + +   G+ AP+++ISN   KR++SI 
Sbjct: 119 FLMPFVMGALSTFYIYVVNDFGQPP-NIKILICVAMFVAGYYAPNIYISNAASKRRASIV 177

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
            A+PDALDLLLICVE+G+SI+ AL++V+++IG  S+ L+EE+ L +AELS+LP R++A+E
Sbjct: 178 TAFPDALDLLLICVEAGMSIEAALQKVSQEIGSASIELAEELSLLVAELSYLPERRMAYE 237

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               RT    +++   A+IQ+++YGT +G +LRV+  E R  RL  AEKKAA+L  +LTV
Sbjct: 238 GLARRTNYPGIKSVCTAMIQAEKYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTV 297

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLPVL +VI+GPAIL+I+D M
Sbjct: 298 PMIVFFLPVLFVVILGPAILNIMDMM 323


>gi|114798130|ref|YP_761686.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738304|gb|ABI76429.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 191/310 (61%), Gaps = 15/310 (4%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
           F     + +P L   +LE R+K+VA +RE LRKQ   +L+K      LR +D   + +  
Sbjct: 24  FGTFMTIFLPYLQGNKLETRLKAVASQREKLRKQSRAALEKKG----LRRKDDSVVGSIS 79

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF-----GYD 139
            KLNL   L D N+V  +  AG R    ++     R+ +P     L   +IF     G  
Sbjct: 80  SKLNLAQALEDPNVVKLMNQAGLRGPGPISAFYFARMAMPFAGAGLMFFYIFFVNDHGLS 139

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
           + ++Y      G+VI     GF AP+++ISNL QKRQ S+ RA+PDALD+LLICVE+G+S
Sbjct: 140 QFMKY------GSVIFGAAAGFYAPNLYISNLAQKRQKSLMRAFPDALDMLLICVEAGMS 193

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           I+    +V+++IG  S  L+EE  +T+AELS+LP+R++A+EN   RT  + V+    AL 
Sbjct: 194 IEMGFNKVSQEIGSASPELAEEFGITVAELSYLPDRRLAYENLALRTGHEGVKAVCMALG 253

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q++RYGT +GD+LR++  E R  R+ EAEKKAASL  KLTVPMI+FFLPVL LV++GPA 
Sbjct: 254 QAERYGTPLGDALRMMAKENREMRMSEAEKKAASLPAKLTVPMILFFLPVLFLVVLGPAY 313

Query: 320 LSIIDTMKDH 329
           +      K++
Sbjct: 314 IQYQAMQKEN 323


>gi|148258240|ref|YP_001242825.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146410413|gb|ABQ38919.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 324

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 135/316 (42%), Positives = 195/316 (61%), Gaps = 12/316 (3%)

Query: 2   PHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
           PH+   LF           A++  + +Y +++P      L KRMK+VA ERE +++++  
Sbjct: 12  PHFMTMLF----------AAIAASATVYTLIMPLFAGENLNKRMKAVASERERIKQRERE 61

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
            +      S LR    + +   V   NL   L  E    KL  AG+R +      L  RL
Sbjct: 62  RMNAGEKVS-LRQTPKQLVAKVVDDFNLTKWLAQEAAREKLIMAGYRGQAPYITFLFARL 120

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           V P++  +  ++++F    L +    +++G  I + Y+G  AP +++SN + KRQ SIKR
Sbjct: 121 VTPVVLFVGSVLYVFVIANL-QKSLPIKIGICIGMAYLGLQAPMLFLSNAISKRQLSIKR 179

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PDALDLLLIC+ESG+SI+ A R+V+ +I  QS+ LSEE  LT AELS+L +R+VA+EN
Sbjct: 180 AFPDALDLLLICIESGMSIEAAFRKVSMEIASQSIALSEEFTLTTAELSYLQDRKVAYEN 239

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTVP
Sbjct: 240 LARRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTVP 299

Query: 302 MIIFFLPVLILVIIGP 317
           MI+FFLPVL +VI+GP
Sbjct: 300 MILFFLPVLFVVILGP 315


>gi|115525754|ref|YP_782665.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519701|gb|ABJ07685.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
          Length = 324

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 201/317 (63%), Gaps = 2/317 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M +   D F      + +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++ 
Sbjct: 1   MFNLLIDKFHDPRFMMMLFAAIAASATVYTLITPLFANEGLNKRMKTVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+  NL   +  EN   KL  AG+R +      L  R
Sbjct: 61  DRLAKTERVS-LRQSPKRLVAKVVEDFNLGKWVAQENARQKLLMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V P+IFL+   +++F   K+   P  L++   I   ++G  AP ++++N + KRQ SIK
Sbjct: 120 MVTPLIFLVATALYVFLVAKM-NQPTALKIAICIAATFLGMQAPMLFLTNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLICVESG+SI+ A R+V+ +IG QS+PL+EE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICVESGMSIEVAFRKVSVEIGTQSIPLAEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAKRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGP 317
           PMI+FFLPVL +VI+GP
Sbjct: 299 PMILFFLPVLFVVILGP 315


>gi|146338118|ref|YP_001203166.1| putative pilus assembly protein membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146190924|emb|CAL74929.1| putative pilus assembly protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 194/316 (61%), Gaps = 12/316 (3%)

Query: 2   PHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
           PH+    F           A++  + +Y +++P      L KRMK+VA ERE +++++  
Sbjct: 12  PHFMTMFF----------AAIAASATVYTLIMPLFAGENLNKRMKAVASERERIKQRERE 61

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
            L      S LR    + +   V   NL   L  E   +KL  AG+R +      L  RL
Sbjct: 62  RLNAGEKVS-LRQTPKQLVAKVVDDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFGRL 120

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           V P++     ++++F    L E    +++G  + + Y+G  AP +++SN + KRQ SI+R
Sbjct: 121 VTPVVLFAGSVLYVFVIAHL-EKSMPVKIGICVGMAYLGLQAPMLFLSNAISKRQLSIRR 179

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PDALDLLLIC+ESG+SI+ A RRVA +I  QS+ LSEE  LT AELS+L +R+VA+EN
Sbjct: 180 AFPDALDLLLICIESGMSIEAAFRRVAIEISSQSIALSEEFTLTTAELSYLQDRKVAYEN 239

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTVP
Sbjct: 240 LARRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTVP 299

Query: 302 MIIFFLPVLILVIIGP 317
           MI+FFLPVL +VI+GP
Sbjct: 300 MILFFLPVLFVVILGP 315


>gi|167648147|ref|YP_001685810.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350577|gb|ABZ73312.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 328

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 200/320 (62%), Gaps = 2/320 (0%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
           +L D T L  A   A+ +F+ I  +  P L S  LE R+KSVA  RE LR++   ++ + 
Sbjct: 4   ELTDPTNLLSAFI-AIVVFATIVTLAAPMLSSNGLEGRLKSVANRREELRRRSREAMSQK 62

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
                LR  D    +N V +L L  +L D  +V+KL  AGFR    ++     R V+P  
Sbjct: 63  GGGGTLRHADEGMYKNVVDRLQLSRLLEDPKVVDKLAQAGFRGPKPVSTFYFFRFVMPFA 122

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
           F ++   +++  +     P Q ++ A      VG+ AP+++ISN+ QKR+ SI  A+PDA
Sbjct: 123 FALVAAFYLYVINGFGLLPVQ-KIAACFFALTVGYYAPNIYISNIAQKRRESIVAAFPDA 181

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LDL+LICVESG+SI+ A+ +V  ++GG S+ L+EE+ L  AELS+LP R++A+E    RT
Sbjct: 182 LDLMLICVESGMSIEAAIAKVGAEVGGASIELAEELSLLTAELSYLPERRLAYEGLARRT 241

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
               +R+   A+IQ++RYGT +G +LRV+  E R  RL  AEKKAA+L  KLTVPMI+FF
Sbjct: 242 NHPGIRSVVTAMIQAERYGTPLGAALRVMAKENRDLRLSAAEKKAAALPAKLTVPMILFF 301

Query: 307 LPVLILVIIGPAILSIIDTM 326
           LPVL +VI+GPA ++I+D +
Sbjct: 302 LPVLFIVIMGPAAINIMDAI 321


>gi|154250694|ref|YP_001411518.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154644|gb|ABS61861.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 322

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/308 (41%), Positives = 195/308 (63%), Gaps = 3/308 (0%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  V + TAV+ F+ I+ +  P L + +L  RMK V+ ERE +R +   +L ++   +RL
Sbjct: 12  ENVVTLLTAVAAFATIFTLTAPLLNTDKLSTRMKYVSTEREAMRARAREALAQEK--TRL 69

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R      ++  V+K     +L +  +  KLR AGFR    +   +  R V+P +  ++ +
Sbjct: 70  RHTPKGFIKQVVEKFASGNMLENAAVKEKLRQAGFRGPGPMYTFVFFRFVMPPVLFVVTL 129

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +++   +     P   R+       +VGF  P++++ N++ +RQ SI++A+PDALDL+LI
Sbjct: 130 LYMVFVNDFGLQPMA-RLAVSCAAAFVGFYLPNLFVENVISRRQDSIRKAFPDALDLMLI 188

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVESG+SI+ A ++VA +IG QSV L+EE+ LT AELS+L  R++A+EN   RT +  V+
Sbjct: 189 CVESGMSIEAAFQKVAAEIGAQSVELAEELGLTTAELSYLQERRMAYENLARRTGLPGVK 248

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                LIQ++RYGT +G +LRV+  E R  R+ EAEKKAA L PKLTVPMI+FFLPVL  
Sbjct: 249 AVATTLIQAERYGTPLGQALRVMAQENRDMRMAEAEKKAAGLPPKLTVPMILFFLPVLFG 308

Query: 313 VIIGPAIL 320
           VI+GPAI+
Sbjct: 309 VILGPAII 316


>gi|110632959|ref|YP_673167.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283943|gb|ABG62002.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 323

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 190/306 (62%), Gaps = 1/306 (0%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+  AV+ FS +  V  P L    L +RM  V  ERE+LRKQ+   L        LR+  
Sbjct: 15  ALMAAVAAFSSVIVVSWPYLFRDNLARRMAKVENERELLRKQERARLAMQKRLPSLRSEP 74

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
            K  +  V +  L     +  +V++LR AG+R    +   L VRL+ PI    + + ++ 
Sbjct: 75  RKLFKQIVDRFKLAKQGDNGQLVDRLRRAGYRGNAPVITFLAVRLIAPIAIFAVSLTYVL 134

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
              K  + P    +G    +G  G+  P+++I N + KRQ +I+RAWP+ALDLLLICVES
Sbjct: 135 LILKP-DLPLFAILGIAAALGGFGYFVPALYIRNKITKRQKAIQRAWPEALDLLLICVES 193

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+SI+ A R+VAE+IG QS  ++EE+ LT AELSFL +R+ A+EN   RT ++ VR A  
Sbjct: 194 GMSIESAFRKVAEEIGTQSAEIAEEIALTTAELSFLQDRRQAYENLGRRTGVEGVRAAVT 253

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPVL  VII 
Sbjct: 254 SLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMIVFFLPVLFAVIIT 313

Query: 317 PAILSI 322
           PA + I
Sbjct: 314 PAAIQI 319


>gi|170740616|ref|YP_001769271.1| type II secretion system protein [Methylobacterium sp. 4-46]
 gi|168194890|gb|ACA16837.1| type II secretion system protein [Methylobacterium sp. 4-46]
          Length = 321

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 130/289 (44%), Positives = 189/289 (65%), Gaps = 4/289 (1%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P L    L +RMKSV  ER+ +R ++   L +      LR +    ++  V++  L   L
Sbjct: 33  PFLEPNRLAQRMKSVGEERDRIRLRERDRLNQ---RGNLRQQPKAYMKRVVERFKLDNWL 89

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             E+  N+L  AG+R   +    L  RLV+P+ FL+L + ++F   ++L  PF +R+  V
Sbjct: 90  ATEDAKNRLMMAGYRGPQAETAFLFFRLVMPLGFLVLAVFYLFVL-QVLNQPFSIRLLIV 148

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           I   Y G  AP +++ N   KRQ+ I++ WPDALDLLLICVESG++I+ A RRV  ++  
Sbjct: 149 IAATYGGVKAPEIFLKNQTDKRQAQIRKNWPDALDLLLICVESGMAIELAFRRVGVEMAN 208

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           QS+ L+EE+ LT AELS+L +R+VA++N   RT +D V+    ALIQ++RYGT IG +LR
Sbjct: 209 QSIVLAEELALTTAELSYLTDRRVAYDNLAIRTGLDSVKAVCTALIQAERYGTPIGQALR 268

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           VL  E+R +R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+ PA++ +
Sbjct: 269 VLAQESRDQRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILTPAMVQV 317


>gi|209886535|ref|YP_002290392.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874731|gb|ACI94527.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 193/294 (65%), Gaps = 2/294 (0%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P      L +RMK+VA ERE +R+++   + ++   + LR    + ++  V++ NL   L
Sbjct: 34  PMFAGDGLARRMKAVASERERMRQRERERMNRNEKVT-LRQSPKQVVQRVVERFNLGKWL 92

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             E    KL  AG+R        L  RLV P++FLI   ++IF    L E    +++G  
Sbjct: 93  AQEEAKEKLIMAGYRGHAPYVTFLFFRLVAPVVFLIATALYIFVILNL-EQTMTIKIGIC 151

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           IL  ++G  AP +++ N + KRQ SIKRA+PDALDLLLICVESG+SI+ A R+V+ +IG 
Sbjct: 152 ILAAWLGMQAPMLFLKNAISKRQLSIKRAFPDALDLLLICVESGMSIEAAFRKVSVEIGS 211

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           QSVPL+EE+ LT AELS+L +R++A+EN   RT ++ V++   AL+QS+RYGT +G +LR
Sbjct: 212 QSVPLAEELTLTTAELSYLQDRKMAYENLQKRTGLEGVKSVCMALMQSERYGTPLGQTLR 271

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           V+  E R  R+ EAEKKAASL PKLTVPMI+FFLPVL +VI+GP  + +   MK
Sbjct: 272 VMAQENRDMRMNEAEKKAASLPPKLTVPMIVFFLPVLFVVILGPTWIKVAAYMK 325


>gi|27376545|ref|NP_768074.1| pilus assemble protein [Bradyrhizobium japonicum USDA 110]
 gi|27349686|dbj|BAC46699.1| pilus assemble protein [Bradyrhizobium japonicum USDA 110]
          Length = 324

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 194/302 (64%), Gaps = 2/302 (0%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           A++  + +Y +V+P      L KRMK+VA ERE +R+++   L K    S LR    + +
Sbjct: 21  AIAASATVYTLVMPLFAGEGLSKRMKAVASERERIRQRERERLNKSEKVS-LRQTPKQLV 79

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
              V+  NL   L  E   +KL  AG+R +      L  R+V PI   +  ++++F    
Sbjct: 80  SKVVEDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFARMVAPITLFVGSVLYVFLIAH 139

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
           + E P  +++G  I   Y+G  AP +++ N + KRQ SIKRA+PDALDLLLIC+ESG+S+
Sbjct: 140 M-EKPVPVKIGICIGAAYLGLQAPMLFLKNAISKRQLSIKRAFPDALDLLLICIESGMSV 198

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           + A R+VA +I GQS+ LSEE  LT AELS+L +R+VA+EN   RT ++ V++   AL Q
Sbjct: 199 EMAFRKVATEIVGQSIALSEEFTLTTAELSYLQDRKVAYENLARRTGLEGVKSVCLALQQ 258

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           ++RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+GP  +
Sbjct: 259 AERYGTPLGHSLRVMAQENRDMRMTEAEKKAAALPPKLTVPMILFFLPVLFVVILGPTGI 318

Query: 321 SI 322
            I
Sbjct: 319 KI 320


>gi|85713510|ref|ZP_01044500.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699414|gb|EAQ37281.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 325

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 197/318 (61%), Gaps = 2/318 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
           F   +    +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++   L K   
Sbjct: 9   FHDPQFMTMVLAAIAASATVYTLITPFFAADGLTKRMKAVASERERIRQRERERLSKSEK 68

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S LR    + +   V+ LNL   +  E    KL  AG+R +      L  R+V PI+ L
Sbjct: 69  VS-LRQAPKQFVSKIVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFRMVTPIVML 127

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I  I ++F      + P  +++G  I   + G  AP +++ N + KRQ SIKRA+PDALD
Sbjct: 128 IGAIAYVFLLSHT-QQPTHVKIGICIGATFFGLQAPMLFLKNAITKRQLSIKRAFPDALD 186

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LLLIC+ESG+SI+ A R+V+ +IG QSV L+EE  LT AELS+L +R++A+EN  NRT +
Sbjct: 187 LLLICLESGMSIEVAFRKVSTEIGNQSVALAEEFTLTTAELSYLQDRKIAYENLANRTGV 246

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLP
Sbjct: 247 EGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTVPMIVFFLP 306

Query: 309 VLILVIIGPAILSIIDTM 326
           VL +VI+GP  + I   M
Sbjct: 307 VLFVVILGPTGIKIAAQM 324


>gi|295690793|ref|YP_003594486.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432696|gb|ADG11868.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 327

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL-QKDSASSRLRTRDSKS 79
           AV +F+ I  +  P +    LE R+KSVA  RE LR++   +L Q+  A   LR +D   
Sbjct: 19  AVVVFATIITLASPLMRDNGLEGRLKSVANRREELRRRSREALAQRHGAPGTLRHQDEGL 78

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
            +  V++L L  +L D  +V+KL  AGFR    +      R V P +F  +   +++G +
Sbjct: 79  YKKVVERLQLSRLLEDPKVVDKLAQAGFRGPRPVTTFYFFRFVAPFVFAAVVAAYLYGVN 138

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                P Q     V  + + G+ AP+V+I+N+ QKR+ SI  A+PD+LDLLLICVESG+S
Sbjct: 139 DFGLLPIQKLCACVAALAF-GYYAPNVYITNIAQKRRESIVAAFPDSLDLLLICVESGMS 197

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           ++ A+++V+ +IG QS+ L+EE+ L  AELS+LP R+ A+EN   RT    V++   A+I
Sbjct: 198 VEAAIQKVSSEIGAQSMELAEELSLLTAELSYLPERRQAYENLARRTNHPGVKSVATAMI 257

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q++RYGT +G +LRV+  E R  RL  AEKKA +L  KLTVPMI+FFLPVL +VI+GPAI
Sbjct: 258 QAERYGTPLGAALRVMAKENRELRLSSAEKKATALPAKLTVPMILFFLPVLFIVILGPAI 317

Query: 320 LSIIDTMKDH 329
           + + D    H
Sbjct: 318 IKVQDVFAKH 327


>gi|329890992|ref|ZP_08269335.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846293|gb|EGF95857.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 330

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 204/316 (64%), Gaps = 6/316 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRK---QQITSLQKDSASSR 71
           ++I   V++F+ +  ++   +G G  L+KRMK+VA  RE LR+   Q +     + ASS 
Sbjct: 15  LSIGVGVAVFASVLTLLSSFVGGGARLDKRMKAVAERREELRRRSRQAMRGGAGNEASSL 74

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
            RT DS   R  V +LNL  +L D  + + +  AGFR    LN     R   P I + L 
Sbjct: 75  RRTDDSFRSR-VVARLNLMKLLEDPKVADNMIQAGFRGPGPLNTFYFFRFATPFILMALT 133

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
             ++F   K  + P   +V  V++   VGF AP++++ N++ KR++SI  A+PD+LDLLL
Sbjct: 134 AFYLFVVVKP-DLPMMTQVAMVVMAAGVGFYAPNIYLKNMIDKRRASIMAAFPDSLDLLL 192

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVESG+SI+ A+++V++++GGQS+ L+EE+ L  AELS+LP+R++A+E    RTQ   +
Sbjct: 193 ICVESGMSIEAAIQKVSQEVGGQSIELAEELSLLSAELSYLPDRRMAYEGMAKRTQHPGI 252

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +    A+ Q++ YGT +G +LRV+  E R  RL  AEKKAA+L  KLTVPMI+FFLPVL 
Sbjct: 253 KAVATAMTQAETYGTPLGSALRVMAKENRELRLSAAEKKAAALPAKLTVPMILFFLPVLF 312

Query: 312 LVIIGPAILSIIDTMK 327
           +VI+GPAI++I D MK
Sbjct: 313 VVILGPAIINIQDMMK 328


>gi|39936745|ref|NP_949021.1| type II secretion system protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292571|ref|YP_001993176.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
 gi|39650601|emb|CAE29124.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192286320|gb|ACF02701.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
          Length = 324

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 198/320 (61%), Gaps = 8/320 (2%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +  + F        +  A++  + +Y +VIP      L KRMK+V  ERE LR+++ 
Sbjct: 1   MLDFLIEKFHDARFMATLLAAIAASATVYTLVIPFFVGETLAKRMKAVGSERERLRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    K +   V+  NL   L  E+  +KL  AG+R +      L  R
Sbjct: 61  DRLAKAEKVS-LRQAPKKFVARVVEDFNLAKWLAQESARDKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIF---GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
           +V+PI F     +++F    +D+    P  +++G  +   + G  AP +++ N +QKRQ 
Sbjct: 120 MVMPIAFGAASALYVFVIANFDQ----PLTIKIGMCVAAIFFGMQAPMLFLKNAIQKRQL 175

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           SIKRA+PDALDLLLIC+ESG+SI+ A RRV+ +IG QS+PL+EE  LT AELS+L +R+ 
Sbjct: 176 SIKRAFPDALDLLLICIESGMSIETAFRRVSIEIGSQSIPLAEEFTLTTAELSYLQDRKQ 235

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           A+EN   RT +D V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PK
Sbjct: 236 AYENLALRTGLDGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPK 295

Query: 298 LTVPMIIFFLPVLILVIIGP 317
           LTVPMI+FFLPVL +VI+GP
Sbjct: 296 LTVPMIVFFLPVLFVVILGP 315


>gi|90425202|ref|YP_533572.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107216|gb|ABD89253.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
          Length = 324

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 188/289 (65%), Gaps = 2/289 (0%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
           Y ++ P      L KRMK+VA ERE +R+++   L K    S LR    + +   V+  N
Sbjct: 29  YTLITPLFAGESLSKRMKAVASERERIRQRERDRLSKTERVS-LRQAPKQFVSKVVEDFN 87

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           L   +  E   +KL  AG+R        L  R+V+PI F++   ++IF    + + P  +
Sbjct: 88  LGKWVAQEAARDKLVMAGYRGHAPYVTFLFFRMVMPIAFMLATALYIFVISHM-QQPLGI 146

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           ++   I   ++G  AP ++++N + KRQ SIKRA+PDALDLLLICVESG+SI+ A R+VA
Sbjct: 147 KIAICIAACFLGMQAPMLFLTNAISKRQLSIKRAFPDALDLLLICVESGMSIETAFRKVA 206

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            +IG QS+PL+EE  LT AELS+L +R+VA+EN   RT ++ V++   AL QS+RYGT +
Sbjct: 207 IEIGSQSIPLAEEFTLTTAELSYLQDRKVAYENLAKRTGLEGVKSVCLALQQSERYGTPL 266

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           G SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+GP
Sbjct: 267 GQSLRVMAQENRDMRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILGP 315


>gi|323137430|ref|ZP_08072508.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
 gi|322397417|gb|EFX99940.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
          Length = 323

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 129/310 (41%), Positives = 198/310 (63%), Gaps = 3/310 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           V+I TA+++ + I  + +P L +  L +RMKSV+       +Q+  +L K    + LR  
Sbjct: 15  VSILTAIAVIATILTIAMPLLNTDTLSRRMKSVS-SERERIRQRERALAKTQGKA-LRQE 72

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               ++N V + +L   L  ++   KL +AGFR   +    L  RLV PI FL   + ++
Sbjct: 73  PKFYMKNVVDRFSLSKWLNTDDAKLKLASAGFRGPQAEVAFLFFRLVTPIAFLFFALFYL 132

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           +  D   +    L+   VI   Y+G  AP ++ISN +  RQ+S++RA+PDALDL+LICVE
Sbjct: 133 YFLDDS-DMSSLLKTMIVIGATYLGVKAPELFISNTITNRQTSMRRAFPDALDLMLICVE 191

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG+SI+ A R+V  +IG QS+PL+EE  L  AELS+LP+R+ A+ N   RT ++ V+  +
Sbjct: 192 SGMSIEHAFRKVGSEIGVQSIPLAEEFALATAELSYLPDRRTAYLNLAARTGLESVKQIS 251

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQ+++YGT +G +LR+   E+R  R+MEAEKKAA+L PKLTVPMI+FFLPVL++V++
Sbjct: 252 TVLIQAEKYGTPLGQALRITAQESRDMRMMEAEKKAAALPPKLTVPMIVFFLPVLMVVVL 311

Query: 316 GPAILSIIDT 325
            PA + ++ +
Sbjct: 312 SPAAIQVMQS 321


>gi|316933034|ref|YP_004108016.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
 gi|315600748|gb|ADU43283.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
          Length = 324

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 137/286 (47%), Positives = 187/286 (65%), Gaps = 2/286 (0%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
           V P +    L KRMK+V  ERE +R+++   L K    S LR    K +   V+  NL  
Sbjct: 32  VTPFIVGDTLAKRMKAVGSERERIRQRERDRLAKAEKVS-LRQAPKKFVARVVEDFNLAK 90

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
            L  E+  +KL  AG+R +      L  RLV+P++F +   ++IF    L + P  +++G
Sbjct: 91  WLAQESARDKLVMAGYRGQAPYITFLFFRLVMPVVFGLASALYIFVITDL-QQPLTVKIG 149

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
             I   + G  AP +++ N +QKRQ SIKRA+PDALDLLLIC+ESG+SI+ A RRV+ +I
Sbjct: 150 ICIAAIFFGMQAPMLFLKNAIQKRQLSIKRAFPDALDLLLICIESGMSIEAAFRRVSIEI 209

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G QS+PL+EE  LT AELS+L +R+ A+EN   RT +D V++   AL QS+RYGT +G S
Sbjct: 210 GSQSIPLAEEFTLTTAELSYLQDRKQAYENLAQRTGLDGVKSVCLALQQSERYGTPLGQS 269

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+GP
Sbjct: 270 LRVMAQENRDMRMNEAEKKAAALPPKLTVPMIVFFLPVLFVVILGP 315


>gi|92116008|ref|YP_575737.1| type II secretion system protein [Nitrobacter hamburgensis X14]
 gi|91798902|gb|ABE61277.1| type II secretion system protein [Nitrobacter hamburgensis X14]
          Length = 325

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 195/309 (63%), Gaps = 2/309 (0%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++   L K    S LR    
Sbjct: 18  VLAAIAASATVYTLITPFFAAEGLTKRMKAVASERERIRQRERERLAKSEKVS-LRQAPK 76

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           + +   V+ LNL   +  E    KL  AG+R +      L  R+V PI+ LI  I+++F 
Sbjct: 77  QFVSKVVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFRMVTPIVMLIGAIVYVFL 136

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              + +    +++G  I   + G  AP +++ N + KRQ SIKRA+PDALDLLLIC+ESG
Sbjct: 137 LSHM-QQSTPIKIGICIGAAFFGLQAPMLFLKNAITKRQISIKRAFPDALDLLLICIESG 195

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +SI+ A R+V+ +IG QSV L+EE  LT AELS+L +R+VA+EN   RT ++ V++   A
Sbjct: 196 MSIEVAFRKVSTEIGSQSVALAEEFTLTTAELSYLQDRKVAYENLAKRTGVEGVKSVCLA 255

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+GP
Sbjct: 256 LQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTVPMIVFFLPVLFVVILGP 315

Query: 318 AILSIIDTM 326
             + I   M
Sbjct: 316 TGIKIAAQM 324


>gi|114568975|ref|YP_755655.1| type II secretion system protein [Maricaulis maris MCS10]
 gi|114339437|gb|ABI64717.1| type II secretion system protein [Maricaulis maris MCS10]
          Length = 331

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 191/308 (62%), Gaps = 4/308 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQ--ITSLQKDSASSRLR 73
           +A+  A+ +F+ +  +  P+LGS +L+KR+KSV   RE LR++          +    +R
Sbjct: 20  IAMVAAILVFATVVTLTSPALGSDKLDKRIKSVNNRREELRRKNRAAIDAAAMAGKGTIR 79

Query: 74  TRDSKSL-RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             ++K L R  V+ L+L+    D  +  KL  AG R +         RL+ P I   + +
Sbjct: 80  GAEAKGLVRKVVEALDLQKAFEDPALHEKLAQAGMRGQRPAMTFYFFRLLSPFILFGVAL 139

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            ++F  +     P   RV     +G +G+ AP++++SNL  KRQ SI  A+PD LDLLLI
Sbjct: 140 FYVFMINDF-GLPQITRVCFSFGLGLLGYYAPNLYLSNLAAKRQQSIMGAFPDGLDLLLI 198

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVESG+SI+ A  +V+ ++G QS+ L+EE+ LT AELS+L +R+VA+EN   RT    V+
Sbjct: 199 CVESGMSIEAAFHKVSSEVGSQSIELAEELSLTTAELSYLQDRRVAYENLAKRTNHPGVK 258

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
               +LIQ++RYGT +G +LRV+  E R  RL  AEKKAASL  KLTVPMIIFFLPVL +
Sbjct: 259 AVCTSLIQAERYGTPLGQALRVMAKENRDMRLAAAEKKAASLPAKLTVPMIIFFLPVLFV 318

Query: 313 VIIGPAIL 320
           VI+GPAI+
Sbjct: 319 VILGPAII 326


>gi|150377235|ref|YP_001313830.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150031782|gb|ABR63897.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 321

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 199/315 (63%), Gaps = 3/315 (0%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           DA +LA AI    S FS +  +  P +    L +RM+ V  ERE +R+++   L++ S +
Sbjct: 9   DAEQLA-AIMAGFSAFSAVVVISWPYVFRDTLSERMRKVEGERERIRRRERARLEQKSKT 67

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           S LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P++  +
Sbjct: 68  S-LRVEPKRLFQAIVDRFRLAKQADDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVVIFM 126

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             +++I    +  E P  L V   I  G +G+ AP++++SN + KRQ SI+R+WP+ALDL
Sbjct: 127 ACLLYILLAVRP-EAPLLLVVAMAIATGALGYFAPAIFVSNRITKRQQSIRRSWPEALDL 185

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           LLI VESG+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++
Sbjct: 186 LLITVESGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVE 245

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPV
Sbjct: 246 GVRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKKAAALPPKLTVPMILFFLPV 305

Query: 310 LILVIIGPAILSIID 324
           L  VII PA++ I++
Sbjct: 306 LFAVIITPAVIQIMN 320


>gi|75674494|ref|YP_316915.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
 gi|74419364|gb|ABA03563.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
          Length = 325

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 198/322 (61%), Gaps = 8/322 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
           F   +    +  A++  + +Y ++ P   +  L KRMK+VA ERE +R ++   L +   
Sbjct: 9   FHNPQFMTMVLAAIAASATVYTLITPFFAADGLTKRMKAVASERERIRLRERERLARTEK 68

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S LR    + +   V+ LNL   +  E    KL  AG+R +      L  R+V PI+ L
Sbjct: 69  VS-LRQAPKQFISKIVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFRMVTPIVML 127

Query: 129 ILGIIWIFGYDKLLEYPFQ---LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           I  I ++F    LL +  Q   +++G  I   + G  AP +++ N + KRQ SIKRA+PD
Sbjct: 128 IGAIAYVF----LLSHTQQSTTVKLGICIGATFFGMQAPMLFLHNAITKRQLSIKRAFPD 183

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLLLIC+ESG+SI+ A R+V+ + G QSV L+EE+ LT AELS+L +R+VA+EN  NR
Sbjct: 184 ALDLLLICLESGMSIEVAFRKVSTETGNQSVALAEELTLTTAELSYLQDRKVAYENLANR 243

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+F
Sbjct: 244 TGVEGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTVPMIVF 303

Query: 306 FLPVLILVIIGPAILSIIDTMK 327
           FLPVL +VI+GP  + I   M 
Sbjct: 304 FLPVLFVVILGPTGIKIAAQMH 325


>gi|296444390|ref|ZP_06886355.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
 gi|296258037|gb|EFH05099.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
          Length = 329

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 129/325 (39%), Positives = 199/325 (61%), Gaps = 8/325 (2%)

Query: 6   FDLF----DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVA---VEREILRKQ 58
           FD F        L  ++  AV++ + + ++ +   G   L KRMKSVA          + 
Sbjct: 2   FDTFVQYASNGRLMFSLMIAVAVVATVISIGLTFSGGDRLAKRMKSVASERERIRARERA 61

Query: 59  QITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
              +  K+S    LR +    ++N V + +L   L   +   +L +AG+R   +    L 
Sbjct: 62  AANAKAKESGPKGLRQQPKVYMKNIVDRFSLDTWLNTGDAKMRLASAGYRGPQAEIAFLF 121

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            RLV PI F++ GI +    D   ++   +++G VI   YVG  +P ++++N + KRQ S
Sbjct: 122 FRLVTPIAFVLFGIFYFTVVDDS-DWSLLVKIGVVIFAAYVGVKSPELFLTNAITKRQQS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           ++ A+PDALDL+LICVESG+SI+ A R+V ++IG +SVPL+EE  L  AELS+LP+R+ A
Sbjct: 181 MRIAFPDALDLMLICVESGLSIEHAFRKVGKEIGVRSVPLAEEFALATAELSYLPDRRQA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           F N   RT +DCV+     LIQ+++YGT +G +LRV   E+R  R+ EAE++AA+L PKL
Sbjct: 241 FHNLAARTGLDCVKQICTVLIQAEKYGTPLGRALRVTAQESRDMRMAEAERQAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSII 323
           TVPMI+FFLPVL++V++ PAI+ ++
Sbjct: 301 TVPMIVFFLPVLMVVVMAPAIIQVM 325


>gi|254419878|ref|ZP_05033602.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186055|gb|EDX81031.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 200/311 (64%), Gaps = 2/311 (0%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +++   V +F+ +  ++    G  +L++RMK+V+  R+ L+++   ++       R  T 
Sbjct: 15  LSLGVGVLVFATVLTLLSSMTGGVKLDQRMKAVSERRDELKRRSRAAIHTGPGGLR-HTD 73

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
           D    +  V +LNL  +L D  + +++  AG+R    L      R   P IFL++   ++
Sbjct: 74  DEGFKKRVVDRLNLTKLLEDPKVADQMAQAGYRGPRPLTTFYFFRFASPFIFLMVVAFYM 133

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           F   K++++P   ++ A +     GF AP+++++N + KR++SI +A+PDALDLLLICVE
Sbjct: 134 F-VIKVVDWPTMQKITACVAAAVAGFYAPNLFLTNRITKRRTSIMQAFPDALDLLLICVE 192

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+SI+ A+ +V+++IG  S+ L+EE+ L  AELS+LP+R++A+EN   RT    V++  
Sbjct: 193 AGMSIEAAIAKVSQEIGTSSIELAEELSLLSAELSYLPDRRMAYENLGKRTNHPGVKSVA 252

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            A+ Q++ YGT +  +LRV+  E R  RL  AEKKAA+L  +LTVPMI+FFLPVL +VI+
Sbjct: 253 VAMTQAETYGTPLSSALRVMAKENRDLRLSAAEKKAAALPAQLTVPMILFFLPVLFIVIL 312

Query: 316 GPAILSIIDTM 326
           GPAIL+I+DTM
Sbjct: 313 GPAILNIMDTM 323


>gi|91977990|ref|YP_570649.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
 gi|91684446|gb|ABE40748.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
          Length = 324

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/298 (44%), Positives = 193/298 (64%), Gaps = 2/298 (0%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
            A++  + +Y +VIP      L KRMK+V  ERE +R+++   + K    S LR    + 
Sbjct: 20  AAIAASATVYTLVIPLFVGETLAKRMKAVGSERERIRQRERDRIAKAERVS-LRQAPKQF 78

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           +   V+ LNL   +  E   +KL  AG+R +      L  R+V+PI F I   +++F   
Sbjct: 79  VAKVVEDLNLGKWVAQETARDKLVMAGYRGQAPYVTFLFFRMVMPIAFGIASALYVFLLS 138

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
            + +    +++G  I   ++G  AP +++ N + KRQ SIKRA+PDALDLLLIC+ESG+S
Sbjct: 139 NM-QQSTSIKIGMCIAGVFLGMQAPMLFLKNAISKRQLSIKRAFPDALDLLLICIESGMS 197

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           I+ A R+V+ +IG QS+PL+EE+ LT AELS+LP+R+ A+EN   RT ++ V++   AL 
Sbjct: 198 IEAAFRKVSIEIGTQSIPLAEELTLTTAELSYLPDRKQAYENLAIRTGLEGVKSVCLALQ 257

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+GP
Sbjct: 258 QSERYGTPLSQSLRVMAQENRDMRMNEAEKKAAALPPKLTVPMIVFFLPVLFVVILGP 315


>gi|86748902|ref|YP_485398.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
 gi|86571930|gb|ABD06487.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
          Length = 324

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 195/309 (63%), Gaps = 2/309 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
           F        +  A+++ + +Y +V+P L    L KRMK+V  ERE LR+++   L K   
Sbjct: 9   FHDARFMTMLLAAIAVSATVYTLVMPLLVGETLAKRMKAVGSERERLRQRERDRLAKAER 68

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S LR    + +   V  LNL   +  E+  +KL  AG+R +      L  R+V+PI F 
Sbjct: 69  VS-LRQAPKQFVAKIVDDLNLGKWVAQESARDKLVMAGYRGQAPYITFLFFRMVMPIAFG 127

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +   +++F    + +    ++V   I   ++G  AP +++ N + KRQ SI+RA+PDALD
Sbjct: 128 LAAALYVFVLSNM-DQSTPIKVAICIGCVFLGMQAPMLFLKNAITKRQLSIRRAFPDALD 186

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LLLIC+ESG+SI+ A R+VA +IG QS+PL+EE  LT AELS+LP+R+ A+EN   RT +
Sbjct: 187 LLLICIESGMSIEAAFRKVAVEIGTQSIPLAEEFTLTTAELSYLPDRKQAYENLAKRTGL 246

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V++   AL QS+RYGT +  S+RV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLP
Sbjct: 247 DGVKSVCLALQQSERYGTPLSQSIRVMAQENRDMRMNEAEKKAAALPPKLTVPMILFFLP 306

Query: 309 VLILVIIGP 317
           VL +VI+GP
Sbjct: 307 VLFVVILGP 315


>gi|302381751|ref|YP_003817574.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192379|gb|ADK99950.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 333

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/313 (39%), Positives = 196/313 (62%), Gaps = 5/313 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           ++I   + +F+ +   ++ S+G G  L+KRM++V+V R+ L+++   ++        LR 
Sbjct: 11  ISIVVGLLVFATML-TLLSSMGGGVSLDKRMQAVSVRRDELKRRSRQAIANGQGG--LRH 67

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            D    +  V +LNL  +L D  +  ++  AG R    L      R   P IF+   +++
Sbjct: 68  TDDGFKKRVVDRLNLVKLLEDPKVAEQMIQAGLRGPRPLTTFYFFRFATPFIFMFAAVLY 127

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +F  +        +R+G V+     GF  P++++ N + KRQ SI +A+PDALDLLLICV
Sbjct: 128 VFVMNDF-GLSVTVRLGIVMFATVAGFYGPNIFLKNRIAKRQLSIMQAFPDALDLLLICV 186

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+SI+ A+ +V+++IG  SV L+EE+ L  AELS+LP R++A+E    RT    VR+ 
Sbjct: 187 EAGMSIEAAIVKVSQEIGTTSVELAEELALLSAELSYLPERRMAYEGLAKRTNHPGVRSV 246

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           + A+IQ+++YGT +G +LR +  E R  RL  AEKKAA+L  +LTVPMIIFFLPVL +VI
Sbjct: 247 STAMIQAEQYGTPLGSALRTMAKENRDLRLSAAEKKAAALPAQLTVPMIIFFLPVLFVVI 306

Query: 315 IGPAILSIIDTMK 327
           +GPAI++I DT+K
Sbjct: 307 LGPAIINIQDTLK 319


>gi|299132291|ref|ZP_07025486.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
 gi|298592428|gb|EFI52628.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
          Length = 325

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 178/293 (60%), Gaps = 2/293 (0%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P   S  L +RMK+VA       +Q+      +S    LR    + +   V   NL   L
Sbjct: 34  PLFASDGLTRRMKAVA-NERERIRQRERERMNNSERVTLRQSPKQFIGKIVHDFNLGKWL 92

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             E    KL  AG+R        L  R+V PI+ L +  ++IF   KL +    +++G  
Sbjct: 93  AQEEAKEKLVMAGYRGHAPYITFLFFRMVTPIVLLAVTALYIFVILKLNQTTL-VKIGIC 151

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           I   + G  AP +++ N + KRQ SIKRA+PDALDLLLICVESG+SI+ A R+V+ +IG 
Sbjct: 152 IGAAWFGMQAPMLFLKNAISKRQLSIKRAFPDALDLLLICVESGMSIEAAFRKVSFEIGS 211

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           QSV L+EE  LT AELS+L +R+ A+EN   RT +D V++   AL+QS+RYGT +G +LR
Sbjct: 212 QSVALAEEFTLTTAELSYLQDRKTAYENLQKRTGIDGVKSVCMALMQSERYGTPLGQTLR 271

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           V+  E R  R+ EAEKKAA+L PKLTVPMI+FFLP+L +VI+GP  + +   M
Sbjct: 272 VMAQENRDMRMTEAEKKAAALPPKLTVPMIVFFLPILFVVILGPTGIKVAAYM 324


>gi|218461576|ref|ZP_03501667.1| putative component of pilus protein [Rhizobium etli Kim 5]
          Length = 165

 Score =  229 bits (583), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%)

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           AP+++ISN + KRQ SIKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS  L+EEM
Sbjct: 2   APNIYISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPALAEEM 61

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
           +LT AELSFLP+R+VA EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R E
Sbjct: 62  VLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDE 121

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R+ EAEKKAA+L PKLTVPMI+FFLPVLI VI+GPA + + D
Sbjct: 122 RMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVAD 163


>gi|227818621|ref|YP_002822592.1| TadC, component of type IV pilus [Sinorhizobium fredii NGR234]
 gi|36958877|gb|AAQ87302.1| Tyrosine phenol-lyase [Sinorhizobium fredii NGR234]
 gi|227337620|gb|ACP21839.1| TadC, component of type IV pilus [Sinorhizobium fredii NGR234]
          Length = 323

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 191/306 (62%), Gaps = 1/306 (0%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+ T ++ FS + AV  P +    L +RM+ V  ERE +R+++ T L  + +   LR   
Sbjct: 15  AMLTGIAAFSAVVAVSWPYVFRNTLAERMRKVESERERIRQRERTRLNAEKSKVALRAEP 74

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
            +  +  V + NL     + +I+ +L  AG+R    +   L  RL+ PI+     +++I 
Sbjct: 75  RRFFQAIVDRFNLAKQAENSDILRQLSMAGYRGYAPVTTFLAFRLIAPIVLFAACLLYIL 134

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
              +  + P    +     +G +G+ AP+++I N + KRQ +I+RAWP+ALDLLLI VES
Sbjct: 135 LVLRP-QAPLLAVIAMAGAMGSLGYFAPAIFIRNRITKRQQAIRRAWPEALDLLLITVES 193

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+ I+ A R+V E+IG QS  ++EE+LLT AELS+L +R+ AFEN   RT ++ VR    
Sbjct: 194 GMGIESAFRKVGEEIGAQSPEVAEEILLTTAELSYLQDRRQAFENLGQRTGVEGVRAVVT 253

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           +LIQ+++YGT +G +LRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL  VI+ 
Sbjct: 254 SLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKKAAALPPKLTVPMIVFFLPVLFAVIVT 313

Query: 317 PAILSI 322
           PA + I
Sbjct: 314 PAAIQI 319


>gi|170750194|ref|YP_001756454.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656716|gb|ACB25771.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 325

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 130/292 (44%), Positives = 195/292 (66%), Gaps = 1/292 (0%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P L +  L KRMK V+ ERE +R+++  S ++    + LRT     +++ V++  L+  L
Sbjct: 34  PFLETDRLGKRMKLVSDEREQIRRRERLSAERTGNRATLRTEPKAYMKSIVERYQLRRWL 93

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             +    KL  AG+R + +    L  RLVVP++ +I  + ++F  + +L+  + +R G V
Sbjct: 94  GTDTAKRKLMQAGYRGQGAETAFLFFRLVVPVVAVIAALFYLFVLE-VLDASYLMRFGLV 152

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           I   Y+G  AP +++ N  +KRQ+ I++AWPDALDL LICVESG++I+ A R+V+ +I  
Sbjct: 153 IGAAYMGIKAPELFLVNTAKKRQTEIRKAWPDALDLTLICVESGMAIENAFRKVSTEIAT 212

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
            SV L+EE+ L  AE+SFLP+R+ A+EN   RT ++ V++   ALIQ++RYGT +G +LR
Sbjct: 213 SSVVLAEELALMTAEMSFLPDRRQAYENLVMRTGLEPVKSVATALIQAERYGTPVGQALR 272

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           VL  E+R  R+ EAEKKAA L PKLTVPMI+FFLPVL +VII PA++ I+ T
Sbjct: 273 VLSQESRDMRMNEAEKKAAGLPPKLTVPMILFFLPVLFVVIITPAVIQIMRT 324


>gi|307318085|ref|ZP_07597521.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306896126|gb|EFN26876.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 321

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 193/316 (61%), Gaps = 3/316 (0%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D  +LA AI    S FS +  V  P +    L  RM+ V  ERE +R+++   L++ S  
Sbjct: 9   DPEQLA-AIMAGFSAFSAVVVVSWPYVFRDTLSDRMRRVEGERERIRQRERARLEEKSRV 67

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           S LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P+    
Sbjct: 68  S-LRVEPKRLFQAIVDRFRLAKQAEDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVAIFA 126

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             +++I    +  E P  L V     +G +G+ +P++++ N + KRQ SI+R+WP+ALDL
Sbjct: 127 ACLLYILLVVRP-EAPLLLVVAMAGAMGALGYFSPAIFVRNRITKRQQSIRRSWPEALDL 185

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           LLI VE+G+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++
Sbjct: 186 LLITVEAGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVE 245

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPV
Sbjct: 246 GVRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMILFFLPV 305

Query: 310 LILVIIGPAILSIIDT 325
           L  VII PA++ I+ T
Sbjct: 306 LFAVIITPAVIQIMST 321


>gi|16127170|ref|NP_421734.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|221235971|ref|YP_002518408.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
 gi|13424566|gb|AAK24902.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|220965144|gb|ACL96500.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
          Length = 362

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 192/310 (61%), Gaps = 4/310 (1%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVA---VEREILRKQQITSLQKDSASSRLRTRDS 77
           AV +F+ I  +  P +    LE R+KSVA    E     +Q I++    +A   LR +D 
Sbjct: 54  AVVVFATIITLASPVMRDNNLEGRLKSVANRREELRRRSRQSISTRAPGTAGGTLRHQDE 113

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
              +N V++L L  +L D  +V KL  AGFR    ++     R  +P  F      +++ 
Sbjct: 114 GLYKNVVERLQLSRLLEDPKVVEKLAQAGFRGPKPVSTFYFFRFAMPFAFAAGAAFYLYV 173

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
            +     P Q ++ A +    +G+ AP+V+ISN+ QKR+ SI  A+PDALDLLLICVESG
Sbjct: 174 VNDFGLLPMQ-KLCACVAFLALGYYAPNVYISNVAQKRRESIVAAFPDALDLLLICVESG 232

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +SI+ A+++V  ++G  S+ L+EE+ L  AELS+LP+R++A+EN   RT    +++   A
Sbjct: 233 MSIEAAIQKVGAEVGSSSMELAEELSLLTAELSYLPDRRLAYENLARRTNHPGIKSVATA 292

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ++RYGT +G +LRV+  E R  RL  AEKKAA+L  +LTVPMI+FFLPVL ++I+GP
Sbjct: 293 MIQAERYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTVPMILFFLPVLFIMILGP 352

Query: 318 AILSIIDTMK 327
           AI+ + D  K
Sbjct: 353 AIMKVQDAFK 362


>gi|304320652|ref|YP_003854295.1| hypothetical protein PB2503_05397 [Parvularcula bermudensis
           HTCC2503]
 gi|303299554|gb|ADM09153.1| hypothetical protein PB2503_05397 [Parvularcula bermudensis
           HTCC2503]
          Length = 338

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 193/318 (60%), Gaps = 8/318 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +A+  AV +F  I  +V+P      L+KR+K VA  +E LR+Q    L        LR  
Sbjct: 15  IAMLAAVGVFLTIVTLVMPLFADNGLDKRVKKVADYKERLRQQSRAELAGSRKPGSLRNA 74

Query: 76  DSKSL-RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            +  + +  V++L L  I        +L  AG R E  +   ++ R++ P+  L++ I +
Sbjct: 75  TAGGMGKRLVEQLKLFEIFDAAAARKQLMMAGLRGERPVFTYMLARVITPVAALLVAIFY 134

Query: 135 IFGYDKLLEYPFQ---LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           ++  + +    F    L +GA+ L    G+  P++++ NLV KR+  I+ ++PD+LDLLL
Sbjct: 135 LYVLEVVEVASFMRLILCIGALAL----GYYLPNIYVHNLVTKRKQKIQLSFPDSLDLLL 190

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVESG+SI+ AL++V E++      L+EE  LT AELS+L +R+VA+ N   RT ++ V
Sbjct: 191 ICVESGMSIEAALQKVTEEVAASCPELAEEYGLTTAELSYLQDRKVAYHNLGERTGLEGV 250

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           ++ T ALIQS+ YGT++G SLRV+ +E R  R+  AEKKAA+L PKLTVPMI+FFLPVL 
Sbjct: 251 KSVTTALIQSEVYGTALGASLRVMAAENREIRMQNAEKKAAALPPKLTVPMILFFLPVLF 310

Query: 312 LVIIGPAILSIIDTMKDH 329
           +VI+GP +L    T  + 
Sbjct: 311 VVILGPGVLKATSTATEE 328


>gi|254293219|ref|YP_003059242.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041750|gb|ACT58545.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 333

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 191/298 (64%), Gaps = 5/298 (1%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
           F+ I  +  P+L   +LE R+KSV+  RE LR++    L+  S    LR +D   +RN V
Sbjct: 21  FATILTIAAPALKGNKLETRLKSVSNRREELRRKSREQLKDKS----LRRKDEGMMRNVV 76

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
            KL+L+++L D+N+   L  AG R    ++     R  +P +  +L  +++  +    + 
Sbjct: 77  DKLDLQSLLRDDNLEKALVQAGLRGPRPVSAFYFARFALPFLLGLLTFLYLH-FVNDFDL 135

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
            FQL++ AV+     GF AP+++++N   KR++SI +A+PD+LD++LICVESG+SI+ A 
Sbjct: 136 NFQLQMCAVMFGAAAGFYAPNMYLTNRADKRKASIMKAFPDSLDMMLICVESGMSIESAF 195

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            +V E++G  SV L+EE+ LT AELS+L  R+ A+ N  +RT    +++   AL+Q+++Y
Sbjct: 196 AKVGEEVGTASVELAEELGLTTAELSYLQERRQAYVNLADRTNHPGIKSVATALVQAEKY 255

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           GT +G +LR +  E R  R++EAEKKAA+L  KLTVPMI+FFLPVL +VI  PA + I
Sbjct: 256 GTPMGTALRTMAKENREIRVLEAEKKAAALPAKLTVPMIVFFLPVLFIVIGTPAYIQI 313


>gi|220922784|ref|YP_002498086.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947391|gb|ACL57783.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 319

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 193/294 (65%), Gaps = 4/294 (1%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
           + ++ P L    L +RMKSV  ER+ +R ++   L +      LR +    ++  V++  
Sbjct: 28  FTLLQPFLEPDRLARRMKSVGEERDRIRLRERERLNQ---RGNLRQQPKAYMKRVVERFK 84

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           L   L  ++  N+L  AG+R   +    L  RLV+P++F ++ + ++F     L+ PF +
Sbjct: 85  LDNWLATDDAKNRLMMAGYRGPQAETAFLFFRLVMPVVFFVVSVFYLFVLHA-LDQPFSI 143

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           R+  VI   Y G  AP +++ N   KRQ+ IK+ WPDALDL+LICVESG++I+ + RRV+
Sbjct: 144 RLMIVIAAVYAGIKAPEIFLKNQTTKRQAEIKKHWPDALDLMLICVESGMAIEHSFRRVS 203

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            ++  QS+ L+EE+ LT AELS+L +R++A+EN   RT ++ V+  + AL+Q++RYGT +
Sbjct: 204 AEMANQSIVLAEELALTTAELSYLTDRRIAYENLAMRTGLESVKAVSTALVQAERYGTPV 263

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G +LRVL  E+R +R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+ PA++ I
Sbjct: 264 GQALRVLAQESRDQRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILTPAMVQI 317


>gi|193782687|ref|NP_436096.2| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304378|ref|ZP_07584129.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|193073143|gb|AAK65508.2| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306902580|gb|EFN33174.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 321

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 193/316 (61%), Gaps = 3/316 (0%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D  +LA AI    S FS +  V  P +    L  RM+ V  ERE +R+++   L++ S  
Sbjct: 9   DPEQLA-AIMAGFSAFSAVVVVSWPYVFRDTLSDRMRRVEGERERIRQRERARLEEKSRV 67

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           S LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P+    
Sbjct: 68  S-LRVEPKRLFQAIVDRFRLAKQAEDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVAIFA 126

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             +++I    +  E P  L V     +G +G+ +P++++ N + KRQ SI+R+WP+ALDL
Sbjct: 127 ACLLYILLVVRP-EAPLLLVVAMAAAMGALGYFSPAIFVRNRITKRQQSIRRSWPEALDL 185

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           LLI VE+G+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++
Sbjct: 186 LLITVEAGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVE 245

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPV
Sbjct: 246 GVRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMILFFLPV 305

Query: 310 LILVIIGPAILSIIDT 325
           L  VII PA++ I+ T
Sbjct: 306 LFAVIITPAVIQIMST 321


>gi|149186259|ref|ZP_01864573.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
 gi|148830290|gb|EDL48727.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
          Length = 329

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 188/311 (60%), Gaps = 7/311 (2%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           +I   ++ F++I+A+         + KR+K++   RE L+   +T+  K   S   +T  
Sbjct: 19  SILAGIAAFAVIFAIYTAVTIKDPMAKRVKALEGRREELKLGLVTAGAKKRQSLVRKTNT 78

Query: 77  SKSLRNFVKKLNLKAILVDENIV---NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +  +R  +   N+K +L D  +     KL  AGFR++    IL+ +R+V+PI+F  +  I
Sbjct: 79  TDKVRETLG--NMK-VLQDSQVQMMQQKLAWAGFRNKEVAVILIGLRMVLPIVFGSIAAI 135

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            ++G +   ++ F+ RV A+    + G+  P +++SN+  KR  +I++  PDALDLL+IC
Sbjct: 136 LLYGIEIYPDWQFK-RVAALAFAVFAGYKGPEIYLSNIASKRTDAIRKGLPDALDLLVIC 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
            E+G+++D A  RVA+++G     L +E  LT  ELSFL  R+ AF+N   R  ++ V+ 
Sbjct: 195 AEAGLTVDAAFNRVAKELGRAYPELGDEFALTAIELSFLNERKKAFDNLAYRVNLEAVKG 254

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               ++Q++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL +V
Sbjct: 255 VVTTMVQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLIMFILPVLFIV 314

Query: 314 IIGPAILSIID 324
           I+GPA  SI D
Sbjct: 315 ILGPAACSIAD 325


>gi|85707698|ref|ZP_01038764.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
 gi|85689232|gb|EAQ29235.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
          Length = 333

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 184/310 (59%), Gaps = 8/310 (2%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
            ++ F++I A+         + KR+KS+   R+ L+   +TS  K  AS   ++  +  +
Sbjct: 24  GLAAFAVIMAIYAAITIKDPMAKRVKSLNERRDELKAGIVTSGTKKRASLVRKSDTTDKV 83

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD- 139
           ++ + K+N+      + +  KL  AG+R++    I++ +R V+P++F I+G   I+ ++ 
Sbjct: 84  KDSLGKMNVLEQSQLQAVQQKLAHAGYRNKELAVIVIGLRAVLPVVFGIVGFFAIYYFNV 143

Query: 140 ---KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
              K   Y F L +   + +GY G   P +++ N   KR   I++  PDALDLL+IC E+
Sbjct: 144 FDIKSDFYKF-LAMAGCLFLGYKG---PELFLKNKADKRTKEIQKGLPDALDLLVICAEA 199

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+++D A  RVA+++G     L +E  LT  ELSFL  R++AF N   R  ++ V+    
Sbjct: 200 GLTVDAAFNRVAKELGRAYPELGDEFALTAIELSFLNERKMAFNNLAYRVDLEAVKGVVT 259

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL +VI+G
Sbjct: 260 TMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVLFIVILG 319

Query: 317 PAILSIIDTM 326
           PA  +I DT+
Sbjct: 320 PAACAITDTL 329


>gi|87199097|ref|YP_496354.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134778|gb|ABD25520.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 335

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 190/327 (58%), Gaps = 16/327 (4%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
           FD++    + VAI  A ++   IYA V        + KR+K++   RE L+   +T+  +
Sbjct: 13  FDVYFVGSILVAIA-AFAVMLAIYAAVTVR---DPMAKRVKALNERREQLKSGIVTANAR 68

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDEN---IVNKLRAAGFRS-EYSLNILLVVRL 121
              S   R + +  +R F++ L    +L D     I  KL  AG R  E+++ ++L  RL
Sbjct: 69  KRTSIVRRNQTTDQIRGFLESLK---VLQDSQLAVIQQKLAQAGIRKKEWAVAVILG-RL 124

Query: 122 VVPIIFLILGIIWIFGYDKLLEY-PFQLRVG-AVILIGYVGFCAPSVWISNLVQKRQSSI 179
           V PI   + G    +  +   ++ PF+  +G AV LI   G+  P ++I NLV KR  ++
Sbjct: 125 VGPIALGLFGAAVFYWSNTFPDWSPFKRFLGFAVCLIA--GYKGPDLFIQNLVSKRTVAV 182

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           ++  PDALDLL+IC E+G+++D A  RVA ++G     L +E  LT  ELSFL  R+ AF
Sbjct: 183 RKGLPDALDLLVICAEAGLTVDAAFSRVARELGRAYPELGDEFALTAIELSFLTERRHAF 242

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN   R  +D V+     +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +T
Sbjct: 243 ENLAYRVDLDSVKGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMT 302

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTM 326
           +P+I+F LPVL +VI+GPA  SI D++
Sbjct: 303 IPLILFILPVLFIVILGPAACSISDSL 329


>gi|326388860|ref|ZP_08210442.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206460|gb|EGD57295.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 339

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 177/308 (57%), Gaps = 9/308 (2%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           AV++   IYA V        + KR+KS+   RE L+   + +  K   S   R   +  +
Sbjct: 32  AVAVVLAIYAAVTVR---DPMAKRVKSLNERREELKAGIVVAASKKRTSIVRRNETTDRI 88

Query: 81  RNFVKKLNLKAILVDENIVN---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           R+ +++L    +L D  +     KL  AG R +     ++  R++ P++   L  ++I+G
Sbjct: 89  RSILERLR---VLQDSQLATAQQKLAQAGIRKKEWGVAVIFGRMIGPMVLGGLAALFIYG 145

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
            +    +P   + GA  ++   G+  P V+++NL+ KR ++I++  PDALDLL+IC E+G
Sbjct: 146 LNYFPTWPDYKKFGAFAVMVLAGYKGPDVFVANLIGKRTNAIRKGLPDALDLLVICAEAG 205

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++ID A  RVA ++G     L +E  LT  ELSFL  R+ AFEN   R  ++ +R     
Sbjct: 206 LTIDAAFSRVARELGRAYPELGDEFSLTAIELSFLTERRSAFENLAYRVNLESMRGVVTT 265

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +T+P+I+F LP L +VI+GP
Sbjct: 266 MIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTIPLILFILPTLFVVILGP 325

Query: 318 AILSIIDT 325
           A  S+ D 
Sbjct: 326 AACSLSDN 333


>gi|103486613|ref|YP_616174.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98976690|gb|ABF52841.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 347

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 112/313 (35%), Positives = 181/313 (57%), Gaps = 2/313 (0%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           A  +  A+ +F+++ A+         + KR+K++   RE L+     S  K  A    + 
Sbjct: 28  AGTLLAAIGVFAVLVAIYNALTVRNPMTKRVKALNERREQLKAGITASTAKRRARLVRKN 87

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           + +  +RNF+ +L +      + +  KL  AG RS+     ++  R+V+PI+F  L +  
Sbjct: 88  QTADRMRNFLGRLQVLQEGQIKEVQQKLAQAGIRSKDLAVAVIFGRMVLPILFGGLALFL 147

Query: 135 IFGYDKLLEY-PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           I+  D      PF+ R G  +    +G+ AP +++ N+ QKR  +I++  PDALDLL+IC
Sbjct: 148 IYIVDMWPTLTPFK-RSGFTMAALILGYKAPDLFVDNMRQKRTDAIRKGLPDALDLLVIC 206

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
            E+G+++D A  RV++++G     L EE  LT  EL FL  R+ AFEN   R  ++ V+ 
Sbjct: 207 AEAGLTVDSAFSRVSKELGRAYPELGEEFALTSIELGFLTERRQAFENLAYRVNLESVKG 266

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               +IQ+++YGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL +V
Sbjct: 267 VVTTMIQTEKYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVLFIV 326

Query: 314 IIGPAILSIIDTM 326
           I+GPA  S+ D M
Sbjct: 327 ILGPAACSLSDAM 339


>gi|83312845|ref|YP_423109.1| Flp pilus assembly protein TadC [Magnetospirillum magneticum AMB-1]
 gi|82947686|dbj|BAE52550.1| Flp pilus assembly protein TadC [Magnetospirillum magneticum AMB-1]
          Length = 339

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 189/301 (62%), Gaps = 12/301 (3%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS----LRNFVKKLNL 89
           P L       R+K+V+  R  L ++Q   L +  A+SR R    +     +R  + +L L
Sbjct: 44  PLLARDRRASRIKAVSNRRRELSERQKAELDQARATSRRRGARPQRRVALMRAVIDRLKL 103

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG-YDKLLEYPFQL 148
           + +L  + +  +L  AG+RS+ +    +  R+ +P+I L LG+I+    +D   E P  +
Sbjct: 104 QDLLEAKALRAQLACAGWRSQAAPLTFIFARVALPVILLALGLIYATTLFD---EQPLMI 160

Query: 149 RVGAVILIGYVGFCA--PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
           R  A+IL   +G  A  P++W++N VQKRQ ++ RA+PDALDL++ICV++G+S++ AL R
Sbjct: 161 R--ALILAAAMGIGALLPNIWLTNAVQKRQMALSRAFPDALDLIVICVDAGLSVETALGR 218

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V E++   +  ++EE+ LT AEL+FL +R+ A+ENF  RT +  V++   ALIQS++YGT
Sbjct: 219 VTEEMMISAPEMAEEIGLTAAELAFLADRRHAWENFAERTGLPQVKSLATALIQSEKYGT 278

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            +  +L+V+  E R  R+  AEKKAA+L  KLTVPMI+FFLPVL L+I GPA + +   M
Sbjct: 279 PVAQALKVISQENREGRMAAAEKKAAALPAKLTVPMIVFFLPVLFLIIAGPAAIQVSGMM 338

Query: 327 K 327
           K
Sbjct: 339 K 339


>gi|296284556|ref|ZP_06862554.1| hypothetical protein CbatJ_13056 [Citromicrobium bathyomarinum
           JL354]
          Length = 342

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 180/307 (58%), Gaps = 5/307 (1%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
            A+++   IYA V        + KR+K++   R+ L+   +    +   S   RT+ +  
Sbjct: 37  AAMAVMLAIYAAVTVR---DPMAKRIKALNERRDELKAGIVRETARKRKSLVRRTQKTDK 93

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRS-EYSLNILLVVRLVVPIIFLILGIIWIFGY 138
           +++ +    +      E +  KL  AG R+ EY++ ++   R V+PI+  ++     +  
Sbjct: 94  VKDTLANFKVLQQSQLEVVQQKLAHAGIRNKEYAVYVI-GARAVLPIVLGLIAFYLFYVS 152

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
           D   ++    R+GA+ +  ++G+  P ++I+N  +KR  +I++  PDALDLL+IC E+G+
Sbjct: 153 DMFADWGSFKRLGALSIAVFIGYKGPELYIANKAKKRTDAIRKGLPDALDLLVICAEAGL 212

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           +ID A  RVA+++G     L +E LLT  ELSFL NR++AF+N   R  ++ V+     +
Sbjct: 213 TIDSAFTRVAKELGRAYPELGDEFLLTSIELSFLNNRKMAFDNLAYRVDLEAVQGVVTTM 272

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA
Sbjct: 273 IQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPTLFIVILGPA 332

Query: 319 ILSIIDT 325
             SI D 
Sbjct: 333 GCSIADA 339


>gi|94497258|ref|ZP_01303830.1| type II secretion system protein [Sphingomonas sp. SKA58]
 gi|94423363|gb|EAT08392.1| type II secretion system protein [Sphingomonas sp. SKA58]
          Length = 329

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (58%), Gaps = 6/285 (2%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
           + KR+K++   RE L+     S  K  A      + +  +R+F+  L    +L D+ + +
Sbjct: 44  MAKRVKALNERREQLKAGITASTAKRRAKLVKSNQTTDQMRSFLSSLK---VLQDDQLKD 100

Query: 101 ---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
              +L  AG RS+     ++  R+++PI    +  I ++G   L E+    R  A  +  
Sbjct: 101 VQVRLAQAGIRSKDLAVAVIFGRMILPIAIGGMAAILLYGVGILPEWGPMKRFFAFAVAL 160

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            + + AP ++I N VQKR ++I++  PDALDLL+IC E+G+++D A  RVA ++G     
Sbjct: 161 LLSYKAPDLFIDNKVQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFARVARELGKAYPE 220

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L +E  LT  ELSFL  R++AFEN  +R ++D V+     +IQ+++YGT +  +LRVL +
Sbjct: 221 LGDEFHLTAIELSFLTERRMAFENLASRVKLDAVKGVVTTMIQTEKYGTPLASALRVLSA 280

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA  SI
Sbjct: 281 EFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGPAACSI 325


>gi|85373127|ref|YP_457189.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
 gi|84786210|gb|ABC62392.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
          Length = 331

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 177/306 (57%), Gaps = 3/306 (0%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
            A+++   IYA V        + KR+K++   R+ L+   + S  K   S   +T  ++ 
Sbjct: 26  AALAVMMAIYAAVTIK---DPMAKRVKALNERRDELKAGIVKSSGKKRQSLVRKTDQTEK 82

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           +++ ++ + +      E I  KL  AG R++    +++  RLV+PI+   +  + ++G D
Sbjct: 83  VKDTLQNMKVLQQSQIEVIQQKLAHAGIRNKELAVVVIGARLVLPIVLGGIVALVVYGLD 142

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
              E+    R  A+++   +G+  P + + N   KR  +I++  PDALDLL+IC E+G++
Sbjct: 143 FFPEWGAMKRYAALVVAMGLGYKGPEMLLKNKAAKRTDAIRKGLPDALDLLVICAEAGLT 202

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           +D A  RVA+++G     L +E  LT  ELSFL  R+ AF+N   R  ++ V+     ++
Sbjct: 203 VDAAFNRVAKELGRAYPELGDEFALTAIELSFLTERKQAFDNLAYRVDLEAVKGVVTTMV 262

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL +VI+GPA 
Sbjct: 263 QTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVLFIVILGPAA 322

Query: 320 LSIIDT 325
            SI D 
Sbjct: 323 CSISDA 328


>gi|148557757|ref|YP_001265339.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148502947|gb|ABQ71201.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 330

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 117/341 (34%), Positives = 190/341 (55%), Gaps = 35/341 (10%)

Query: 2   PHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
           P +F  L     + +A+ TA+ +  + +A+V  S+    + +R++++   RE        
Sbjct: 7   PQFFDTLL---SIGIALATAIVMLVVGHALV-KSIARDPMARRVRALNDRRE-------- 54

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIV--NKLRAA-------GFRSEYS 112
            L+   A+S+ R R     +  +    +KAIL    ++  ++L+AA       G R++ +
Sbjct: 55  QLKAGVAASKTRRRQKMDKKASISVDRMKAILGSMKMLQDSQLKAASLSLTRAGIRTKDA 114

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP-------FQLRVGAVILIGYVGFCAPS 165
              ++  RLV P++   +G   + G   L  +P       + +  GA+I      + AP 
Sbjct: 115 AITVIFFRLVSPVL---IGGTAVVGVYVLHWFPEASAFKQYMIVAGALI----ASYKAPD 167

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           V++ NL+ KRQ +I++A PDALDLL+IC E+G+S+D A  RVA ++      L +E  LT
Sbjct: 168 VYVKNLITKRQQAIRKALPDALDLLVICAEAGLSVDLAFNRVARELSKAYPELGDEFALT 227

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
             EL FL +R+ AFEN   R  +D +R     +IQ+++YGT +  +LRVL +E R ER+M
Sbjct: 228 AIELGFLTDRRQAFENLAQRVNLDSIRGVVTTMIQTEKYGTPLAAALRVLSAEFRHERMM 287

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            AE+KAA L   +TVP+I+F LPVL +VI+GPA  SI D +
Sbjct: 288 RAEEKAARLPAIMTVPLIMFILPVLFIVILGPAACSIRDNV 328


>gi|294012437|ref|YP_003545897.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675767|dbj|BAI97285.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 330

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 170/289 (58%), Gaps = 14/289 (4%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
           + KR+K++   RE L+     S  +  A    + + +  +R+F+   NLK +L D+ +  
Sbjct: 45  MAKRVKALNERREQLKAGITASTARRRAKLVKKNQATDQMRSFLS--NLK-VLQDDQLKE 101

Query: 101 ---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP----FQLRVGAV 153
              KL  AG RS+     ++  RL++PI+   +  + ++      E+     F    GA+
Sbjct: 102 AQIKLAQAGIRSKDWAVAVIFGRLILPIVIGGMAALLLYAVGIYPEWGGAKRFMAFAGAL 161

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +L     + AP ++I N +QKR ++I++  PDALDLL+IC E+G+++D A  RVA ++G 
Sbjct: 162 LL----SYKAPDIFIDNKIQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFSRVARELGK 217

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
               L +E  LT  ELSFL  R++AFEN   R ++D ++     +IQ+++YGT +  +LR
Sbjct: 218 AYPELGDEFHLTAIELSFLTERRMAFENLATRVKLDAIKGVVTTMIQTEKYGTPLASALR 277

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           VL +E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA  SI
Sbjct: 278 VLSAEFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGPAACSI 326


>gi|307293454|ref|ZP_07573300.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881520|gb|EFN12736.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 330

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 163/285 (57%), Gaps = 6/285 (2%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
           + KR+K++   RE L+     S  +  A    + + +  +R+ +  L    +L D+ +  
Sbjct: 45  MAKRVKALNERREQLKAGITASTARRRAKLVKKNQATDQMRSLLSSLK---VLQDDQLKE 101

Query: 101 ---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
              KL  AG RS+     ++  R+++PI    +  + ++      E+    R  A     
Sbjct: 102 AQIKLAQAGIRSKDWAVAVIFGRMILPIAIGGMAALLLYAVGIFPEWGGAKRFMAFAAAL 161

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            + + AP ++I N VQKR ++I++  PDALDLL+IC E+G+++D A  RVA ++G     
Sbjct: 162 LLSYKAPDLFIDNKVQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFSRVARELGKAYPE 221

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L +E  LT  ELSFL  R++AFEN   R ++D V+     +IQ+++YGT +  +LRVL +
Sbjct: 222 LGDEFHLTAIELSFLTERRMAFENLATRVKLDAVKGVVTTMIQTEKYGTPLASALRVLSA 281

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA  SI
Sbjct: 282 EFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGPAACSI 326


>gi|23016184|ref|ZP_00055943.1| COG2064: Flp pilus assembly protein TadC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 319

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 181/289 (62%), Gaps = 8/289 (2%)

Query: 44  RMKSVAVEREILRKQQITSLQKDSASSRLR----TRDSKSLRNFVKKLNLKAILVDENIV 99
           R+K+V+  R  L ++Q   L +   S R R     R    +R  + +L L+ ++  + + 
Sbjct: 34  RIKAVSGRRRELSERQKADLDQARGSGRRRGAMPQRRVALMRAVIDRLKLQDLMEAKALK 93

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG-YDKLLEYPFQLRVGAVILIGY 158
            KL  AG+R + +    +  R+ +P++ L LG+I+    +D   E P  +R   + +   
Sbjct: 94  AKLAQAGWRGQAAPLTFIFARVALPVLLLALGLIYATTLFD---EQPLMIRAMILAVAMG 150

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
            G   P++W++N VQKRQ ++ RA+PDALDL++ICV++G+S++ AL RV E++   S  +
Sbjct: 151 AGGLLPNIWLANAVQKRQLALGRAFPDALDLIVICVDAGLSVETALGRVTEEMMNSSPEM 210

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           +EE+ LT AEL+FL +R+ A+ENF  RT +  V++ + ALIQS++YGT +  +L+VL  E
Sbjct: 211 AEEIGLTAAELAFLADRRQAWENFAGRTGLPQVKSLSTALIQSEKYGTPVAQALKVLSQE 270

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            R  R+  AEKKAA+L  KLTVPMI+FFLPVL L+I GPA L +   +K
Sbjct: 271 NRESRMAAAEKKAAALPAKLTVPMIVFFLPVLFLMIAGPAALQVSGMLK 319


>gi|332188365|ref|ZP_08390090.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
 gi|332011594|gb|EGI53674.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
          Length = 332

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 107/315 (33%), Positives = 171/315 (54%), Gaps = 9/315 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            A+   V +F L+ A  +       +++R++++   RE L K  I    K  A    RT 
Sbjct: 16  TAMLWGVCVFCLLVAGYMLIGTRDPMKRRVQALNERREQL-KAGIDPSPKRRAQFIERTD 74

Query: 76  DSKSLRNFVKKLNLKAILVDENIVN----KLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
             + +R  +  L +    + E+ V     KL  AG RS+     ++  RL +PI      
Sbjct: 75  LLERMRRVLSALKM----LQEDQVKAVQLKLLQAGIRSKEMAVAVIFGRLALPIALGGGM 130

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +W++G +   ++    R   V  +  + + AP + + N + KR  +I++  PDALDL++
Sbjct: 131 ALWVYGTEDFAQWSGFSRYMMVAGMLVLSYKAPDLALKNQIDKRTHAIRKGLPDALDLMV 190

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           IC E+G+++D A  RVA ++      L +E  LT  EL FL +R+ A EN   R  +D +
Sbjct: 191 ICAEAGLTVDAAFARVARELRRAYPELGDEFQLTSVELGFLTDRRQALENLSMRVNLDAL 250

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R     +IQ+++YGT +  SLRVL +E R+ER+M AE+KAA L   +TVP+I+F LP L 
Sbjct: 251 RGVVTTMIQTEKYGTPLASSLRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPTLF 310

Query: 312 LVIIGPAILSIIDTM 326
           +VI+GPA  SI DT+
Sbjct: 311 IVILGPAGCSINDTL 325


>gi|218516408|ref|ZP_03513248.1| pilus component protein [Rhizobium etli 8C-3]
          Length = 121

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/119 (65%), Positives = 97/119 (81%)

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           RV+E++G QS PL+EEM+LT AELSFLP+R+VA EN   RTQ++ VR+ TQALIQ+DRYG
Sbjct: 1   RVSEELGEQSPPLAEEMVLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYG 60

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           T +  +LRVL  E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI VI+GPA + + D
Sbjct: 61  TPVAQALRVLAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVAD 119


>gi|197106463|ref|YP_002131840.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
 gi|196479883|gb|ACG79411.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
          Length = 320

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (63%)

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           R+ A +     G   P + + N +QKR   I+RA PDALDL +IC E+G+S+D AL RV+
Sbjct: 141 RLAATLGGAVAGLYLPRLMLKNAIQKRSLKIQRALPDALDLFVICAEAGLSLDAALARVS 200

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            +IG  +  L++E+ LT  EL FLP+R+ A  N   R     VR     L+Q+++YGT +
Sbjct: 201 REIGPAAPELADELGLTAVELGFLPDRREALLNLTRRVAAPQVRGLVNTLVQTEKYGTPL 260

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             +LRVL +E R  R+M+AE+KAA L   LTVPMI F LP L +V+IGPAI+ ++ T
Sbjct: 261 AQALRVLAAEFRDTRMMKAEEKAARLPATLTVPMIAFILPPLFVVLIGPAIVQVLTT 317


>gi|144897440|emb|CAM74304.1| Flp pilus assembly protein TadC [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 199

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 109/150 (72%)

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           ++ R +PDALDL++ICVE+G+S++ AL +V +++   +  L+EE+ LT AEL+FL +R+ 
Sbjct: 50  ALARGFPDALDLMVICVEAGLSVEAALLKVTDEMANSAPELAEEIGLTAAELAFLGDRRQ 109

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           A++N   RT +  V++ + AL+QS++YGT +  +LRVL  E R  R+  AEKKAASL  K
Sbjct: 110 AWDNLAERTGLAQVKSLSTALVQSEKYGTPVAQALRVLSQENRETRMAAAEKKAASLPAK 169

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LTVPMI+FFLPVL +VI GPA + ++   K
Sbjct: 170 LTVPMIVFFLPVLFIVIAGPAAIQVMAAWK 199


>gi|159043673|ref|YP_001532467.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
 gi|157911433|gb|ABV92866.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
          Length = 331

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 141/263 (53%), Gaps = 1/263 (0%)

Query: 65  KDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           +D    +LR  D  K L  F + L  +       I  KL  AG+R + S+ I    +L +
Sbjct: 63  EDGKGKQLRQDDPGKKLERFSQYLEPQDNEELSAIRLKLIQAGYRQKSSVQIFHFAQLAL 122

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            + FL +G+I+ F +    +          ++ G+ G+  P  W+   + KRQ  I   +
Sbjct: 123 GLGFLSIGVIYTFFFGGGEDPDVTKATLTTLVPGFCGYYLPKYWVDKRIDKRQEEITNGF 182

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD+LDL+L+CVE+G  +DQA+ RVA +I      L++E  +   E+    ++    ++  
Sbjct: 183 PDSLDLMLVCVEAGQGLDQAIIRVAHEIRAGYPDLADEFEMVAFEIKAGKDKITVLKDMA 242

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  V +    LIQS  +GTSI D+LRV   E R +R+M AE+KA  L  KLT+  +
Sbjct: 243 ERCGVGDVTSFVTVLIQSQSFGTSIADALRVYAGEMRDKRVMRAEEKANVLPTKLTLGTM 302

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +F +P L++++IGP++ SI +++
Sbjct: 303 MFTVPPLLIILIGPSMWSIYESL 325


>gi|258405283|ref|YP_003198025.1| Type II secretion system F domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797510|gb|ACV68447.1| Type II secretion system F domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 320

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 173/330 (52%), Gaps = 29/330 (8%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D   L +A    VS+F L+  V+          + ++S + +R IL K Q TS Q+ +  
Sbjct: 4   DYLPLIMAGAIFVSLFLLMIGVM----------QLVRSNSKKRAILEKIQ-TSNQQSAFG 52

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVN-----------KLRAAGFRSEYSLNILLV 118
              R   S+S   F  K+     LV + +             +   AG RS  +  +   
Sbjct: 53  DPQRLDSSRS--GFFGKIFGFVGLVGQKVAKDRVSDHTVLRPRFLKAGIRSPLAPAVFWG 110

Query: 119 VRLVVPIIF-LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
           +++++P+   L  G+ +    D  L     L +  + ++   GF  P +W++N  QKR+ 
Sbjct: 111 LKVIMPLALPLCFGLFYYLIPDLTLSPTNTLLI--ITVLAVAGFYVPDLWLTNKRQKRRQ 168

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM-LLTIAELSFLPNRQ 236
           +I + +PDALDL+++CVE+G+ +D A+ RVA++    +  LSEE+   T+   + +P R+
Sbjct: 169 TILKGFPDALDLMVVCVEAGMGLDAAISRVAKESKSNNATLSEELHFFTLETRAGMP-RK 227

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            A +N   RT +  ++N T  LIQ++++GTS+  +L+V     R+ER   AE+KAA +  
Sbjct: 228 DALKNLAMRTDLQQMQNLTTLLIQTEKFGTSVSQALKVFSESMRTERFQRAEEKAAKIPV 287

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           KL  P+I+F  P L + I+GPA++ I  T+
Sbjct: 288 KLLFPLIMFIFPSLFVAILGPAVIRISQTL 317


>gi|91788419|ref|YP_549371.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697644|gb|ABE44473.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 314

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 106/163 (65%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P+V + NL+ +RQ  I  ++PDALDL+ +CVE+G+++D AL RVA +IG +S  LS
Sbjct: 140 GYYLPNVLLKNLISRRQREIFESFPDALDLMTVCVEAGLAMDAALARVASEIGLKSAVLS 199

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           EE+ L   EL    +++ A  N   RT +D V      LIQS+R+GTSI DSLRV   + 
Sbjct: 200 EELQLVTLELRAGSSKEKALRNLALRTGVDDVDALVAMLIQSERFGTSIADSLRVQSDQL 259

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R++R   AE++AA +  KL  P+I F  P L++V++GPA + I
Sbjct: 260 RTKRRQRAEEQAAKIALKLLFPLIFFIFPSLLVVLMGPAFIQI 302


>gi|254475205|ref|ZP_05088591.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
 gi|214029448|gb|EEB70283.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
          Length = 327

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 146/274 (53%), Gaps = 1/274 (0%)

Query: 52  REILRKQQITSLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSE 110
           +++ R    ++  K     RLR  D ++ L+ F   L  +       +  KLR AG++S+
Sbjct: 48  KKLQRSMSESTRDKKPQKERLRQADRNEQLQKFASFLEPQNADELSAMELKLRQAGYQSK 107

Query: 111 YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISN 170
            S+ +    +  + ++ L+ G+++++  +  +EY  Q  +  +I  G   +  P  WI+ 
Sbjct: 108 DSVRLFHFAQFALGLVGLVAGLVYVYVLNADMEYDSQQMIIRIIGPGAAAYMLPKYWITR 167

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
            +++R+  I   +PDALD++L+CVE+G S+DQA+ RVA+++      L+EE  +   E+ 
Sbjct: 168 RIEERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALAEEFEVVAYEMK 227

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
               +     +   R  +  V +    +IQS  +GTSI D+LRV   E R +R+M AE+ 
Sbjct: 228 AGKEKDKVLRDMGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRAEEA 287

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           A  L  K+T+  +   +P L+++++GP+   I +
Sbjct: 288 ANKLPTKMTLATMTLTVPPLLIILVGPSAQGIAN 321


>gi|292491527|ref|YP_003526966.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580122|gb|ADE14579.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 320

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 128/232 (55%), Gaps = 10/232 (4%)

Query: 99  VNKLRAAGFRSEYSLNILLVVRL----VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
             KL  AG+RS  +L +   ++L    ++P I + L  I+   Y K     FQ+ V   +
Sbjct: 92  TTKLVHAGYRSGNALTLFYAIKLLSGIILPAIAIFLTTIF---YPKFTT--FQI-VFLGL 145

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
            + ++G   P++ +  L++KRQ  I   +PD LDLL+ C E+G+ ++ AL+RVAE+    
Sbjct: 146 FLSFIGLLFPNIVLERLIKKRQRQIYNGFPDVLDLLITCTEAGLGLNAALKRVAEECAVS 205

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              LS E+ L   E+    NR  A +NF  R  ++ + +    L QS R+GTSI D+LR+
Sbjct: 206 HPVLSGELTLVNMEIRAGVNRVEALKNFSARAGIEEIHSFVAFLSQSLRFGTSIADTLRI 265

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              E R +R+  AE+ AA +G K+  P+I   LP   LV IGPA+L ++  +
Sbjct: 266 YSDEFRDKRMQRAEEMAAKMGTKMIFPLIFCILPSFFLVAIGPAVLGVLKAL 317


>gi|255264846|ref|ZP_05344188.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255107181|gb|EET49855.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 323

 Score =  135 bits (341), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 145/273 (53%), Gaps = 3/273 (1%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           L++  +T  Q+DS      T       +F++  + +       I  KL  AG+R + ++ 
Sbjct: 50  LKRNNVTPGQRDSLRFNQGTDKLDKYADFLEPQDEEEY---SAIRLKLLQAGYRGKSAVR 106

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
                +  + I  L+ G+ +        E   Q  + ++++ G VG+ AP  W++   Q 
Sbjct: 107 TFHFAQFALGIALLLAGVAYAIYNSTAGEPSTQSTIMSILIPGCVGYMAPKYWVTKRQQT 166

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           RQ +I   +PD+LD++L+CVE+G S+DQ++ RV++++      L+ E  +   E+    +
Sbjct: 167 RQEAITNGFPDSLDMMLVCVEAGQSLDQSILRVSQELKSGFPDLASEYEIVSHEMKAGKD 226

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           +     +   R  +  + +    LIQS  +GTSI ++LRV   E R +R+M AE+KA +L
Sbjct: 227 KTSVLRDMSERCGVPDIASFVTVLIQSQSFGTSIAEALRVYAGEMRDKRVMRAEEKANTL 286

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
             K+T+  ++  +P L++++IGP++  I +T+K
Sbjct: 287 PTKMTLATMMLTVPPLLIILIGPSVYGIAETLK 319


>gi|84501671|ref|ZP_00999843.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390292|gb|EAQ02851.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 330

 Score =  135 bits (341), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 146/276 (52%), Gaps = 10/276 (3%)

Query: 57  KQQITSLQKDSASSRLRTRDSKS-LRNFVKKLNLK---AILVDENIVN------KLRAAG 106
           K+++  L+K   +    T D+K  LRN  +   L+   + L  +N         KL  AG
Sbjct: 38  KKEVDPLEKLKQNGTPATADNKDKLRNNKRNQRLERYSSFLEPQNEKEYSAMRIKLLQAG 97

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           +RS+ S+      +  + I  L+ G+I+        +   Q  V  ++  G VG+  P  
Sbjct: 98  YRSKDSVRYFHFAQFALGIFGLLGGVIYFIAVKAADQPDTQTTVMYILGPGGVGYLIPKY 157

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           WI+    +RQ  I   +PDALD+LL+CVE+G S+DQA+ RVA++I      L++E  L  
Sbjct: 158 WINKRQAQRQEEITNGFPDALDMLLVCVEAGQSMDQAILRVAKEIRVSYPSLADEFELVS 217

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            E+    ++     +   R  +  + +    LIQS  +GTS+ D+LRV  SE R +R+M 
Sbjct: 218 HEIKAGKDKASVLGDMAERCGVPDIASFVTVLIQSASFGTSVADALRVYASEMRDKRVMR 277

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           AE+KA  L  K+T+  ++  +P L++++IGP++L I
Sbjct: 278 AEEKANKLPTKMTLATMMLTVPPLLIILIGPSVLGI 313


>gi|260427288|ref|ZP_05781267.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
 gi|260421780|gb|EEX15031.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
          Length = 324

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 151/280 (53%), Gaps = 11/280 (3%)

Query: 54  ILRKQQITSLQKDSASSRLR-----------TRDSKSLRNFVKKLNLKAILVDENIVNKL 102
           +L +Q+   + K + S R R           TR +  L  + + L  K+      +  KL
Sbjct: 36  LLLRQKPDPMDKLAKSGRARIDAETKAILRDTRRNAKLNKYAQYLEPKSAEELGQMRLKL 95

Query: 103 RAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
             AG+R+  S+ +  + ++V+ +  L  G  +   +    +   Q ++  ++  G VG+ 
Sbjct: 96  LQAGYRTPDSVRLYYLAQMVLGLGLLAAGTAYYVMFKDGPDATMQTKLMYIVGPGAVGYL 155

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           AP  WI+  V++R+  I+  +PDALD++L+CVE+G S+DQ++ RV++++      L++E 
Sbjct: 156 APKYWITKRVEERKKQIEEGFPDALDMMLVCVEAGQSLDQSIVRVSKELRASYPALADEF 215

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +   E+    ++     +   R  +  V +    L Q+  +GTSI D+LR+  SE R +
Sbjct: 216 EIISHEMRAGKDKSNVLNDMGERCGVQDVSSFVTVLNQAANFGTSIADALRIYASEMRDK 275

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+M AE+KA  L  K+T+  ++  +P L+++++GP+++SI
Sbjct: 276 RVMRAEEKANKLPTKMTLTTMMLTVPPLLIILVGPSVVSI 315


>gi|146276356|ref|YP_001166515.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554597|gb|ABP69210.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 323

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 137/255 (53%), Gaps = 9/255 (3%)

Query: 77  SKSLR--NFVKKLNLKAILVDENIVNKLRA-------AGFRSEYSLNILLVVRLVVPIIF 127
           S++LR  +  +KL+  A L++     +L A       AG+RS+ ++      +  + + F
Sbjct: 62  SQALRRSSGTEKLDRFANLLEPKTAEELSASRLKMMRAGYRSKGAVRAFHAAQFALGVGF 121

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L+LG+++            Q  V   +L G +G+  P  WI    Q+R   I   +PDAL
Sbjct: 122 LVLGVLYALLASATAPLTMQQMVIYTLLPGAIGYYLPVYWIKRRAQERHDQIVAGFPDAL 181

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++L+CVE+G S+DQ++ RVA +       L+EE  +   E+     R    ++   R  
Sbjct: 182 DMMLVCVEAGQSLDQSILRVARESASGYPALAEEFEMVAHEVKAGKERVAVLKDMAERVG 241

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V +    LIQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +
Sbjct: 242 IPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTV 301

Query: 308 PVLILVIIGPAILSI 322
           P L+L++IGP++  I
Sbjct: 302 PPLMLILIGPSVYGI 316


>gi|89068023|ref|ZP_01155440.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046262|gb|EAR52319.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 987

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 148/274 (54%), Gaps = 18/274 (6%)

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVN------------------KLRAAGFRSEYS 112
           RL+ R+S   +N +K   L+     + +                    KL  AG+R++ +
Sbjct: 709 RLKRRESDETKNLMKGEKLRQKKGTDKLDKYSNFLEPQDKAEYSAIQLKLLQAGYRTKNA 768

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           + +    +  + I+ L+LG+ +    ++  +   Q  + ++++ G  G+  P  W++   
Sbjct: 769 VRLYHFAQFALGIVMLLLGVAYAIWKNQTGDPTTQSTILSILIPGSAGYMLPKYWVNKRQ 828

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           Q+RQ  I+  +PD+LD++L+CVE+G S+DQ++ RVA ++      L+ E  L   E+   
Sbjct: 829 QERQQEIENGFPDSLDMMLVCVEAGQSLDQSIIRVARELKTGFPALAWEYELVAYEMKAG 888

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            ++    ++   R  ++ V +    LIQS ++GTSI ++LRV   E R +R+M AE+KA 
Sbjct: 889 KDKISVLKDMSERCGVNDVASFVTVLIQSQQFGTSIAEALRVYAGEMRDKRVMRAEEKAN 948

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +L  K+T+  ++  +P L++++IGP++  I DT+
Sbjct: 949 TLPTKMTLATMMLTVPPLLIILIGPSVFDIYDTL 982


>gi|332560332|ref|ZP_08414654.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
 gi|332278044|gb|EGJ23359.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
          Length = 326

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 132/252 (52%), Gaps = 4/252 (1%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRA--AGFRSEYSLNILLVVRLVVPIIFLIL 130
           R   S+ L  F   L  K    +E   ++L+   AG+RS+ ++      +  + + FL+ 
Sbjct: 70  RASGSEKLDRFANLLEPKT--AEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLVA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G+++            Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++
Sbjct: 128 GLLYAMVASAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMM 187

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           L+CVE+G S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  
Sbjct: 188 LVCVEAGQSLDQSILRVARESAAGYPALAEEFEMVAHEVKAGKERVAVLKDMSERVGIPD 247

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V +    LIQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L
Sbjct: 248 VSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPL 307

Query: 311 ILVIIGPAILSI 322
           +L++IGP++  I
Sbjct: 308 MLILIGPSVYGI 319


>gi|149915637|ref|ZP_01904163.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
 gi|149810529|gb|EDM70372.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
          Length = 328

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 138/257 (53%), Gaps = 1/257 (0%)

Query: 69  SSRLRT-RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           ++RLRT R ++ L  +   L  +       +   L  AG+R+  ++      +L + + F
Sbjct: 65  TTRLRTNRKNEKLDKYASFLEPQDAKALSQVRLTLLQAGYRTRDAVRYYHFAQLTLALGF 124

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L LG+++   +    E   Q  +  ++  G +G+  P  W++   Q+RQ  I   +PD+L
Sbjct: 125 LTLGVLYFLIFKSGGETSAQQTILYILGPGAIGYMLPKYWVTKRQQQRQEDITNGFPDSL 184

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++L CVE+G S+DQ++ RV+ +I      L+EE  +   ++    ++         R  
Sbjct: 185 DMMLTCVEAGQSLDQSIVRVSNEIAASYPALAEEYQIVANQIKAGRDKPSVLNEMAERCG 244

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  + +    L+QS  +GTSI D+LRV   E R +R+M AE+KA  L  K+T+  ++  +
Sbjct: 245 VQDISSFVTVLVQSQTFGTSIADALRVYAGEMRDKRVMRAEEKANKLPTKMTLATMMLTV 304

Query: 308 PVLILVIIGPAILSIID 324
           P L+++++GP+++ I++
Sbjct: 305 PPLLIILVGPSVIGILE 321


>gi|288956974|ref|YP_003447315.1| type II secretion system [Azospirillum sp. B510]
 gi|288909282|dbj|BAI70771.1| type II secretion system [Azospirillum sp. B510]
          Length = 334

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 139/248 (56%), Gaps = 1/248 (0%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           +S    +  L +        I  +L  AGFR   ++++ L  +LV  +  + L ++ + G
Sbjct: 85  RSAHGILGSLAMANAAEQARIRQRLLNAGFRDPETVSLFLTAKLVFGLAAIALAMVAVLG 144

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
           +D L+      R GA+I   Y G   P   ++ L ++RQS+I R  PDALDLL+IC  +G
Sbjct: 145 FD-LVSGGAVPRFGAIIAAAYAGTILPERILALLAKRRQSAIARTLPDALDLLIICANAG 203

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
            S+D +L RV  ++   +  +SEE+++T  EL  L +R+ A  N   R  ++ +R+    
Sbjct: 204 YSLDLSLARVGREMRLAARAMSEELVITADELRVLTDRREALRNLAERNDLEALRSLVAT 263

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L+Q+ +YGT +  +LR L +E R  R+M  E++AA L   ++VP+++  LP + +++ GP
Sbjct: 264 LLQAQKYGTPLTQALRTLAAEMRHARMMAIEERAARLPALISVPLMVLILPAVFIIVAGP 323

Query: 318 AILSIIDT 325
           A++ +  T
Sbjct: 324 AVIQVART 331


>gi|148253057|ref|YP_001237642.1| hypothetical protein BBta_1517 [Bradyrhizobium sp. BTAi1]
 gi|146405230|gb|ABQ33736.1| putative membrane protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 320

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 133/223 (59%), Gaps = 9/223 (4%)

Query: 109 SEYSLNILLVVRLVVPIIFLIL----GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           ++ +++  +V R+V  + F  L     + W F   +     + L + A I+   VG+ +P
Sbjct: 99  ADRAMSYFVVARVVFALSFATLTAAAAVHWAFSGAR-----WWLPIMAAIVAAIVGWISP 153

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
             +I ++V+++  ++    PDAL+LL++CVE+G+S+++ L RVA ++      L++E++L
Sbjct: 154 IFYIDHVVRQQTKAVASGLPDALELLVVCVEAGLSLEEGLHRVAHELREAQPALADELVL 213

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T AE++ LP+R  A  NF  R  +  VR+    L QS + GT +  SLRV   E R++++
Sbjct: 214 TWAEINVLPSRAQALTNFAARNDIPSVRSVVSMLSQSLQLGTPLAQSLRVGAVEMRNDQM 273

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           M  E++A+ L   LT+P+++F +P + L++ GPA L +ID  +
Sbjct: 274 MLLEERASRLPAMLTIPVMLFIMPTVFLLVGGPAALRLIDMFQ 316


>gi|260431089|ref|ZP_05785060.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414917|gb|EEX08176.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 327

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 129/224 (57%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG+ S+ ++      +  + II +++G++ +  +    E+  Q  +  V++ G +G
Sbjct: 98  KLRQAGYVSKDAVRFFHFAQFSLGIIGIVIGVLLVTVFSNGQEFSGQQVLIRVLVPGAIG 157

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+  V++R+ +I   +PD LDL+L+CVE+G S+DQA+ RVA ++      +++
Sbjct: 158 YYLPKYWITRRVEERKEAITAGFPDTLDLMLVCVEAGQSLDQAIVRVASEMKSSYPDIAQ 217

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+    ++     +F  R  +  V +    +IQS  +GTSI D+LRV   E R
Sbjct: 218 EFEIVAYEMKAGKDKNQVLRDFGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMR 277

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            +R+M AE+ A  L  K+T+  ++  +P L+++++GP+   I++
Sbjct: 278 DKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVGPSAKGIME 321


>gi|126461326|ref|YP_001042440.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638311|ref|YP_002524573.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
 gi|126102990|gb|ABN75668.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159092|gb|ACM00072.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
          Length = 326

 Score =  132 bits (331), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 4/252 (1%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRA--AGFRSEYSLNILLVVRLVVPIIFLIL 130
           R   S+ L  F   L  K    +E   ++L+   AG+RS+ ++      +  + + FL  
Sbjct: 70  RASGSEKLDRFANLLEPKT--AEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLAA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G+++            Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++
Sbjct: 128 GLLYAMVASAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMM 187

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           L+CVE+G S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  
Sbjct: 188 LVCVEAGQSLDQSILRVARESAAGYPALAEEFEMVAHEVKAGKERVAVLKDMSERVGIPD 247

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V +    LIQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L
Sbjct: 248 VSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPL 307

Query: 311 ILVIIGPAILSI 322
           +L++IGP++  I
Sbjct: 308 MLILIGPSVYGI 319


>gi|126737249|ref|ZP_01752984.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721834|gb|EBA18537.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 146/262 (55%), Gaps = 1/262 (0%)

Query: 64  QKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           +K ++  RLR  D ++ L+ F   L  +       +  KLR AG+ S+ ++      +L 
Sbjct: 55  RKSASKERLRQNDRNEQLQKFATFLEPQDAEELSAMELKLRQAGYLSKDAVRFFFFAQLA 114

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + +I L  G+ +++  +  + +  Q  +  ++  G VG+  P  W++  V++R+  I++ 
Sbjct: 115 LALIGLAGGMFYVYVLNADMTFDTQQLLIRIVGPGAVGYMLPKYWVTRRVEERRQKIEQG 174

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PD+LD++L+CVE+G S+DQ++ RVA ++      L+ E  +   E+    +++    + 
Sbjct: 175 FPDSLDMMLVCVEAGQSLDQSIVRVATELRASFPDLAYEFEIVAQEMKAGKDKEKVLRDM 234

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  + +    +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  
Sbjct: 235 GTRCGVQDISSFVTVMIQSQSFGTSIADALRVYAGEMRDKRVMRAEEAANKLPVKMTLAT 294

Query: 303 IIFFLPVLILVIIGPAILSIID 324
           ++  +P L+++++GP++  I++
Sbjct: 295 MMLTVPPLLIILVGPSVQGILN 316


>gi|149200852|ref|ZP_01877827.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
 gi|149145185|gb|EDM33211.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
          Length = 326

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 149/282 (52%), Gaps = 11/282 (3%)

Query: 54  ILRKQQ--ITSLQKDSASSRLRTRDSKSLRNFV--KKLNLKAILVD-------ENIVNKL 102
           +LR++Q  +  L++++  S        SLR  V  KKL+  A  ++         I  KL
Sbjct: 39  MLRQKQDPLEKLKQENQRSSTSVGTKTSLRAGVQNKKLDRYATFLEPQDAKQLSQIRLKL 98

Query: 103 RAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
             AG+R   ++      +  + +  LILG+I+        E   Q  +  ++    +G+ 
Sbjct: 99  MQAGYRHRDAVRYFHFAQFALGVGLLILGVIYYVLVKSGTETSTQETLMYILGPAGIGYM 158

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P  W++   QKRQ  I+  +PD+LD++L+C+E+G S+DQ++ RVA ++      L++E 
Sbjct: 159 MPKYWVTKRQQKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALADEF 218

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +   ++    ++         R  +  + +    L+QS  +GTSIG++LRV   E R +
Sbjct: 219 EIVALQIKAGRDKPSVLGEMAERCGVQDISSFVTVLVQSQTFGTSIGEALRVYAGEMRDK 278

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R+M AE+KA  L  K+T+  ++  +P L+++++GP++L I+D
Sbjct: 279 RVMRAEEKANKLPTKMTLATMMLTVPPLLIILVGPSVLGIMD 320


>gi|77462448|ref|YP_351952.1| putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
 gi|77386866|gb|ABA78051.1| Putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
          Length = 326

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 4/252 (1%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRA--AGFRSEYSLNILLVVRLVVPIIFLIL 130
           R   S+ L  F   L  K    +E   ++L+   AG+RS+ ++      +  + + FL  
Sbjct: 70  RASGSEKLDRFANLLEPKT--AEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLAA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G+++            Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++
Sbjct: 128 GLLYAMVASAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMM 187

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           L+CVE+G S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  
Sbjct: 188 LVCVEAGQSLDQSILRVARESAAGYPALAEEFEIVAHEVKAGKERVAVLKDMSERVGIPD 247

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V +    LIQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L
Sbjct: 248 VSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPL 307

Query: 311 ILVIIGPAILSI 322
           +L++IGP++  I
Sbjct: 308 MLILIGPSVYGI 319


>gi|126725975|ref|ZP_01741817.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
 gi|126705179|gb|EBA04270.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
          Length = 318

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 144/273 (52%), Gaps = 20/273 (7%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEY 111
           R  LR+++  + Q D  S  L+ +D   L                 +  KL  AG+ S+ 
Sbjct: 60  RTSLRQKRNKADQLDKYSEFLQPKDEGQL---------------SEMRLKLLQAGYSSKS 104

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGY--DKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
           ++     ++  + II LI G I+ F    D+       + +G     G  G+  P  W++
Sbjct: 105 AVQTFHFLQFALGIIGLIFGCIYAFTMLPDETTSKQMLMYIGGP---GGAGYMLPKYWVT 161

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
                RQ +I +A+PD+LDL+LICVESG S+DQA+ +V+++I      L++E  L   E+
Sbjct: 162 RRRGTRQKNIIQAFPDSLDLMLICVESGQSLDQAIIKVSKEIRAGYPDLADEFELVAYEI 221

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
               +++   ++F  R  +  + +    LIQ+  YGT I ++LR   +E R +R+M AE+
Sbjct: 222 KAGKDKKRVLKDFSERCGVPDISSFVSVLIQAATYGTPIAEALRAYSAEMRDKRVMRAEE 281

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           KA +L  K+T+  ++F LP L+++++GPA+  I
Sbjct: 282 KANTLPVKMTLGTMVFCLPSLLIILVGPAVYKI 314


>gi|77919352|ref|YP_357167.1| Flp pilus assembly protein TadC [Pelobacter carbinolicus DSM 2380]
 gi|77545435|gb|ABA88997.1| Flp pilus assembly protein TadC [Pelobacter carbinolicus DSM 2380]
          Length = 326

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 167/323 (51%), Gaps = 10/323 (3%)

Query: 4   YFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
           Y+  L +A   AV I T +++  ++  + +  L     E+R++ +    +I  K++   L
Sbjct: 8   YYRLLENAGYWAVLILTFLTVALIVMGIYLLFLRKSREEERLEKLLPSSKIPFKKKPKLL 67

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           + +       TR +K +   V     K   + ++I  +L  AG+RS  +    +  ++++
Sbjct: 68  EGEGNG--FVTRFAKPIDEIVAN---KPGALHKSIRLRLIQAGWRSNAAYYNFITTKVLL 122

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            +IF +  +I  F +   L++     + A+I     GF  P   +  +V+ RQ+ I RA 
Sbjct: 123 GLIFPLSYLISRFFFTFSLQFVLLCLLLAII-----GFGLPDSILGFVVRSRQNRIMRAL 177

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDL+++CVE+G+ +D   RRV E+I   S  LS+E  LT  E+     R   F+N  
Sbjct: 178 PDALDLMVVCVEAGLGLDMTFRRVGEEIRPLSHDLSDEFHLTNLEIRAGKPRNECFKNMS 237

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +  V N    LIQ+ R+GTS+  +LRV     R +R   AE+KAA    KL  P++
Sbjct: 238 LRTGVPEVSNLMTILIQTSRFGTSLAKALRVHSDAMRIKRRQIAEEKAAKSTVKLIFPLV 297

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
            F  P + +V++GP ++ II+ +
Sbjct: 298 FFIFPAIFVVLVGPGVIRIINVL 320


>gi|254463054|ref|ZP_05076470.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2083]
 gi|206679643|gb|EDZ44130.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 323

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 147/273 (53%), Gaps = 9/273 (3%)

Query: 57  KQQITSLQKDSASSRLRT-RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           K+Q+          RLR  + +K L  + K L  K       I  KL  AG+R + ++ +
Sbjct: 51  KEQMQGKAAGEDRQRLRAAKGNKQLGKYAKLLEPKDEAEYSAIRLKLIQAGYRDKDAVRL 110

Query: 116 LLVVRLVVPIIFLILGIIW----IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
             ++++++ +IFL++G+++    I G +   +      +G     G  G+  P  WI+  
Sbjct: 111 FHLMQMILGVIFLVIGLLYYTFVISGENATTQQMLMYVLGP----GGAGYFLPKYWITRR 166

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           +  R+  I+  +PD+LD++L+CVE+G S+DQ++ RVA ++      L++E  +   E+  
Sbjct: 167 IDTRKEQIESGFPDSLDMMLVCVEAGQSLDQSIVRVAAELHHSYPFLADEYEIVAQEMKA 226

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
             ++     +   R  +  V +    LIQS  +GTSI ++LRV   E R +R+M AE+KA
Sbjct: 227 GKDKIAVLNDMSERCGVQDVASFVTVLIQSTSFGTSIAEALRVYAGEMRDKRVMRAEEKA 286

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
             L  K+T+  ++  +P L+++++GP+++ I +
Sbjct: 287 NKLPTKMTLATMMLTVPPLLIILVGPSVVGITE 319


>gi|85705157|ref|ZP_01036257.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670479|gb|EAQ25340.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 325

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 125/223 (56%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL  AG+R   ++      +  + I  LILG+I+   +    E   Q  +  ++    +G
Sbjct: 95  KLMQAGYRHRDAVRYFHFAQFALGIGLLILGVIYYVLFKSGTETSTQETLMYILGPAGIG 154

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+   QKRQ  I+  +PD+LD++L+C+E+G S+DQ++ RVA ++      L+E
Sbjct: 155 YMMPKYWITKRQQKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALAE 214

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   ++    ++         R  +  + +    ++QS  +GTSIG++LRV  +E R
Sbjct: 215 EFEIVSLQIKAGRDKPSVLNEMAERCGVQDITSFVTVMVQSQTFGTSIGEALRVYAAEMR 274

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            +R+M AE+KA  L  K+T+  ++  +P L+++++GP++L I+
Sbjct: 275 DKRVMRAEEKANKLPTKMTLATMMLTVPPLLIILVGPSVLGIM 317


>gi|167579124|ref|ZP_02371998.1| type II secretion system protein [Burkholderia thailandensis TXDOH]
          Length = 319

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (57%), Gaps = 4/233 (1%)

Query: 96  ENIVNKLR--AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
           EN   +LR   AG+RS  + ++    + V+ +      + ++FG   + + P+ +    +
Sbjct: 82  ENSPLRLRLINAGWRSPSAAHLYFAAKTVLALALPAAAMPFLFG-TAIADSPYSVS-AML 139

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++  
Sbjct: 140 VLIGAFGFYLPNAMLARRIASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRL 199

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SLR
Sbjct: 200 RSPVVADELGLMLLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLR 259

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           VL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 260 VLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 312


>gi|253996761|ref|YP_003048825.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983440|gb|ACT48298.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 312

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 107/170 (62%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +IL+  +G+  P+  +S+ +  R+  I  ++PDALDL+++CVESG+ +D AL RV E++ 
Sbjct: 132 LILLAAIGYFLPNAVLSHRIDSRKREIFESFPDALDLIIVCVESGLGLDAALARVGEEMH 191

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  L EE+ L   EL    +R+ A  N   RT ++ V      L+QSDR+GT+I DSL
Sbjct: 192 VRSPTLGEELHLINLELRAGSSRERALRNLALRTGVEEVDTLVAMLVQSDRFGTNISDSL 251

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           RV     R++R + AE+ AA +  KL  P+I F  P ++LV++GPA ++I
Sbjct: 252 RVHADSLRTKRRLLAEEAAAKIAVKLLFPLIFFIFPSMLLVLLGPAFINI 301


>gi|283779212|ref|YP_003369967.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437665|gb|ADB16107.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 329

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 167/329 (50%), Gaps = 18/329 (5%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVV-----IPSLGSGELEKRMKSVAVEREILRKQQI 60
           F  F A+     I   +++F LI A+V       S  +   E+R++    +  I RK++ 
Sbjct: 3   FTTFFASLQLSPIMVQIAVFGLIAALVWVAVDFFSARNSRAEQRLEDY--KDPIARKRRE 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            + +K  + +  R  ++ S     K L  K      N+  KL  AGFR E +  I L  +
Sbjct: 61  EAAKKGGSDAMTRMLEAAS-PALAKPLQPKTAKEATNLKMKLSYAGFRGEGAPQIFLGAK 119

Query: 121 LVVPIIFLILG---IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
            V  II L LG    + I G         Q  +  V+LI    F  P   +  L +KR+ 
Sbjct: 120 FVCLIIGLFLGGGTTVAIMGLS-------QGALMRVVLIAGGMFYFPDGIVWWLGRKRKE 172

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           SI    PDALDL+++CVE+G+ +DQA+R+V+E++      ++EE  L   +L     R  
Sbjct: 173 SIFLGLPDALDLMVVCVEAGLGLDQAMRKVSEEMRKSYRVIAEEFSLCNLQLQMGRGRTQ 232

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
             +   +R+ +D +++ +  LIQ+D++G+SI  +LRV     R+ R   AE+KAA    K
Sbjct: 233 VLQELGSRSGVDDLKSLSSILIQADKFGSSIAQALRVQSDAMRTRRRQIAEEKAAKTAVK 292

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           L  P+++F  P + +V++GPA ++++  M
Sbjct: 293 LIFPLVLFIFPGIFVVLVGPAAITMVREM 321


>gi|330811031|ref|YP_004355493.1| type II secretion system protein; membrane protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379139|gb|AEA70489.1| putative type II secretion system protein; putative membrane
           protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 321

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 126/221 (57%), Gaps = 4/221 (1%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L  AG+RS  ++ +   VRL++P++ + + ++ +     +++    + + AV L+  +G+
Sbjct: 98  LTHAGYRSASAVQMYWAVRLMLPLLMVGVALLLL----PMVKVSVAIGLLAVTLVAGIGW 153

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P++++    Q RQ  ++ A+PDALDL+++CVESG+++   + RVAE++    V L+EE
Sbjct: 154 LLPAIYVGKRKQARQGRLRAAFPDALDLMVVCVESGLALPTTIERVAEEMSVSQVELAEE 213

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           + L  A++        A +    RT ++ ++     L QS R+GTS+ D+LR+   E R 
Sbjct: 214 LALVNAQIRAGITSTEALKQLAVRTGLEDIQGLVSLLAQSIRFGTSVADTLRIYADEFRD 273

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R   AE+  A +G KL  P+I    P   LV IGPA++ +
Sbjct: 274 RRTQAAEEMGAKIGTKLIFPLIFCLWPSFFLVAIGPAMIGV 314


>gi|187919329|ref|YP_001888360.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717767|gb|ACD18990.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 318

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 104/171 (60%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+    +GF  P+V +  LV+ RQ  +    PDALDL+ +CVE+G+ +D A+ RV ++IG
Sbjct: 135 VLAASALGFYLPNVVMRRLVESRQRKLFEDLPDALDLMTVCVEAGLGLDAAMLRVTQEIG 194

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  L +E  + + EL     R+ A  N   RT ++ +      LIQ+DR+GTS+GDSL
Sbjct: 195 VKSHALKDEFDMVLLELRAGSGREKALRNLSLRTGVEDIDTLAAMLIQADRFGTSVGDSL 254

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           RV     R++R + AE++AA +  KL  P++ F  P L+ V++GP+ + I+
Sbjct: 255 RVYTDNLRTKRRLRAEEQAAKIALKLLFPLMFFIFPTLLAVLVGPSAIQIV 305


>gi|116620536|ref|YP_822692.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223698|gb|ABJ82407.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 315

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 123/220 (55%), Gaps = 8/220 (3%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP-FQLR-VGAVILIGYVGFC 162
           AGFR E +L +   VR++  +  LIL ++      ++   P  QL  +G+ I  G++   
Sbjct: 90  AGFRGENALAVFYGVRILTTLGMLILCVMM---EARMPPNPVMQLGLMGSGICAGWI--- 143

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P  ++   V KRQ +++ + PDALDLL++ +E+G+ +DQA++ VA ++      LS+EM
Sbjct: 144 LPRFFLEKRVAKRQETLRLSLPDALDLLVVSIEAGLGLDQAIQHVARELYASHPQLSDEM 203

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            L   E+     R  A  NF  RT     R     LIQ+DR+GTS+G+SLR      R+ 
Sbjct: 204 QLVTLEMRAGKRRSEALRNFAERTGEAEFRKLVAILIQNDRFGTSMGESLRTHSDFLRTR 263

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R  EAE++A  +G KL  P+  F LP +++V  GP IL I
Sbjct: 264 RRQEAEERAGKVGVKLVFPIFFFILPSMLVVAAGPGILQI 303


>gi|118581108|ref|YP_902358.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
 gi|118503818|gb|ABL00301.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
          Length = 302

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 156/319 (48%), Gaps = 32/319 (10%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L+VA+  +++++ L+          GEL++R++ +  E     KQ  T+  +D    R+ 
Sbjct: 11  LSVAMVVSLALYPLLTK-------KGELQERLEKMMPE-----KQASTTFSEDKPWWRIT 58

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
             D  +      K   K           L AAGFR E SL + L  +L +    LIL  I
Sbjct: 59  IEDLGAKLPVAAKEQTK-------YTRMLVAAGFRKE-SLYLFLGSKLALA---LILPGI 107

Query: 134 WIFGY----DKLLE-YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +IF Y      L+E  P     G  I     GF  PS W+   V  R++ I    PD LD
Sbjct: 108 YIFTYALPKGVLMEPEPLLYTTGLAI----AGFLLPSGWLMYKVNNRKTEIFHTLPDILD 163

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL + VE+G+ ID AL R  E    +  PL+EE+ +   E+     R  A  +   RT +
Sbjct: 164 LLTVSVEAGLGIDAALNRACESPQFKGNPLAEELKIAAREIRAGKPRGDALRDMAERTDV 223

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + VR     L+Q++R+GTS+  +LRV     R++R   AE++AA    K+  P+I+F  P
Sbjct: 224 EDVRAFVTMLVQTERFGTSLSLALRVHSDSLRTKRRQIAEERAAKTAIKILFPLILFIFP 283

Query: 309 VLILVIIGPAILSIIDTMK 327
            L++++IGPA   ++D  K
Sbjct: 284 ALMIILIGPAFFKLMDIFK 302


>gi|217978831|ref|YP_002362978.1| type II secretion system protein [Methylocella silvestris BL2]
 gi|217504207|gb|ACK51616.1| type II secretion system protein [Methylocella silvestris BL2]
          Length = 320

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 111/170 (65%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG+  P+++I+  V++R  +     PDAL+LL++CVE+G+S++ AL+RVA+++      L
Sbjct: 148 VGWILPAIFIAFGVRRRTKAAAAGLPDALELLVVCVEAGLSLEDALQRVAQELKNSQPAL 207

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E+ LT AE++ LP+R+ A  N  +R  +  V++    + QS RYGT +  SLRV  +E
Sbjct: 208 ADELTLTWAEINILPSREQALANLADRVNVPTVKSMVSMISQSMRYGTPLAQSLRVGATE 267

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R++++   E++A  L   +T+P+++F +P L L++ GPA L +ID  + 
Sbjct: 268 MRNDQMTLLEERANRLPALMTIPVMLFIMPTLFLIVGGPAALRLIDMFRS 317


>gi|167840869|ref|ZP_02467553.1| hypothetical protein Bpse38_29619 [Burkholderia thailandensis
           MSMB43]
          Length = 279

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 133/233 (57%), Gaps = 4/233 (1%)

Query: 96  ENIVNKLR--AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
           EN   +LR   AG+RS  + ++    + V+ +    + + ++ G   L + P+ +    V
Sbjct: 42  ENSPLRLRLINAGWRSPGAAHLYFAAKTVLALTLPAVAMPFMIG-TALGDNPYAVSA-MV 99

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +LIG  GF  P+  +S  ++ RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++  
Sbjct: 100 LLIGGFGFYLPNAMLSRHIRLRQRKIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRL 159

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +S  +++E+ L + E+     +  A  N   RT  + V      LIQ+DR+GTSIG SLR
Sbjct: 160 RSPIVADELGLMLLEIRSGFAKDAALRNLALRTGAEDVDAFCAMLIQADRFGTSIGASLR 219

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           VL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 220 VLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 272


>gi|113866736|ref|YP_725225.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525512|emb|CAJ91857.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 324

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 129/218 (59%), Gaps = 2/218 (0%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+R+  +  +    + V+ I   ++G++   G   L +      + AV+  G +G+  P
Sbjct: 96  AGWRNASAAPLYFAAKTVLAIALPMIGLLAAAGQPGLQDRNIMFALLAVL--GAIGYYLP 153

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           +V ++  V +RQ ++   +PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L
Sbjct: 154 NVVLARKVAQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQL 213

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + EL    +++ A  N   RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R 
Sbjct: 214 MLLELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRR 273

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           M AE++AA +  KL  P+I    P L+LV++GPA + I
Sbjct: 274 MRAEEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|225872758|ref|YP_002754215.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225793390|gb|ACO33480.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 299

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 134/247 (54%), Gaps = 12/247 (4%)

Query: 77  SKSLRNFVKKLNLKAILVD-ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            KS+ + +K L +   +V+ + + ++  AAG R    + + L  RL+ P++ +++G    
Sbjct: 55  GKSMLHAMKGLRVTLGMVENQKLRDRFMAAGMRKPEHMELYLGARLLAPLLGVLIGTF-- 112

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                   +P    + AV L G  G+  P  W+   V+ R+  I R+ PDA+DLL+ICV+
Sbjct: 113 --------FPSNTFLWAVALAG-AGYLGPDFWLERKVKGRRHRISRSMPDAIDLLVICVD 163

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+ +DQA+ RV +++      ++EE L    E      R  A++ F  RT++  ++N  
Sbjct: 164 AGLGLDQAMLRVGQELAVSHPEINEEFLQINREQRAGRPRVDAWKGFAERTRLPEIQNFV 223

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             L+Q++R+GT I  +L       R +R   AE+KAA    K+  P+++F  P + +V++
Sbjct: 224 SMLVQTERFGTPITRALNTFSDSMRLKRKQIAEEKAAKTTVKMLFPLVLFIFPCIFIVLL 283

Query: 316 GPAILSI 322
           GPA ++I
Sbjct: 284 GPAFITI 290


>gi|126733578|ref|ZP_01749325.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
 gi|126716444|gb|EBA13308.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
          Length = 321

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 131/227 (57%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW-IFGYDKLLEYPFQLRVGAVILIGYV 159
           KL  AG+RS  ++ I   ++  + I  L+ G  + +      +E   Q  V  +++ G  
Sbjct: 94  KLLQAGYRSTNAVRIYNFMQFALGIFGLLCGGAYSLIQMSGTVEVTTQQLVMWIMIPGGA 153

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P  W++   Q RQ +I+ A+PD+LD++L+CVE+G S+DQ++ RVA ++      L+
Sbjct: 154 GYLLPKYWVTRRQQMRQEAIENAFPDSLDMMLVCVEAGQSLDQSIIRVARELKSGFPELA 213

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           EE  +   E     ++    ++  +R  +  + +    L+QS ++GTSI D+LRV  +E 
Sbjct: 214 EEFEIVSQEAKAGKDKNTVLKDMSDRCGVPDIASFVTVLVQSSQFGTSIADALRVYSAEM 273

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           R +R+M AE+KA  L  K+T+  ++  +P L+ ++IGP+I +I+ ++
Sbjct: 274 RDKRVMRAEEKANKLPTKMTLATMMLTVPPLMAMLIGPSIYAIVTSL 320


>gi|254486075|ref|ZP_05099280.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214042944|gb|EEB83582.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 308

 Score =  129 bits (323), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 144/269 (53%), Gaps = 5/269 (1%)

Query: 57  KQQITSLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKL--RAAGFRSEYSL 113
           K+  T   +  +  RLR  D ++ L+ F K L  + +  DE    +L  R AG+ S  ++
Sbjct: 37  KRSQTEPSERPSQQRLRQSDRNEQLQKFAKFLEPENL--DELTAKQLMLRQAGYSSRDAV 94

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
                 ++ + I  L+ GI+++           Q  +   +  G +G+  P  W++  V+
Sbjct: 95  RFFHFAQMALGIGGLVFGIVYVNFLGGGEGLTTQKMMMYTVGPGGIGYYLPKYWVTKRVE 154

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           KR+  I R +PDALD++L+CVE+G S+DQ++ RVA+++      L+EE  +   E+    
Sbjct: 155 KRKEEITRGFPDALDMMLVCVEAGQSLDQSIVRVAKELHASYPALAEEFEVVAYEMKAGK 214

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           ++     +  +R  +  V +    L QS  +GTSI D+LRV   E R +R+M AE+ A  
Sbjct: 215 DKVGVLTDMGDRCGVQDVSSFVTVLCQSAAFGTSISDALRVYAEEMRDKRVMRAEEAANK 274

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L  K+T+  ++  +P L+++++ P++++I
Sbjct: 275 LPTKMTLATMMLTVPPLLIILVAPSVMNI 303


>gi|194335919|ref|YP_002017713.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308396|gb|ACF43096.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 316

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 165/308 (53%), Gaps = 11/308 (3%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           + +  ++ SL++A++   + +  L+KR+  +  +    R    TSL K + + ++ T   
Sbjct: 11  VLSGAAVASLVFALLNWLVDNNALKKRLTKIIRQS---RAPAATSLSKTANTGKVAT--- 64

Query: 78  KSLRNFVKKLNLKAILVDENIVN-KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
             + N + KL+L       + V  K   AG R++ +      V+ +  ++  ++  +++ 
Sbjct: 65  --VINILSKLSLPEEGWQSSGVQIKFLQAGIRNKNAPQNFFAVKTLFTLVLPVVLALFLH 122

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
               L+  P    +  V+     G+  P + +  + Q R   ++ + PD LDL+++C ES
Sbjct: 123 FTQPLM--PLARVMILVLFTAAAGYYLPEMLLRFITQNRIERMRNSLPDMLDLMVVCTES 180

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+ ID A+ R++ ++   +  L+EE  L+  E+    NR  A  N   R+++D ++N   
Sbjct: 181 GMGIDAAIARISREMVRTNPDLAEEFYLSTLEMRAGANRIDALRNLALRSRLDDLQNLVS 240

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L+Q+DR+GTS+ DSLRV     R+ R   AE+ AA +  K+T+P+++F  PVL+LV++G
Sbjct: 241 VLVQADRFGTSLVDSLRVHSDMMRTCRTQRAEELAAKIPVKMTLPLVLFIFPVLMLVLLG 300

Query: 317 PAILSIID 324
           PAI+ +I 
Sbjct: 301 PAIIQVIQ 308


>gi|114764951|ref|ZP_01444124.1| Putative Flp pilus assembly protein TadC [Pelagibaca bermudensis
           HTCC2601]
 gi|114542663|gb|EAU45687.1| Putative Flp pilus assembly protein TadC [Roseovarius sp. HTCC2601]
          Length = 323

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 142/248 (57%)

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R +  L  + + L  K+      +  KL  AG+R+  ++ +  + ++V+ +  L+ G+ +
Sbjct: 68  RKNAKLNKYAQYLEPKSAEELGEVRMKLLQAGYRTRDAVRLYYLAQMVLGLGLLVAGLTY 127

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
              +    E   Q ++  +IL G +G+ AP  WI+  V++R+  I+  +PDALD++L+CV
Sbjct: 128 YLMFIDGPESTMQQKLMYIILPGALGYLAPKYWITKRVEERKKQIEEGFPDALDMMLVCV 187

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G S+DQ++ RV+++I      L++E  +   E+    ++     +   R  +  V + 
Sbjct: 188 EAGQSLDQSIVRVSKEIRASYAALADEFEIISHEMKAGKDKASVLNDMGERCGVADVSSF 247

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L Q+  +GTSI D+LR+  SE R +R+M AE+KA  L  K+T+  ++  +P L++++
Sbjct: 248 VTVLNQASTFGTSIADALRIYASEMRDKRVMRAEEKANKLPTKMTLTTMMLTVPPLLIIL 307

Query: 315 IGPAILSI 322
           +GP++++I
Sbjct: 308 VGPSVVNI 315


>gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722223|gb|ABC77166.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 317

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 104/171 (60%)

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
           +  VGF  P++W+   +  R+  I   +PDALDL++ICVE+G+ +DQA+ RV E++    
Sbjct: 144 LALVGFYLPNLWLRLKIGARKEKIMEGFPDALDLMVICVEAGMGLDQAINRVGEEMKLSC 203

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            P+S+E      E+    +R+ A  N  NRT++D V +    LIQ+D++GTSIG +LRV 
Sbjct: 204 PPISDEFRTLNMEMRMGKSRREALRNMANRTELDDVTSLVTLLIQTDQFGTSIGQALRVH 263

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               R +R   AE+KAA L  KL  P+I F  P L +VI+GPA++ +   +
Sbjct: 264 SDSMRVQRRQRAEEKAAKLPLKLLFPLIFFIFPSLFVVIMGPAMIQVFHAL 314


>gi|167617239|ref|ZP_02385870.1| type II secretion system protein [Burkholderia thailandensis Bt4]
 gi|257141112|ref|ZP_05589374.1| type II secretion system protein [Burkholderia thailandensis E264]
          Length = 319

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 133/233 (57%), Gaps = 4/233 (1%)

Query: 96  ENIVNKLR--AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
           EN   +LR   AG+RS  + ++    + V+ +      + ++ G   + + P+ +    +
Sbjct: 82  ENSPLRLRLINAGWRSPSAAHLYFAAKTVLALALPAAAMPFLIG-TAIADSPYSVS-AML 139

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++  
Sbjct: 140 VLIGAFGFYLPNAMLARRIASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRL 199

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SLR
Sbjct: 200 RSPVVADELGLMLLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLR 259

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           VL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 260 VLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 312


>gi|296156494|ref|ZP_06839332.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893093|gb|EFG72873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 318

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 103/171 (60%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+    +GF  P++ ++ LV+ RQ  +    PDALDL+ +CVE+G+ +D A+ RV ++IG
Sbjct: 135 VLAASALGFYLPNLVMTRLVESRQRKLFEDLPDALDLMTVCVEAGLGLDAAMMRVTQEIG 194

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  L +E  + + EL     R  A  N   RT ++ +      LIQ+DR+GTS+GDSL
Sbjct: 195 VKSHALKDEFDMVLLELRAGSGRDKALRNLSLRTGVEDIDTLAAMLIQADRFGTSVGDSL 254

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           RV     R++R + AE+ AA +  KL  P++ F  P L+ V++GP+ + I+
Sbjct: 255 RVYTDNLRTKRRLRAEELAAEIALKLLFPLMFFIFPTLLAVLVGPSAIQIV 305


>gi|163738365|ref|ZP_02145780.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742218|ref|ZP_02149606.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384548|gb|EDQ08929.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388286|gb|EDQ12640.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 326

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 143/271 (52%), Gaps = 1/271 (0%)

Query: 55  LRKQQITSLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
           L+K    S Q      RLR  D ++ L+ F   L  +       +  KLR AG++S+ S+
Sbjct: 50  LQKSMSASTQTKPKKERLRQADRNEQLQKFASFLEPQDAAELSKMELKLRQAGYQSKDSV 109

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
                 +  + +I L LG+ +++  +  +EY  Q  V  +I  G   +  P  WI+  ++
Sbjct: 110 RFFHFAQFALGLIGLALGLFYVYVLNADMEYDSQQMVIRIIGPGAAAYMLPKYWITRRIE 169

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           +R+  I   +PDALD++L+CVE+G S+DQA+ RVA+++      L++E  +   E+    
Sbjct: 170 ERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALADEFDIVAQEMKAGK 229

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           ++     +   R  +  V +    +IQS  +GTSI ++LRV   E R +R+M AE+ A  
Sbjct: 230 DKDKVMRDMGTRCGVQDVSSFVTVMIQSATFGTSIAEALRVYAGEMRDKRVMRAEEAANK 289

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           L  K+T+  +   +P L+++++GP+   I +
Sbjct: 290 LPTKMTLATMTLTVPPLLIILVGPSAQGIAN 320


>gi|115358176|ref|YP_775314.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115283464|gb|ABI88980.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 314

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 128/227 (56%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   +++ ++ ++L   ++F    I++     +L E+ F +R  A++    +G
Sbjct: 89  QLTRAGFRERRAVSAMIGIKLSCGVLFAGFAIVFSPYIPRLGEF-FVIRAVAMVGAFVIG 147

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+ +I   +PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 148 VIVPEYVLGAMIRRRRRTIAACFPDALDLLVICTMAGNSLASGVRRVARELQRICPPLAD 207

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R
Sbjct: 208 ELTVCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSER 267

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 268 TEQVVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 314


>gi|83718164|ref|YP_440464.1| hypothetical protein BTH_II2276 [Burkholderia thailandensis E264]
 gi|83651989|gb|ABC36053.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 296

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 133/233 (57%), Gaps = 4/233 (1%)

Query: 96  ENIVNKLR--AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
           EN   +LR   AG+RS  + ++    + V+ +      + ++ G   + + P+ +    +
Sbjct: 59  ENSPLRLRLINAGWRSPSAAHLYFAAKTVLALALPAAAMPFLIG-TAIADSPYSVS-AML 116

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++  
Sbjct: 117 VLIGAFGFYLPNAMLARRIASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRL 176

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SLR
Sbjct: 177 RSPVVADELGLMLLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLR 236

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           VL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 237 VLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 289


>gi|116748937|ref|YP_845624.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698001|gb|ABK17189.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 319

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 103/174 (59%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A      VGF  P +W+     +R+  ++R  PDALDL+++CVE+G+ ID A  RV+E++
Sbjct: 143 AACATALVGFYLPDLWLRLKTSRRRKQLRRGLPDALDLMVVCVEAGMGIDSATYRVSEEM 202

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
              + P+S+E+     EL     R+ A  N   RT ++ V + T  LIQ+D++GTS+  +
Sbjct: 203 KLTNAPMSDELKYLNLELRAGKARRDALRNLALRTDLEDVNSLTTLLIQTDKFGTSVAQA 262

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           LRV     R++R   AE+ AA L  KL +P+I+F  P L +VI+GPA++    T
Sbjct: 263 LRVHSDSFRTKRHQMAEELAAKLPVKLVLPLILFIFPSLFVVIMGPAMIRAFRT 316


>gi|254441173|ref|ZP_05054666.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251251|gb|EDY75566.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 326

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 129/227 (56%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL  AG+R++ ++      + ++ I+ L+ GI +        +      + +++  G  G
Sbjct: 96  KLIQAGYRTKSAVKTYHFTQFMLGIVLLVGGITYAIYNSATGDPTTNATIMSILGPGMAG 155

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  W+     +RQ  +   +PD+LD++L+CVE+G S+DQ++ RVA ++      L+E
Sbjct: 156 YYLPKWWVGKRQAERQLEMINGFPDSLDMMLVCVEAGQSLDQSIIRVAHELKSGFPALAE 215

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+    ++     +   RT +  + +    LIQS ++GTSI ++LRV  +E R
Sbjct: 216 EYQMVSHEMKAGKDKTQVLRDMAERTGVADISSFVTVLIQSQQFGTSIAEALRVFSAEMR 275

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            +R+M AE+KA +L  K+T+  ++  +P L++++IGP+I +I +T++
Sbjct: 276 DKRVMRAEEKANTLPTKMTLATMLLTVPPLLIILIGPSIYNIYETLQ 322


>gi|126729093|ref|ZP_01744907.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710083|gb|EBA09135.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 324

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 147/275 (53%), Gaps = 11/275 (4%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVD-------ENIVNKLRAAGF 107
           L K + TS +K  A +R   RD +  RN  +KLN  A  ++         I  KL  AG+
Sbjct: 45  LDKLKETSQKKMDAQARAVLRDKR--RN--EKLNKYAQFLEPQDAKELSEIKLKLLQAGY 100

Query: 108 RSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
           R++ ++ +   ++  + +  L  G  +   +    E     ++  ++  G VG+ AP  W
Sbjct: 101 RTKDAVQVYYFMQFALGLGMLAAGTGYYLFFVNPEEADMTTKLMYILGPGCVGYLAPKYW 160

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           I+  ++KR+  I++ +PDALD++L+CVE+G S++Q++ RVA+++      L++E  +   
Sbjct: 161 ITKRMEKRKEEIQQGFPDALDMMLVCVEAGQSMEQSIIRVAKELRASYPALADEFEIISH 220

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           E+    +R     +   R     V +    L Q+  +GTSI D+LRV   E R +R+M A
Sbjct: 221 EMKAGKDRSQVLNDMSERCGSQDVSSFVTVLNQAQTFGTSISDALRVYAGEMRDKRVMRA 280

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           E+ A  L  K+T+  ++  +P L+++++GP+ + I
Sbjct: 281 EEAANKLPTKMTLTTMMLTVPPLLIILVGPSAVGI 315


>gi|84687272|ref|ZP_01015152.1| type II/IV secretion system protein, TadC subfamily protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664705|gb|EAQ11189.1| type II/IV secretion system protein, TadC subfamily protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 324

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 111/186 (59%)

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
           E   Q  +  V++ G VG+ AP  W++  V  R+  I   +PDALD++L+CVE+G S+DQ
Sbjct: 136 ETSTQKMIMTVLIPGAVGYVAPKYWVTRRVDSRKEEITNGFPDALDMMLVCVEAGQSLDQ 195

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSD 262
           A+ RVA++I      L++E  +   E+    +R     +   R  +  V++    LIQS 
Sbjct: 196 AIIRVAKEIRAGYPALADEFEIVSWEIKAGKDRIQVLRDMGERCGVADVQSFVTVLIQST 255

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            +GTSI ++LRV   E R +R+M AE+KA +L  K+T+  ++  +P L++++IGP++  +
Sbjct: 256 SFGTSIAEALRVYAGEMRDKRVMRAEEKANTLPTKMTLATMMLTVPPLLIILIGPSVYEV 315

Query: 323 IDTMKD 328
             T+K+
Sbjct: 316 YKTLKN 321


>gi|89053483|ref|YP_508934.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863032|gb|ABD53909.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 326

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 102/170 (60%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI+ G VG+ AP  WI+   Q R+  I   +PDALDL+L+CVE+G S+DQA+ +VA +I 
Sbjct: 151 VIVPGVVGYYAPKYWITKRAQTREDQINSGFPDALDLMLVCVEAGQSLDQAIIKVANEIK 210

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
               PL+EE  +   E+    ++     +   R  +  V +    LIQS  +GTS+ ++L
Sbjct: 211 TSYPPLAEEFEIVSYEMKAGKDKTKVLRDMGERVGIQDVNSFITTLIQSSTFGTSVAEAL 270

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +V   E R +R+  AE+KA  L  KLT+  ++F +P L++++IGP+I  I
Sbjct: 271 KVYSDEMRDKRISRAEEKANKLPTKLTLFTMLFCVPPLLVILIGPSIYGI 320


>gi|126443620|ref|YP_001064084.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|167908138|ref|ZP_02495343.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
 gi|126223111|gb|ABN86616.1| type II secretion system protein [Burkholderia pseudomallei 668]
          Length = 319

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++ 
Sbjct: 139 LVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELR 198

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SL
Sbjct: 199 LRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASL 258

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RVL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 259 RVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 312


>gi|242311994|ref|ZP_04811011.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254265316|ref|ZP_04956181.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|242135233|gb|EES21636.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254216318|gb|EET05703.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 313

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++ 
Sbjct: 133 LVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELR 192

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SL
Sbjct: 193 LRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASL 252

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RVL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 253 RVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 306


>gi|53723215|ref|YP_112200.1| hypothetical protein BPSS2198 [Burkholderia pseudomallei K96243]
 gi|76819357|ref|YP_336475.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|126455503|ref|YP_001076997.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167744183|ref|ZP_02416957.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167821382|ref|ZP_02453062.1| type II secretion system protein [Burkholderia pseudomallei 91]
 gi|167829724|ref|ZP_02461195.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167851191|ref|ZP_02476699.1| type II secretion system protein [Burkholderia pseudomallei B7210]
 gi|167899821|ref|ZP_02487222.1| type II secretion system protein [Burkholderia pseudomallei 7894]
 gi|167916485|ref|ZP_02503576.1| type II secretion system protein [Burkholderia pseudomallei 112]
 gi|167924342|ref|ZP_02511433.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
 gi|217424204|ref|ZP_03455703.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226194113|ref|ZP_03789713.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237510430|ref|ZP_04523145.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254182575|ref|ZP_04889169.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|254187127|ref|ZP_04893642.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254192523|ref|ZP_04898962.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254296491|ref|ZP_04963947.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52213629|emb|CAH39683.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76583830|gb|ABA53304.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Burkholderia pseudomallei 1710b]
 gi|126229271|gb|ABN92684.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157806389|gb|EDO83559.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934810|gb|EDO90480.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169649281|gb|EDS81974.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|184213110|gb|EDU10153.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|217392669|gb|EEC32692.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225933806|gb|EEH29793.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002635|gb|EEP52059.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 319

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++ 
Sbjct: 139 LVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELR 198

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SL
Sbjct: 199 LRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASL 258

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RVL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 259 RVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 312


>gi|110679391|ref|YP_682398.1| TadC family type II/IV secretion system protein [Roseobacter
           denitrificans OCh 114]
 gi|109455507|gb|ABG31712.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter denitrificans OCh 114]
          Length = 355

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 143/275 (52%), Gaps = 17/275 (6%)

Query: 57  KQQITSLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           K+QI + + ++   RLR  + ++ L+ F   L  + +         LR AG++S+ ++  
Sbjct: 79  KRQIQTPETNAPEQRLRQGERNEQLQRFASFLEPQDVAELSARQLMLRQAGYQSQDAVRF 138

Query: 116 LLVVRLVVPIIFLILGIIWI--------FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
               +  + I  L+L  +++        F   K++ Y         I+ G VG+  P  W
Sbjct: 139 FHFAQFALGIAGLVLAFVYLNLLGHGEGFTTQKMMIY--------TIIPGAVGYYLPVYW 190

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +   V  R+  I R +PD+LD++L+CVE+G S+DQ + RV++++      L++E  +   
Sbjct: 191 VRRRVDARKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAY 250

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           E+    ++     +F  R  +  V +    L QS ++GTSI ++LRV   E R +R+M A
Sbjct: 251 EMKAGKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAEEMRDKRVMRA 310

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           E+ A  L  K+T+  ++  +P L+++++GP++  I
Sbjct: 311 EEAANKLPTKMTLATMMLTVPPLLIILVGPSVHGI 345


>gi|134281772|ref|ZP_01768479.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|134246834|gb|EBA46921.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 313

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++ 
Sbjct: 133 LVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELR 192

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SL
Sbjct: 193 LRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASL 252

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RVL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 253 RVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 306


>gi|194288828|ref|YP_002004735.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222663|emb|CAQ68666.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 324

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 129/218 (59%), Gaps = 2/218 (0%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+RS  +  +    + V+ +   +LG++ +    +  +   QL    + L+G  G+  P
Sbjct: 96  AGWRSASAAPLYFGAKTVLAVALPMLGLLAV--SSQPGQQSQQLMFALLALLGATGYYLP 153

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           +V ++  V +RQ ++   +PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L
Sbjct: 154 NVVLARKVSQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQL 213

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + EL    +++ A  N   RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R 
Sbjct: 214 MLLELRSGFSKEKALTNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRR 273

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           M AE++AA +  KL  P+I    P L+LV++GPA + I
Sbjct: 274 MRAEEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|325108941|ref|YP_004270009.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324969209|gb|ADY59987.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 310

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 154/287 (53%), Gaps = 13/287 (4%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
           +E+R++ +   R+  R+ + +S ++D   + L    +K+     K L  K  L +  +  
Sbjct: 33  VEERLEDI---RDPSRRFKESSAERDGVGNML----NKAAPTLSKALKPKTELEESALKI 85

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY-V 159
           ++  AGF S  +    L ++ +  I  L++G    FG+   L+Y         ++IG  +
Sbjct: 86  RMANAGFNSPNAPQAYLAIKFISMIGGLLVG--SSFGF---LQYGMTQNGWTAVVIGAGL 140

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P + ++ ++ KR+ +I    PDALDLL++CVESG+ +DQ + RV  ++   +  + 
Sbjct: 141 GFYLPELILAYVISKRKQAIFLTMPDALDLLVVCVESGLGLDQGMNRVTAELSDTAPEIC 200

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E  L   +L    NR+    +   RT +D ++     LIQ+DR+G+SI  +LRV     
Sbjct: 201 AEFSLCNFQLQMGRNRREVLHDLGVRTGVDDMKALAAILIQADRFGSSIAQALRVQSDSM 260

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           R +R+  AE+KA     ++  P+++F  P + +V++GPA +S++D++
Sbjct: 261 RVKRMQIAEEKAQKTAVQMIFPLVLFIFPGIFVVLVGPAAISMMDSL 307


>gi|167725257|ref|ZP_02408493.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 275

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++ 
Sbjct: 95  LVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELR 154

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +++E+ L + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SL
Sbjct: 155 LRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASL 214

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RVL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 215 RVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 268


>gi|73542334|ref|YP_296854.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119747|gb|AAZ62010.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 323

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 129/218 (59%), Gaps = 2/218 (0%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+RS  +  +    + ++ I   ++G+I +     L +    + +  + L+  +G+  P
Sbjct: 96  AGWRSTSAAPLYFTAKTILAIALPMIGLIAVSNQPALQQQ--HIMLALLTLLAAIGYYLP 153

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           +  +S+ V +RQ ++   +PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L
Sbjct: 154 NTVLSHKVAERQRAVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQL 213

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + EL    +++ A  N   RT ++ V      LIQ+DR+GTS+GDSLRVL    R++R 
Sbjct: 214 MLLELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGDSLRVLSDMLRTKRR 273

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           M AE++AA +  KL  P+I    P L+LV++GPA + I
Sbjct: 274 MRAEEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|224824220|ref|ZP_03697328.1| type II secretion system protein [Lutiella nitroferrum 2002]
 gi|224603639|gb|EEG09814.1| type II secretion system protein [Lutiella nitroferrum 2002]
          Length = 314

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 127/223 (56%), Gaps = 12/223 (5%)

Query: 105 AGFRSEYSLNILLVVR----LVVP-IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           AG+R + ++ +    +    L+ P I+FL LG+    G+     +   +     +L   +
Sbjct: 87  AGYRGQSAVPLFFGAKTFLALLFPTILFLYLGLTG--GHKDGTNFLLFM-----LLAAGI 139

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P++ +S  V+ RQ  I   +PDA+DLLL+CVE+G+ +D AL +V E++  +S  L+
Sbjct: 140 GYYLPNILLSRRVENRQREIFNNFPDAIDLLLVCVEAGLGLDAALLKVGEEMRIKSPILA 199

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+ L   EL     ++ A  N   RT +  V      LIQSDR+GTSIG+SLRV   + 
Sbjct: 200 DELHLVNLELRAGSTKERALRNLAIRTGVQEVDTLVAMLIQSDRFGTSIGESLRVHADDL 259

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R++R + AE+ AA +  KL  P+I    P L+LV++GPA + I
Sbjct: 260 RTKRRLRAEEAAAKIPLKLLFPLIFCIFPALLLVLLGPAFIQI 302


>gi|167566943|ref|ZP_02359859.1| type II secretion system protein [Burkholderia oklahomensis EO147]
 gi|167574012|ref|ZP_02366886.1| type II secretion system protein [Burkholderia oklahomensis C6786]
          Length = 318

 Score =  125 bits (314), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 133/233 (57%), Gaps = 4/233 (1%)

Query: 96  ENIVNKLR--AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
           EN   +LR   AG+RS  +  +    + V+ +      + ++ G + L + P+ L V  +
Sbjct: 81  ENSPLRLRLINAGWRSASAAPLYFAAKTVLALALPAAAMPFLIGTE-LADSPYILSV-ML 138

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           + IG  GF  P+  +S  +  RQ  I   +PDALDLL +C+E+G+ +D  L +VA+++  
Sbjct: 139 VTIGAFGFYLPNAVLSRRIASRQRVIVEDFPDALDLLTVCIEAGLGLDAGLMKVADELRL 198

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +S  +++E+ L + E+    +++ A  N   RT  + +   +  LIQ+DR+GTSIG SLR
Sbjct: 199 RSPVVADELGLMLLEMRSGFSKETALRNLALRTGAEDIDAFSAMLIQADRFGTSIGASLR 258

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           VL    R++R M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 259 VLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 311


>gi|94309584|ref|YP_582794.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353436|gb|ABF07525.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Cupriavidus metallidurans CH34]
          Length = 323

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 124/218 (56%), Gaps = 2/218 (0%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+R   +  +    + ++ +   ++G+I         E      V AV+    +G+  P
Sbjct: 96  AGWRDASAAPLYFAAKTLLAVALPMIGLIATSSVPAFQEQSTTFAVLAVL--AAIGYYIP 153

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           ++ +S  V  RQ ++   +PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L
Sbjct: 154 NIVLSRKVTARQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQL 213

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + EL    +++ A  N   RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R 
Sbjct: 214 MLLELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRR 273

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           M AE++AA +  KL  P+I    P L+LV++GPA + I
Sbjct: 274 MRAEEQAAKIALKLLFPLIFTIFPTLLLVLLGPAFIQI 311


>gi|17545369|ref|NP_518771.1| tight adherence TadC-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427661|emb|CAD14180.1| probable pilus assembly tadc transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 315

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 167/318 (52%), Gaps = 19/318 (5%)

Query: 16  VAITTAVSIFSLIYAVVIPSLG---SGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           V I      F++++  V+ +L       L++R+  +  +RE+ R Q      +D    R 
Sbjct: 4   VHIVLLAGTFAIVFGAVLAALTLLRPSTLDRRLGQI--DRELPRSQP-----RDDGRDRA 56

Query: 73  RTRDSKSLRNFVKKLNL-KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI---IFL 128
             R  + L   + K +L K      ++  +   AG+R+  ++ +   ++ ++     + L
Sbjct: 57  WLRRLEQLAKPLAKASLPKEGWEGSSLRQRFVHAGWRAPEAIAVYFGIKTILTFGLPLLL 116

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
             G++  F  D+  ++   L  GA +    VGF  P+V +S  ++ RQ  I  ++PD+LD
Sbjct: 117 WAGLVGRFNADQQSQF-MSLLFGAAV----VGFYLPNVLLSLKIKYRQREIFESFPDSLD 171

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+S+D A+ RV +D+      ++EE  L   EL    +R+ A  N   RT +
Sbjct: 172 LIMVCVEAGLSLDAAILRVVDDMRTARPVMAEEYELLTLELRAGLSREKALRNLAARTGV 231

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V      LIQ+DR+GTS+ DSLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 232 DDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERAAKIGTKVLFPLIFCIFP 291

Query: 309 VLILVIIGPAILSIIDTM 326
            L +V++GPA L +I  +
Sbjct: 292 SLYVVLLGPAALQMIAAL 309


>gi|171320623|ref|ZP_02909643.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171094136|gb|EDT39223.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 314

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 128/227 (56%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   +++ ++ ++L   ++F  L I++     +L E+ F +R  A++    +G
Sbjct: 89  QLTRAGFRERRAVSTMIGIKLSCGVLFAGLAIVFSPYIPRLGEF-FVIRAVAMVGAFVIG 147

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 148 VIVPEYVLGAVIRRRRRIIAACFPDALDLLVICTMAGNSLASGVRRVARELERICPPLAD 207

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R
Sbjct: 208 ELTVCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSER 267

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 268 TEQVVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 314


>gi|254511547|ref|ZP_05123614.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221535258|gb|EEE38246.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 325

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 138/256 (53%), Gaps = 5/256 (1%)

Query: 71  RLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           RLRT   ++ L  F   L  K       +  KLR AG++S+ ++      +  + I+ ++
Sbjct: 67  RLRTASRNEQLEKFANFLEPKDQEEYSAVQLKLRQAGYQSKDAVRFYHFAQFALGIVGIL 126

Query: 130 LGI--IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           +G+  + +F  D+  E+     +  V++ G VG+  P  WI+  V++R+ +I   +PD L
Sbjct: 127 IGVSLVTVFAGDQ--EFDSTQLLIRVLVPGVVGYFVPKYWITRRVEERKEAIVNGFPDTL 184

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+L+CVE+G S+DQA+ RVA ++      ++ E  +   E+     +     +F  R  
Sbjct: 185 DLMLVCVEAGQSLDQAIVRVAAEMKASYPDIALEFEVVAYEMKAGKEKDTVLRDFATRCG 244

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V      +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +
Sbjct: 245 VQDVSAFVTVMIQSAAFGTSIADALRVYSDEMRDKRVMRAEEAANKLPTKMTLATMMLTV 304

Query: 308 PVLILVIIGPAILSII 323
           P L+++++GP+   I+
Sbjct: 305 PPLLVILVGPSAKGIM 320


>gi|302343414|ref|YP_003807943.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301640027|gb|ADK85349.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 305

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 121/222 (54%), Gaps = 4/222 (1%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AGFRS  +LN+   VRL     FL+  I++  G   L++      V + ++   +G+  P
Sbjct: 87  AGFRSVEALNVFTGVRLAA--AFLLPAIVFALGV--LIQAKRPAMVISTLIAAALGYLGP 142

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
              +  L  +R + I R  P  LDLL+I VESG+ +D A++RV+ D+   S  L+ E+ +
Sbjct: 143 GYVLEKLALRRSALIARQMPSMLDLLVIAVESGLGLDAAVQRVSRDLAASSPVLAHELAI 202

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
              EL     R  A  N   R  +D +      LIQ+DR+G SIG S+RV   + R++R 
Sbjct: 203 FSLELKLGAARGDALRNLAKRCGVDEMAGLVAMLIQADRFGVSIGRSIRVFADDLRTKRR 262

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            + E++AA +  KL  P++    P ++ V+ GPA+++I++ M
Sbjct: 263 QKLEEQAAKIPLKLLFPVLFLIFPAIMAVMAGPAVINIVEKM 304


>gi|46580529|ref|YP_011337.1| hypothetical protein DVU2124 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449948|gb|AAS96597.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 284

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 124/221 (56%), Gaps = 6/221 (2%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGII--WIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
           AG+R+  +  +   V+  + +  L++G+    + G D        L +G  +     G  
Sbjct: 60  AGYRNRTAPRVFWGVKAGLTVAGLLMGLTVRLLLGDDVPAGMVALLFIGPAV----TGLY 115

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P++W+S+ +++R+  I  A PDALDLL++CVE+G+ +DQAL RVA+++   S  L+EE+
Sbjct: 116 LPNIWLSSRIKERRQEIINALPDALDLLVVCVEAGMGLDQALARVAKELQSTSPVLAEEL 175

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            L+I EL    +R    +N   R  ++ V +    +IQ+D +GTSI  +LRV     R+ 
Sbjct: 176 QLSILELRAGKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSIASTLRVYSDTMRTT 235

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R   AE+ AA +  KL  P++   LP L + I+GPA + ++
Sbjct: 236 RFQRAEEIAAKMPVKLLFPLVFCILPALFVTIMGPAFIKLM 276


>gi|260574611|ref|ZP_05842614.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023028|gb|EEW26321.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 326

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 105/170 (61%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G VG+  P  W+++ V+KRQ+ I   +PDALD++L+CVE+G S+DQ++ RVA +      
Sbjct: 152 GAVGYYLPQYWVNSRVKKRQAEIVSGFPDALDMMLVCVEAGQSMDQSIIRVARESRAGYP 211

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            L++E  +   E+     R     +   R  +  V +    L+QS  +GTSI ++LRV  
Sbjct: 212 ALADEFDMVAQEIKAGKERTTVMRDMSERVGIADVASFVTTLVQSATFGTSIAEALRVYS 271

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +E R +R+M AE+KA +L  KLT+  ++F LP L++++IGP+I +I  T+
Sbjct: 272 AEMRDKRVMRAEEKANTLPTKLTLGTMLFTLPPLLIILIGPSIHNIAVTL 321


>gi|32473987|ref|NP_866981.1| secretion system protein TadC [Rhodopirellula baltica SH 1]
 gi|32444524|emb|CAD74523.1| probable secretion system protein TadC [Rhodopirellula baltica SH
           1]
          Length = 328

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 131/239 (54%), Gaps = 14/239 (5%)

Query: 95  DENIVNKLRA----AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
           +E  + KLR     AGFR E +  I  +++LV   + L+LG +     D L +       
Sbjct: 95  NEEEMGKLREKLINAGFRRESAPVIFKLIQLVCTGVGLMLGGVTGAVLDGLTQ------- 147

Query: 151 GAVI--LIGYVG-FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           G +I  L+G +G F  PS+ +  +  KR+  I    PDALDL+++CVE+G+ +DQALR+V
Sbjct: 148 GMIIKLLLGMIGGFMIPSLILGFMASKRREKIFLGLPDALDLMVVCVEAGLGLDQALRKV 207

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           AE++      + EE  ++  +L     R         R+ +D ++     LIQ+D++G+S
Sbjct: 208 AEEMQKSHKAIGEEFSISNHQLQLGSPRSEVLSGLGYRSGVDDLKQLASILIQADKFGSS 267

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +  +LRV     R++R   AE+KAA    K+  P+++F  P + +V++GPA +++   M
Sbjct: 268 VAQALRVQSDSMRTKRRQIAEEKAAKTAVKMIFPLVLFIFPGIFVVLVGPAAINMYRQM 326


>gi|327543264|gb|EGF29697.1| flp pilus assembly protein TadC [Rhodopirellula baltica WH47]
          Length = 328

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 131/239 (54%), Gaps = 14/239 (5%)

Query: 95  DENIVNKLRA----AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
           +E  + KLR     AGFR E +  I  +++LV   + L+LG +     D L +       
Sbjct: 95  NEEEMGKLREKLINAGFRRESAPVIFKLIQLVCTGVGLMLGGVTGAVLDGLTQ------- 147

Query: 151 GAVI--LIGYVG-FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           G +I  L+G +G F  PS+ +  +  KR+  I    PDALDL+++CVE+G+ +DQALR+V
Sbjct: 148 GMIIKLLLGMIGGFMIPSLILGFMASKRREKIFLGLPDALDLMVVCVEAGLGLDQALRKV 207

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           AE++      + EE  ++  +L     R         R+ +D ++     LIQ+D++G+S
Sbjct: 208 AEEMQKSHKAIGEEFSISNHQLQLGSPRSEVLSGLGYRSGVDDLKQLASILIQADKFGSS 267

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +  +LRV     R++R   AE+KAA    K+  P+++F  P + +V++GPA +++   M
Sbjct: 268 VAQALRVQSDSMRTKRRQIAEEKAAKTAVKMIFPLVLFIFPGIFVVLVGPAAINMYRQM 326


>gi|149911401|ref|ZP_01900019.1| hypothetical putative tight adherence TadC-related
           transmembraneprotein [Moritella sp. PE36]
 gi|149805509|gb|EDM65514.1| hypothetical putative tight adherence TadC-related
           transmembraneprotein [Moritella sp. PE36]
          Length = 325

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 145/278 (52%), Gaps = 9/278 (3%)

Query: 57  KQQITSLQKDSASSR-LRTRDSKSLRNFVKKLNL-----KAILVDENIVNKLRAAGFRSE 110
           K+Q+  L K+S S   L      SL + + KLN      K    D +    L  AGF S+
Sbjct: 49  KKQLNKLSKESTSHDDLAKEYESSLEHTIDKLNHVPFINKRYQGDSSTKKLLIHAGFHSQ 108

Query: 111 YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISN 170
            +L I   ++L++ +I   L  + I   +++  Y     V  ++ +    +  P + +  
Sbjct: 109 DALKIFNSIKLLLLLISGALVTLLI---NQISSYSTTKTVYIILFVLGAAYLLPGIILKK 165

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           + ++R + +KR +PDALDLL++C ESG+ + ++ +RVA+++      LS E+ L  +++ 
Sbjct: 166 IAKRRMADLKRYFPDALDLLIVCCESGLGLLESFQRVAKELQLAHPYLSYELNLVCSKVR 225

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
           +    Q A + F +RT ++ +R     ++QS R GT +  ++R+   E R +RL  AE+ 
Sbjct: 226 YGLTLQQALKEFSDRTGLEDIRGLNSVIVQSLRLGTGVAATIRIYSDEYREKRLQAAEEN 285

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           AA LG K+  PM+    P   +V IGPA+L ++    D
Sbjct: 286 AAKLGVKMIFPMMCCIWPSFFIVAIGPAVLKVMSVWGD 323


>gi|167589644|ref|ZP_02382032.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 264

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 128/227 (56%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   +++ ++ ++L V ++F  + I++     +L EY F +R  A++    +G
Sbjct: 39  QLTRAGFRERRAVSSMIGIKLSVGVLFACVAIVFSPYIPRLGEY-FVIRALAMVAAFVIG 97

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+  I    PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 98  VIVPEYVLGAMIRRRRRIIAGCLPDALDLLVICTMAGNSLASGVRRVAHELARICPPLAD 157

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   +      +F  R  +   R+    L QS R+GT I  +LR L    R
Sbjct: 158 ELSVCADELTLSGDVAATLTHFATRVDLPSARSLATTLTQSQRFGTPITQALRTLARTER 217

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E++AA L PK+T+PM++F LP + L+  GPA + +++  +
Sbjct: 218 TEQIVALEERAAKLAPKITLPMMLFILPTVCLIAAGPAAIRLLEVFR 264


>gi|120602154|ref|YP_966554.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|120562383|gb|ABM28127.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|311234268|gb|ADP87122.1| Type II secretion system F domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 323

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 124/221 (56%), Gaps = 6/221 (2%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGII--WIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
           AG+R+  +  +   V+  + +  L++G+    + G D        L +G  +     G  
Sbjct: 99  AGYRNRTAPRVFWGVKAGLTVAGLLMGLTVRLLLGDDVPAGMVALLFIGPAV----TGLY 154

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P++W+S+ +++R+  I  A PDALDLL++CVE+G+ +DQAL RVA+++   S  L+EE+
Sbjct: 155 LPNIWLSSRIKERRQEIINALPDALDLLVVCVEAGMGLDQALARVAKELQSTSPVLAEEL 214

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            L+I EL    +R    +N   R  ++ V +    +IQ+D +GTSI  +LRV     R+ 
Sbjct: 215 QLSILELRAGKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSIASTLRVYSDTMRTT 274

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R   AE+ AA +  KL  P++   LP L + I+GPA + ++
Sbjct: 275 RFQRAEEIAAKMPVKLLFPLVFCILPALFVTIMGPAFIKLM 315


>gi|170704228|ref|ZP_02894801.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170130863|gb|EDS99617.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 255

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 127/227 (55%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   +++ ++ ++L   ++F    I++     +L E+ F +R  A++    +G
Sbjct: 30  QLTRAGFRERRAVSAMIGIKLSCGVLFAGFAIVFSPYIPRLGEF-FVIRAVAMVGAFVIG 88

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 89  VIVPEYVLGAMIRRRRRIIAACFPDALDLLVICTMAGNSLASGVRRVARELQRICPPLAD 148

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R
Sbjct: 149 ELTVCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSER 208

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 209 TEQVVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 255


>gi|172062964|ref|YP_001810615.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171995481|gb|ACB66399.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 314

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 127/227 (55%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   +++ ++ ++L   ++F    I++     +L E+ F +R  A++    +G
Sbjct: 89  QLTRAGFRERRAVSAMIGIKLSCGVLFAGFAIVFSPYIPRLGEF-FVIRAVAMVGAFVIG 147

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 148 VIVPEYVLGAMIRRRRRIIAACFPDALDLLVICTMAGNSLASGVRRVARELERICPPLAD 207

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R
Sbjct: 208 ELTVCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSER 267

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 268 TEQVVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 314


>gi|83943934|ref|ZP_00956391.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83954507|ref|ZP_00963218.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840791|gb|EAP79962.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845181|gb|EAP83061.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 305

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 143/283 (50%), Gaps = 33/283 (11%)

Query: 57  KQQITSLQKDSASSRLRTRD-SKSLRNFVK--------KLNLKAILVDENIVNKLRAAGF 107
           K+  T         RLR  D ++ L+ F K        +L+ KA+L        LR AG+
Sbjct: 34  KRSQTEAADAGKQQRLRQSDRNEKLQKFAKFLEPEDVEELSAKALL--------LRQAGY 85

Query: 108 RSEYSLNILLVVRLVVPIIFLILGIIWI--------FGYDKLLEYPFQLRVGAVILIGYV 159
            S  ++      ++ + I  L++G ++I           +K++ Y         +  G +
Sbjct: 86  SSRDAVRFFHFAQMALGIAGLVIGTVYINFLGGGEGMTTNKMMLY--------TVGPGGI 137

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P  W++  V +R+  I R +PDALD++L+CVE+G S+DQ + RVA ++      L+
Sbjct: 138 GYFLPRYWVTRRVAERKEEITRGFPDALDMMLVCVEAGQSLDQCIVRVARELRASYPALA 197

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           EE  +   E+    ++         R  +  V +    L+QS  +GTSI D+LRV  +E 
Sbjct: 198 EEFEIVAYEMKAGKDKVSVLNAMGERCGVQDVSSFVTVLVQSAAFGTSIADALRVYAAEM 257

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R +R+M AE+ A  L  K+T+  ++  +P L+++++ P++++I
Sbjct: 258 RDKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVAPSVMNI 300


>gi|168702877|ref|ZP_02735154.1| probable secretion system protein TadC [Gemmata obscuriglobus UQM
           2246]
          Length = 319

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 124/223 (55%), Gaps = 6/223 (2%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR-VGAVILIGYV 159
           +L  AGFRSE +  +   +R+V  ++FL+  + +    D      F L+ +   + +G +
Sbjct: 94  QLANAGFRSENAAGVYQGIRVVCLVVFLLPALFFFLLKDG-----FTLKSIEWTVALGGM 148

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P + + +L   RQ  I    PDALDLL++CVESG+ +D ALR+V +++ G +  + 
Sbjct: 149 GFYLPQMGLYHLRSTRQKEIFLTLPDALDLLVVCVESGLGLDAALRKVTDEMKGHAKTIC 208

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           EE  L   +L     R+    +   RT +D VR+    LIQ+DR+G+SI  +LRV     
Sbjct: 209 EEFSLANLQLQMGRPRREVLHDLGVRTGVDDVRSLAAILIQADRFGSSIAQALRVQSDSM 268

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R  R   AE+KAA    +L  P+++F  P + +V++GPA + I
Sbjct: 269 RVRRRQIAEEKAAKTAVQLIFPLVLFIFPSIFVVLVGPAAIQI 311


>gi|254466278|ref|ZP_05079689.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
 gi|206687186|gb|EDZ47668.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
          Length = 326

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 126/224 (56%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG+ S+ S+ +    +  + ++ L+ G+ +++     ++Y  Q     ++  G  G
Sbjct: 97  KLRQAGYHSKDSVRLFHFAQFALGLLGLMGGLFFVYVLKADIDYDSQQMAIRIVGPGAAG 156

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+  +++R+  I   +PDALD++L+CVE+G S+DQA+ RVA+++      L+E
Sbjct: 157 YLLPKYWITRRIEERKQKITEGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPDLAE 216

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+     +     +   R  +  + +    +IQS  +GTSI D+LRV   E R
Sbjct: 217 EFEVVAYEMKAGKEKDRVLRDMGTRCGVQDISSFVTVMIQSASFGTSIADALRVYAGEMR 276

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            +R+M AE+ A  L  K+T+  +   +P L+++++GP+I  I++
Sbjct: 277 DKRVMRAEEAANKLPVKMTLATMGLTVPPLLIILVGPSIQGIMN 320


>gi|87312288|ref|ZP_01094386.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
 gi|87284992|gb|EAQ76928.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
          Length = 309

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 126/229 (55%), Gaps = 10/229 (4%)

Query: 101 KLRAAGFRSEYSLNILLVVRLV---VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           +L  AGFRSE + NI L ++     + +I     ++ +  Y+       Q  +   I I 
Sbjct: 80  RLTHAGFRSEAAPNIFLGLKFASLLIGLIVGGGLVVLLGNYN-------QSDLFKGIAIA 132

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            + F  PS+ +  L +KR+  I R  PDALDL+++CVE+G+ +DQA+RRV+E++      
Sbjct: 133 GISFYIPSIGLWYLGKKRKEQIFRGLPDALDLMVVCVEAGLGLDQAMRRVSEEMKKTYRV 192

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           ++EE  L   +L     R        NRT +D +R+    LIQ+D++G+SI  +LRV   
Sbjct: 193 IAEEFGLCNFQLQVGRQRSDVLHELGNRTGVDDLRSLAAILIQADKFGSSISQALRVQSD 252

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R+ R   AE+KAA    K+  P++ F  P + +V++GPA +++I  M
Sbjct: 253 SMRTRRRQIAEEKAAKTAVKMIFPLVFFIFPGIFVVLVGPAAITVIREM 301


>gi|294012231|ref|YP_003545691.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675561|dbj|BAI97079.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 322

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 141/258 (54%), Gaps = 16/258 (6%)

Query: 75  RDSKSLRNFVKKLNLKAI-LVDENIVN---KLRAAGFRSEYSLNILLVVRLVV----PII 126
           R+S   +  V ++    + LVD N V+   +L AAG+ S  +  +  + RLV+    P I
Sbjct: 63  RNSSEWKKLVDRIEKMGVSLVDTNNVDLRRRLIAAGYMSPEAPKLFTLFRLVLTFALPAI 122

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVI-LIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           F+I  +       +  E P  L +  V  L+  +G   P+++IS    +RQ  I   +PD
Sbjct: 123 FVITSL-------RNPEPPTALTLYMVASLLAVLGLYMPNLYISAKASRRQEEIVHGFPD 175

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDL+L+CVE+G+ ++ A+ RV  ++      +S  +   + EL    +RQ A     + 
Sbjct: 176 ALDLMLVCVEAGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGRSRQDALRRMADD 235

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +D +R+    LIQSD+ G+S+G +LRV  +E R +R M AE+KA  L   L+VP++  
Sbjct: 236 VDVDEIRSFATLLIQSDQLGSSVGQTLRVYAAEMREKRRMRAEEKAHRLPVLLSVPLVAC 295

Query: 306 FLPVLILVIIGPAILSII 323
            LPV+I V++ PA++ ++
Sbjct: 296 MLPVMIGVLMLPAVVRVV 313


>gi|294102185|ref|YP_003554043.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617165|gb|ADE57319.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
          Length = 296

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 114/199 (57%), Gaps = 9/199 (4%)

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           LIL ++  F    L+  PF  R+   I++G +G+  P +WI+N  ++RQ   +   PD +
Sbjct: 104 LILAMVSFF----LIPDPF--RISGAIILGALGYMIPGLWITNKGKQRQVEARNQLPDVM 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+++ VE+G+ +D A+ RVA+ + G   P+ E     + E+S   +RQ AF     R  
Sbjct: 158 DLMVVSVEAGLGLDAAMSRVADRLRG---PMGENFARALHEISLGESRQAAFRGIMERLP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           ++ VR+   +LIQ++  G ++ + LR      +  R ++AE+ A     K+  PMI+F  
Sbjct: 215 IEEVRHFIASLIQAEELGVAVSEVLRSQAGTLKRLRRLKAEEHARKAPIKILFPMILFIF 274

Query: 308 PVLILVIIGPAILSIIDTM 326
           P L +VI+GPA LSI++T+
Sbjct: 275 PSLFVVILGPAFLSIMETL 293


>gi|56477520|ref|YP_159109.1| type II secretion system protein [Aromatoleum aromaticum EbN1]
 gi|56313563|emb|CAI08208.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Aromatoleum aromaticum EbN1]
          Length = 315

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 105/177 (59%)

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           FQ  +  V+L   +G+  P++ ++ L+  RQ  I   +PDALDL+ +CVE+G+ ++ AL 
Sbjct: 125 FQGTLLVVLLAAAIGYYVPNIILNRLIFVRQREIFETFPDALDLMTVCVEAGLGVEAALV 184

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           RVA+++  +S  L+EE+ L   EL     R  A  N   RT ++ V      +IQ++R+G
Sbjct: 185 RVADEMQHKSEALAEELHLVTLELRAGLERARALRNLAARTGVEEVEGFVAMVIQAERFG 244

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           TSI  SLR+     R+ R   AE+ AA +  KL  P+I F  P L+LV++GPA++ +
Sbjct: 245 TSIATSLRIHSDMLRTRRRQRAEEAAAKIALKLLFPLIFFIFPSLMLVLLGPAMIQV 301


>gi|153006801|ref|YP_001381126.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030374|gb|ABS28142.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
          Length = 314

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 125/240 (52%), Gaps = 8/240 (3%)

Query: 91  AILVDENIVNKLRA----AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
           A   DE+  ++LR     AGFRS  +  + +  + V+    L+         +     P 
Sbjct: 71  AATTDEDAESRLRRQLVWAGFRSMRAPKLFVGAKAVLSFGLLLG----FLAVNAARAEPV 126

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
              +G  + +   GF  P++W+S+ +  R   I RA PDALDLL+ CVE+G+ +D AL+R
Sbjct: 127 PFALGIAVWLAGAGFFLPNLWLSSRIANRLRQIDRALPDALDLLVTCVEAGLGLDAALQR 186

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V+ +I      LS E+ LT  E+     R   F     RT    +R     L Q++ +GT
Sbjct: 187 VSGEIALAWPLLSSELRLTFLEVRAGIPRMDGFRRLAARTGSPELRALAATLTQTELFGT 246

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           SI  +LRV     R  R+  AE++AA +  K+T+P+I+  LP L  VIIGPA ++I+ T+
Sbjct: 247 SIASALRVQAEGIRIRRMQRAEERAAYVAVKMTLPLILCILPSLFAVIIGPAAINIMKTL 306


>gi|218887822|ref|YP_002437143.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758776|gb|ACL09675.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 326

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 99/166 (59%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG  AP+VW+S  ++ R+  I  + PDALDLL++CVE+G+ +DQA  RVA ++   +  L
Sbjct: 154 VGLYAPNVWLSRRIKARRLDIINSLPDALDLLVVCVEAGMGLDQAFSRVAREMAATNPVL 213

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           +EE+ L I EL    +R  A +N   R  ++ V +    ++Q+D +GTSI  +LRV    
Sbjct: 214 AEELNLVILELRAGKSRAEALKNLAARVALEDVNSLVTLIVQADAFGTSISSTLRVYSDT 273

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            R+ R   AE+ AA +  KL  P++   LP L + I+GPA + ++ 
Sbjct: 274 MRTTRFQRAEEIAAKMPVKLLFPLVFCILPALFVTIMGPAFIKLMQ 319


>gi|157961842|ref|YP_001501876.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846842|gb|ABV87341.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 320

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 159/339 (46%), Gaps = 56/339 (16%)

Query: 5   FFDLFDATELAV-------AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK 57
           FFD     E A+        +T A+SI  LI  V  P      +  R+KS+  E+     
Sbjct: 11  FFDDPQHVEWAIYSISAIAGVTLAISISYLISGVYSP------IRSRLKSLNGEKVTKNS 64

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNK--LRAAGFRSEYSLNI 115
           Q +T                 +L + + ++  K  L   N   +  L  AGF SE +L +
Sbjct: 65  QDVTG----------------TLEHGIGEMAKKPFLNFSNHETRRLLIHAGFHSENALAV 108

Query: 116 LLVVRLVVPIIFLILGII-----------WIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
               RL++ +   I  ++           W F       Y F L +G         F AP
Sbjct: 109 FNASRLLLILFGFITSLLILNLFPNISGFWTF-------YIFCLFIGGA-------FIAP 154

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           S+ + +L ++R   ++  +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L
Sbjct: 155 SMVLQSLSKRRMRKLRVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELEL 214

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
             +++      +VA + F  RT ++ ++    A+ QS R GT I ++LRV   E R++RL
Sbjct: 215 VCSKVRAGLTIKVALQEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRNKRL 274

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             AE++AA L  K+  PM+    P   +V +GPA+L ++
Sbjct: 275 QAAEEQAAKLAVKMIFPMMCCIWPSFFIVAVGPAVLKVM 313


>gi|167836684|ref|ZP_02463567.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis MSMB43]
          Length = 310

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 127/229 (55%), Gaps = 5/229 (2%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   ++++L  ++L+V + F +  I+      ++ EY F  R  A+++ 
Sbjct: 80  KVAQRLISAGFRDRRAVSVLAGLKLLVGVGFALGMIVGASHVPRIGEY-FVFR--ALMMA 136

Query: 157 G--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           G   +G   P   +  ++++RQ  I    PDALDLL+IC  +G S+  A++RVA ++   
Sbjct: 137 GAFMIGMMLPEFVLDLMIRQRQKRIAAYLPDALDLLVICTNAGNSLVVAIKRVASELKMI 196

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL++E  +T  EL    +   A      R  +   R     L+QS +YGT I  SLR 
Sbjct: 197 CPPLADEFAVTADELQIGGDISSALNALAKRIAVPSTRALVTTLVQSQQYGTPITQSLRQ 256

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L    RS +++  E+KAA L PK+++PM++F +P + L+  GPAI+ +I
Sbjct: 257 LSRTERSMQIVALEEKAAKLAPKMSLPMLLFIMPTVALIAAGPAIIRLI 305


>gi|221067370|ref|ZP_03543475.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712393|gb|EED67761.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 303

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 126/224 (56%), Gaps = 13/224 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPII--FLILGIIWIFGYD---KLLEYPFQLRVGAVILIGYV 159
           AG R E +  +    + ++P++  FL+  ++   G     +LL YP        ++ G V
Sbjct: 77  AGIRHENAPLLYFGAKTLLPLVMMFLVYSLMLAQGTTDSLQLLLYP--------LVTGLV 128

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
               P++ +  +  +R+  I   +PDA DL+L+CVE+G+ +D AL +V  +I  +S  L+
Sbjct: 129 ACYLPNLVLRWMAARRKREIFENFPDAADLMLVCVEAGMGLDAALGKVTAEIRIKSEALA 188

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+  T  E+     R+ +  N   RT +D +   T  L Q+DR+GTSIGDS+RV   + 
Sbjct: 189 QELHWTNLEMRAGSTREKSLRNLAARTGVDEIHAFTAMLTQADRFGTSIGDSIRVFSDDL 248

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R +R M AE+ AA +  K+ +P++    P +++V++GPAI+ ++
Sbjct: 249 RHKRQMRAEELAAKIPTKMLLPLVTCIFPAIVMVVLGPAIIRLL 292


>gi|328953758|ref|YP_004371092.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454082|gb|AEB09911.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 302

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 123/232 (53%), Gaps = 16/232 (6%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI------ 154
           KL  AG     + +  L  +L  P+  +I+GI               L VG ++      
Sbjct: 78  KLMLAGCYGSRAFSRFLFFKLTSPLAAIIIGI----------PLSLNLNVGLIMKPVFLY 127

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L+   GF  P++ +++ +  RQ  I    PDALDLL++CVE+G+ ++ A++RVA+D+   
Sbjct: 128 LLLAFGFYLPNLVLNHKISARQKKISEGLPDALDLLVVCVEAGLGLNAAMKRVADDLKMN 187

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
           +  LS E  +   E+    +R+ A  N   RT ++ +      LIQ+DR+GTSI  +LRV
Sbjct: 188 NPVLSLEFNMLNLEILAGLDREQALRNLAERTGVEELSTLCAILIQADRFGTSIAQALRV 247

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
                R+ R    E+ AA    KL  P+I+F  P L++VI+GPA++ + ++M
Sbjct: 248 QSDTMRTNRRQRLEELAARTPVKLVFPLILFIFPALVVVILGPAVIQVAESM 299


>gi|197123313|ref|YP_002135264.1| type II secretion system protein [Anaeromyxobacter sp. K]
 gi|196173162|gb|ACG74135.1| type II secretion system protein [Anaeromyxobacter sp. K]
          Length = 306

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 107/172 (62%)

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           LI  + F  P++W+ + VQ RQ+ + R+ PDALDLL+ CVE+G+ +D AL+RV++++   
Sbjct: 127 LITGIAFFLPNLWLRSRVQARQTQLDRSLPDALDLLVTCVEAGLGLDSALQRVSDEVALA 186

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              LS+E+ L   E+     R  AF     RT    +R+ +  L Q++ +GTS+G +LR+
Sbjct: 187 HPLLSKELRLVFLEVKAGIPRIAAFRRMAERTGAPELRSLSATLAQTELFGTSVGAALRI 246

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
                R  R+  AE+KAA +  K+++P+++  LP +  V++GPA++++ D +
Sbjct: 247 QAEGIRIRRMHRAEEKAAYVSVKMSLPLVLCILPCVFAVVLGPAVVNMADRL 298


>gi|157375501|ref|YP_001474101.1| putative putative tight adherence TadC-like transmembrane protein
           [Shewanella sediminis HAW-EB3]
 gi|157317875|gb|ABV36973.1| conserved hypothetical putative tight adherence TadC-related
           transmembrane protein [Shewanella sediminis HAW-EB3]
          Length = 321

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 167/323 (51%), Gaps = 20/323 (6%)

Query: 5   FFDLFDATE-LAVAITTAVSIFSLIYAVVIPSLGSG---ELEKRMKSVAVEREILRKQQI 60
           F  LFD  E +  AI     I  +++A+ +  L SG    L +R+KS+       +++QI
Sbjct: 8   FGSLFDDPEQIKWAIFAVAGIAGVMFALSLAFLISGIYSPLRQRLKSLN------KEEQI 61

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            ++Q D  ++         + + V+K  L   + ++     L  AG  SE ++ I   +R
Sbjct: 62  KTVQTDVNATL-----EHGIGSMVEKSPLN--MSNDETRRLLIHAGLHSENAMAIFSSIR 114

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +++ +I     ++ +  Y  L      + V  V L+    F  PS+ +  +  +R   ++
Sbjct: 115 IILLLIGAGSSVLVLSLYPDL---STMMSVYIVALLVGGAFLLPSLVLQKIASRRMRMLR 171

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
             +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L  +++      +VA  
Sbjct: 172 TGFPDALDLLVVCCEAGLGLMAAMQRVARELALSHPTLASELDLVCSKVRAGLTVKVALN 231

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
            F +RT ++ ++    A+ QS R GT I ++LRV   E R++RL EAE++AA L  K+  
Sbjct: 232 EFTDRTGLEDIKGLNSAISQSIRLGTGIAETLRVFSDEYRNKRLQEAEEQAAKLAVKMIF 291

Query: 301 PMIIFFLPVLILVIIGPAILSII 323
           PM++   P   +V IGPA+L ++
Sbjct: 292 PMMLCIWPSFFIVAIGPAVLKVM 314


>gi|167581954|ref|ZP_02374828.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis TXDOH]
          Length = 271

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 127/229 (55%), Gaps = 5/229 (2%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  ++      ++ +Y F LRV  +++ 
Sbjct: 41  KLAARLASAGFRERRAVSVMAGLKLVVGACAGLAALVVGAHVPRVGDY-FVLRV--LMMA 97

Query: 157 G--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           G   +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++G  
Sbjct: 98  GAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELGTI 157

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+
Sbjct: 158 CPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRM 217

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 218 LSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 266


>gi|299067812|emb|CBJ39023.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CMR15]
          Length = 315

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 168/319 (52%), Gaps = 21/319 (6%)

Query: 16  VAITTAVSIFSLIYAVVIPS---LGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           V I      F++++  V+ +   L    L++R+  +  +RE+ R Q      +D    R 
Sbjct: 4   VHIVLLAGTFAIVFGAVLAAMTLLRPSTLDRRLGQI--DRELPRTQP-----RDDGHDRA 56

Query: 73  RTRDSKSLRNFVKKLNL-KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI---IFL 128
             R  + L   + K +L K      ++  +   AG+R+  ++ +   ++ ++     + L
Sbjct: 57  WLRRLEQLAKPLAKASLPKEGWEGSSLRQRFVHAGWRAPEAIAVYFGIKTILTFGLPLLL 116

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
             G++     D+  ++   L  GA +    VGF  P+V +S  ++ RQ  I  ++PD+LD
Sbjct: 117 WAGLVGRINADQQSQF-MSLLFGAAV----VGFYLPNVLLSLKIKYRQREIFESFPDSLD 171

Query: 189 LLLICVESGISIDQALRRVAEDI-GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           L+++CVE+G+S+D A+ RV +++   + V   E  LLT+   + LP R+ A  N   RT 
Sbjct: 172 LIMVCVEAGLSLDAAILRVVDEMRTARPVMAEEYELLTLELRAGLP-REKALRNLAARTG 230

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D V      LIQ+DR+GTS+ DSLRV     R++R M AE++AA +G K+  P+I    
Sbjct: 231 VDDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERAAKIGTKVLFPLIFCIF 290

Query: 308 PVLILVIIGPAILSIIDTM 326
           P L +V++GPA L +I  +
Sbjct: 291 PSLYVVLLGPAALQMIAAL 309


>gi|84516638|ref|ZP_01003997.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
 gi|84509674|gb|EAQ06132.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
          Length = 316

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 139/259 (53%), Gaps = 1/259 (0%)

Query: 69  SSRLRTRDSK-SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           + RLR   SK +L  +   L  +       +  KL  +G+RS+ ++ I   V+  + I  
Sbjct: 57  TERLRAASSKDTLEKYSNFLEPQNAAEYSAVKLKLLQSGYRSKNAVRIYHFVQFALGITG 116

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L  G I+            Q  +  +++ G +G+  P  W++  V+ R+ +I  A+PD+L
Sbjct: 117 LFGGGIYSLIEMAQRTVNTQELIMMILVPGGIGYMFPKYWVTRRVEVRKEAIINAFPDSL 176

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+L+CVE+G S+DQ++ RV+ ++      L+EE  +   E     ++    ++   R  
Sbjct: 177 DLMLVCVEAGQSLDQSILRVSNELRTGFPELAEEFEIVSQEAKAGKDKTTVLKDMAERCG 236

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  + +    ++QS ++GTSI D+LRV  SE R +R+M AE+ A  L  K+T+  ++  +
Sbjct: 237 VPDISSFVTVMVQSAQFGTSISDALRVYASEMRDKRVMRAEEAANKLPTKMTLATMMLTV 296

Query: 308 PVLILVIIGPAILSIIDTM 326
           P L+ ++IGP+I +I  ++
Sbjct: 297 PPLMAILIGPSIYAITTSL 315


>gi|294676064|ref|YP_003576679.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474884|gb|ADE84272.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 337

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 164/315 (52%), Gaps = 9/315 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +A+A   AV + + + A+V  S     L+K  KS+A     +   Q TS +    + +LR
Sbjct: 21  IALAALGAVLVLAALPALV--SRREDPLDKLRKSLAPGSGTVGAAQATSKK----AQKLR 74

Query: 74  -TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            T     L+ F   L  ++          L  AG+R  + +     V+  + I  L LG+
Sbjct: 75  NTAGPDKLQKFAGFLEPQSKEEMSESRKWLHKAGYRGPHVVRHFHAVQFALAISLLGLGV 134

Query: 133 IWIFGYDKLLEYPFQLR--VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           +++  Y+   E P +    + A++  G  G+ AP  W++  V  R   I+  +PDALD+L
Sbjct: 135 LYVLFYNAGHEVPLESTNAIAAILGPGIGGYYAPRRWVNQRVAARTQEIQDGFPDALDML 194

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           L+CVE+G S+DQ + RV++++      L+EE      E+    ++      F  R+ +  
Sbjct: 195 LVCVEAGQSLDQGIIRVSKELSSSYPALAEEFATVAHEIKAGLDKPTVLRAFAERSGVSD 254

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V +    +IQS ++GTSI ++LR+  ++ R +R+M AE+ A  +  K+T+  ++F +P L
Sbjct: 255 VASFVTVMIQSQQFGTSIAEALRLYAADMRDKRIMRAEEAANKIPTKMTLGTMMFTVPPL 314

Query: 311 ILVIIGPAILSIIDT 325
           +++++GP++  +++ 
Sbjct: 315 LIILVGPSVHDMMEN 329


>gi|51245380|ref|YP_065264.1| hypothetical protein DP1528 [Desulfotalea psychrophila LSv54]
 gi|50876417|emb|CAG36257.1| hypothetical membrane protein [Desulfotalea psychrophila LSv54]
          Length = 283

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 95/169 (56%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           I  G  G+  P   +      R+  + R +PDA+DLL++CVE+G+ ID A+RRVA++I  
Sbjct: 108 IFAGIFGYFLPVFRLKIRGHYRRKELDRTFPDAIDLLMVCVEAGMGIDSAIRRVAQEIHI 167

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
            S  L++E  +   EL     R    +N   RT +  + N    LIQ+ +YGT + ++LR
Sbjct: 168 TSPELAKEFKILSLELKTGKPRNECLKNLAKRTNLRDIDNLVSLLIQAQKYGTGVANALR 227

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +   E R +R    E+ AA L  KL +P+I F  P L LVI+GPA++ +
Sbjct: 228 IHAEEMRQKRYSRLEEMAAKLPVKLVIPLIFFIFPALFLVILGPAMIRV 276


>gi|114800177|ref|YP_759874.1| putative Flp pilus assembly protein TadC [Hyphomonas neptunium ATCC
           15444]
 gi|114740351|gb|ABI78476.1| putative Flp pilus assembly protein TadC [Hyphomonas neptunium ATCC
           15444]
          Length = 310

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 126/226 (55%), Gaps = 3/226 (1%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL  AGF    ++    + R    I  +I  +   F    L EYP  + V A I++   G
Sbjct: 87  KLNQAGFTGAKAVPRYFLARF---ICVVIPQVALFFALPYLQEYPRYVPVMASIILVLAG 143

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
             AP  ++   + +R+ +    +PD +DL++ CVE+G+S+D +++RV E++  +   ++ 
Sbjct: 144 LAAPGKFLDMRISQRKQACSSGFPDMMDLMVACVEAGLSLDASVQRVGEELELRHPIIAG 203

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
            M     EL    +R++A+  F  R  +D   +    L Q++  GTS+G +LRV  ++ R
Sbjct: 204 HMRTLSLELRAGKSRKMAWRAFAERLGIDEAGSLATMLRQAEEMGTSLGQTLRVFSADMR 263

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R++ AE+KA +L  K+T+P+IIF  PVL+ V+I PA++ ++ T+
Sbjct: 264 QRRILMAEEKAMALPAKMTLPLIIFVFPVLLGVLILPAVVMLMTTL 309


>gi|83720640|ref|YP_442975.1| type II secretion system protein F [Burkholderia thailandensis
           E264]
 gi|83654465|gb|ABC38528.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis E264]
          Length = 290

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 127/229 (55%), Gaps = 5/229 (2%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  ++      ++ +Y F LRV  +++ 
Sbjct: 60  KLAARLASAGFRERRAVSVMAGLKLVVGACAGLAALVVGAHVPRVGDY-FVLRV--LMMA 116

Query: 157 G--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           G   +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++G  
Sbjct: 117 GAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELGTI 176

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+
Sbjct: 177 CPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRM 236

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 237 LSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 285


>gi|257139199|ref|ZP_05587461.1| type II secretion system protein F [Burkholderia thailandensis
           E264]
          Length = 314

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 124/227 (54%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  ++      ++ +Y F LRV  +   
Sbjct: 84  KLAARLASAGFRERRAVSVMAGLKLVVGACAGLAALVVGAHVPRVGDY-FVLRVLMMAGA 142

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++G    
Sbjct: 143 FVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELGTICP 202

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 203 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 262

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 263 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 309


>gi|264678228|ref|YP_003278135.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262208741|gb|ACY32839.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 303

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 100/160 (62%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P++ +  +  +R+  I   +PDA DL+L+CVE+G+ +D AL +V ++I  +S  L+EE+ 
Sbjct: 133 PNLVLRWMASRRKREIFENFPDAADLMLVCVEAGMGLDAALGKVTDEIRIKSEALAEELH 192

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T  E+     R+ +  N   RT +D +   T  L Q+DR+GTSIG+SLRV   + R +R
Sbjct: 193 WTNLEMRAGSTREKSLRNLAARTGVDEIHTFTAMLTQADRFGTSIGESLRVFSDDLRHKR 252

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            M AE+ AA +  K+ +P++    P +I+V++GPAI+ I+
Sbjct: 253 QMRAEELAAKIPTKMLLPLVTCIFPAIIMVVLGPAIIRIV 292


>gi|167620118|ref|ZP_02388749.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis Bt4]
          Length = 254

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 127/229 (55%), Gaps = 5/229 (2%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  ++      ++ +Y F LRV  +++ 
Sbjct: 24  KLAARLASAGFRERRAVSVMAGLKLVVGACAGLAALVVGAHVPRVGDY-FVLRV--LMMA 80

Query: 157 G--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           G   +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++G  
Sbjct: 81  GAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELGTI 140

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+
Sbjct: 141 CPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRM 200

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 201 LSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 249


>gi|78062901|ref|YP_372809.1| type II secretion system protein [Burkholderia sp. 383]
 gi|77970786|gb|ABB12165.1| type II secretion system protein [Burkholderia sp. 383]
          Length = 314

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 126/227 (55%), Gaps = 1/227 (0%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L  AGFR   ++++++ ++L   ++F    I++     +  +Y F +R  A+I    +G
Sbjct: 89  QLTRAGFRERRTVSVMIGIKLSCGVLFACGAIVFSPLIPRFGDY-FVIRALAMIAAFVIG 147

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++
Sbjct: 148 VIVPEYVLGAMIRRRRRIIAACFPDALDLLVICTMAGNSLASGIRRVAHELARICPPLAD 207

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +   EL+   +      +F  R      R+    L QS R+GT I  +LR L    R
Sbjct: 208 ELTVCADELTLSGDVAATLTHFAMRVDFTSARSLATTLTQSQRFGTPITQALRTLSRTER 267

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +E+++  E++AA L PK+T+PM++F LP + L+  GPA + +++  +
Sbjct: 268 TEQIVALEERAAKLAPKITLPMMLFILPTVCLIAAGPAAIRLLEVFR 314


>gi|251789651|ref|YP_003004372.1| type II secretion system protein [Dickeya zeae Ech1591]
 gi|247538272|gb|ACT06893.1| type II secretion system protein [Dickeya zeae Ech1591]
          Length = 318

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 103/173 (59%), Gaps = 1/173 (0%)

Query: 152 AVILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A  LIG+  G   P  W+      R   + RA PDALDL+++C E+G+SI + L+ V+++
Sbjct: 141 AAALIGFFAGSLLPEAWLKMRAAGRGEKLARAVPDALDLMVVCAEAGLSIGRVLQVVSKE 200

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +G  S  +++E+  T AEL  L +R  A ++   RT++  + +    L+Q++RYGT +  
Sbjct: 201 LGLSSPEMADELRYTAAELQILADRNTALQHLAERTRVSEIESMVATLLQAERYGTPLSQ 260

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +LR +  E+R   L+  E+KA  L  +L+VP++   LP +I ++  PA+L ++
Sbjct: 261 ALRTIADESRKTLLLTLEEKAGKLPAQLSVPLMALILPPIIAIMASPALLRVV 313


>gi|299532601|ref|ZP_07045990.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719404|gb|EFI60372.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 303

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 98/159 (61%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P++ +  +  +R+  I   +PDA DL+L+CVE+G+ +D AL +V E+I  +S  L+EE+ 
Sbjct: 133 PNLVLRWMALRRKREIFENFPDAADLMLVCVEAGMGLDAALGKVTEEIRIKSEALAEELH 192

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T  E+     R+ A  N   RT +D +   T  L Q+DR+GTSIG+SLRV   + R +R
Sbjct: 193 WTNLEMRAGSTREKALRNLAARTGVDEIHTFTAMLTQADRFGTSIGESLRVFSDDLRHKR 252

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            M AE+ AA +  K+  P++    P +I+V++GPAI+ +
Sbjct: 253 QMRAEELAAKIPTKMLFPLVTCIFPAIIMVVLGPAIIRV 291


>gi|283852078|ref|ZP_06369352.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
 gi|283572468|gb|EFC20454.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
          Length = 317

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 130/230 (56%), Gaps = 8/230 (3%)

Query: 99  VNKLRA----AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
           ++K RA    AGFR   ++ I   ++    ++ L++G +        L   +++ V    
Sbjct: 85  LSKTRANLVHAGFRQPGAVEIYWGIKAGAGLVGLVVGAL--LALSGRLPGQYKMFVALAC 142

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           + G  GF  P + +   V+KRQ +I+R  PDALDLL++CVE+G+ +D A+ RV  ++  +
Sbjct: 143 VAG--GFYLPGLLLDARVKKRQKAIQRGLPDALDLLVVCVEAGMGLDAAIYRVCVEMASK 200

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              LS E+ L   EL    +R+ A +N  +R  ++ + +    LIQ+D +GTSI  +LRV
Sbjct: 201 EPVLSSELRLLTLELRAGKSRREALKNLSSRIGLEDMGSLVAMLIQTDMFGTSIAQTLRV 260

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
                R++R   AE+ AA L  KL  P+I F  P L++VI+GPA++S++ 
Sbjct: 261 YADSMRTKRFQLAEELAAKLPVKLLFPLIFFIFPTLLIVILGPAVISLMK 310


>gi|307294432|ref|ZP_07574276.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880583|gb|EFN11800.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 322

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 141/254 (55%), Gaps = 17/254 (6%)

Query: 78  KSLRNFVKKLNLKAILVDEN---IVNKLRAAGFRSEYSLNILLVVRLVV----PIIFLIL 130
           K L + ++K+ +   LVD N   +  +L AAG+ S  +  +    RLV+    P IF+++
Sbjct: 69  KKLVDRIEKMGIS--LVDTNNAGLRRRLIAAGYMSPEAPKLFTFFRLVLTFALPAIFVVM 126

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVI-LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
            +          E P  L++  +  L+  +G   P+++IS    +RQ +I   +PDALDL
Sbjct: 127 AL-------SKAEPPSALKLYFIASLLAVLGLYLPNLFISAKAARRQEAIVHGFPDALDL 179

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +L+CVE+G+ ++ A+ RV  ++      +S  +   + EL    +RQ A     +   +D
Sbjct: 180 MLVCVEAGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGRSRQDALRRMADDVDVD 239

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +R+    LIQSD+ G+S+G +LR+  +E R +R M AE+KA  L   L+VP++   LPV
Sbjct: 240 EIRSFATLLIQSDQLGSSVGQTLRIYAAEMREKRRMRAEEKAHRLPVLLSVPLVACMLPV 299

Query: 310 LILVIIGPAILSII 323
           +I V++ PA++ ++
Sbjct: 300 MIGVLMLPAVVRVV 313


>gi|254486463|ref|ZP_05099668.1| type II secretion system protein [Roseobacter sp. GAI101]
 gi|214043332|gb|EEB83970.1| type II secretion system protein [Roseobacter sp. GAI101]
          Length = 320

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 128/230 (55%), Gaps = 11/230 (4%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI-----FGYDKLLEYPFQLRVGAVILI 156
           L +AG+RS  +L I   ++ VVP+  L+ G++W+      G D L+  P  + +G  + +
Sbjct: 95  LASAGYRSRDALLIYAFLKTVVPMAALMAGLVWLGLTTPVGIDMLI--PAAMVIGTALAL 152

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
                    +++    + R   I+ ++PD L+L++I  E+G+    AL RVA+++     
Sbjct: 153 SK----GVDMYVDLRRKNRLGRIRHSFPDMLELIVITSEAGLGPQPALHRVAQEMSLSHP 208

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            L+ EML  ++E++   + + A+     R  +  +   TQ L QSDRYGT    ++R L+
Sbjct: 209 ELAREMLQMVSEMAMTNDCRGAYAKMNLRVPLPEIGIFTQTLDQSDRYGTPFSRAMRTLI 268

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            E R  RLM  E+KAA L   +T+P+I   +P + +V++GPA+LS++D +
Sbjct: 269 IEQRGNRLMAIEEKAARLPVLMTLPLIFCIMPAVFVVLVGPAVLSVLDNI 318


>gi|167624197|ref|YP_001674491.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354219|gb|ABZ76832.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 320

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 164/329 (49%), Gaps = 36/329 (10%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSG---ELEKRMKSVAVEREILRKQQIT 61
           FFD  D   +  AI +  +I  +  A+ I  L SG    + KR+KS+             
Sbjct: 11  FFD--DPQHVEWAIYSVAAIAGVTLAISISYLISGVYSPIRKRLKSL------------- 55

Query: 62  SLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNK--LRAAGFRSEYSLNILLV 118
               ++A     T D + +L + + ++  K  L   N   +  L  AGF SE +L +   
Sbjct: 56  ----NAAEGTKVTHDVTGTLEHGMGEMAKKPFLNFSNHETRRLLIHAGFHSENALAVFNA 111

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLE----YPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
            RL++ ++  ++ ++ +  + ++      Y F L +G         F  PS+ + +L  +
Sbjct: 112 SRLLLILLGFVISLVILNLFPEISGIWTIYIFCLFIGG-------AFIVPSMVLQSLANR 164

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R   ++  +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L  +++     
Sbjct: 165 RMRQLRVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELDLVCSKVRAGLT 224

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
            +VA + F +RT ++ ++    A+ QS R GT I ++LRV   E R +RL  AE++AA L
Sbjct: 225 IKVALQEFTDRTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAAEEQAAKL 284

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSII 323
             K+  PM+    P   +V +GPA+L ++
Sbjct: 285 AVKMIFPMMCCIWPSFFIVAVGPAVLKVM 313


>gi|86137998|ref|ZP_01056574.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
 gi|85825590|gb|EAQ45789.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
          Length = 326

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 129/224 (57%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG+ S+ ++ +    ++ + +  L LG+ +++  +   E+  Q  +  +I  G  G
Sbjct: 97  KLRQAGYHSKDAVRLFHFAQMSLGLAGLALGLFYVYVMNAGFEFDTQALMIRIIGPGGAG 156

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  W++  + +R+  I+  +PD+LD++L+CVE+G S+DQ++ RVA ++      L  
Sbjct: 157 YMLPKYWVTRRIAERKEEIEAGFPDSLDMMLVCVEAGQSLDQSIVRVASELKASYPQLDY 216

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+    +++    +   R  +  + +    +IQS  +GTSI ++LRV  SE R
Sbjct: 217 EFDIVAHEMKAGKDKEKVLRDMGTRCGVQDISSFVTVMIQSAAFGTSIAEALRVYASEMR 276

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            +R+M AE+ A  L  K+T+  ++  +P L+++++GP++ +I++
Sbjct: 277 DKRVMRAEEAANKLPVKMTLATMMLTVPPLLIILVGPSVKNIMN 320


>gi|86159245|ref|YP_466030.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775756|gb|ABC82593.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 306

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 110/182 (60%)

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           P +  + A  LI  + F  P++W+   VQ RQ+ + R+ PDALDLL+ CVE+G+ +D AL
Sbjct: 117 PVRTGLPAAALITGLAFFLPNLWLRARVQARQTQLDRSLPDALDLLVTCVEAGLGLDSAL 176

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
           +RV++++      LS+E+ L   E+     R  AF     RT    +R+ +  L Q++ +
Sbjct: 177 QRVSDEVALAHPLLSKELRLVFLEVKAGIARISAFRRMAERTGAPELRSLSATLAQTELF 236

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           GTS+G +LR+     R  R+  AE+KAA +  K+++P+++  LP +  V++GPA++++ +
Sbjct: 237 GTSVGAALRIQAEGIRIRRMHRAEEKAAYVSVKMSLPLVLCILPCVFAVVLGPAVVNMAE 296

Query: 325 TM 326
            +
Sbjct: 297 RL 298


>gi|239908016|ref|YP_002954757.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239797882|dbj|BAH76871.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 281

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 125/218 (57%), Gaps = 4/218 (1%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+R   +L I   ++    ++ L+LG +         + P Q ++  V+ +   GF  P
Sbjct: 59  AGYRQPSALEIYWGIKAGAALVGLVLGALAAMSG----KVPGQYKLFVVVGLTAAGFYIP 114

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            + + + V+ RQ++I+++ PDALDLL++CVE+G+ +D A+ RV +++  +   LS E+ L
Sbjct: 115 GMILDSRVKARQTAIQKSLPDALDLLVVCVEAGMGLDAAIYRVCQEMSLKDPILSAELRL 174

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
              EL     R+ A +N   R  ++ V +    LIQ+D +GTSI  +LRV     R++R 
Sbjct: 175 LTLELRAGKARREALKNLSARIGLEDVGSLVAMLIQTDMFGTSIAQTLRVYADSMRTKRF 234

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             AE+ AA L  KL +P+I F  P L++VI+GPA + I
Sbjct: 235 QLAEELAAKLPVKLLMPLIFFIFPTLLIVILGPAGIRI 272


>gi|212635449|ref|YP_002311973.1| Tight adherence TadC-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556933|gb|ACJ29387.1| Tight adherence TadC-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 321

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 168/330 (50%), Gaps = 37/330 (11%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSG---ELEKRMKSVAVEREILRKQQIT 61
           FFD  + T +  AI     I  +  A+ I  L SG    L KR+K++             
Sbjct: 11  FFD--NPTHVEWAIYAVAGIAGVTLAIAISYLISGFYSPLRKRLKTL------------- 55

Query: 62  SLQKDSASSRLRTRD--SKSLRNFVKKLNLKAILVDENIVNK--LRAAGFRSEYSLNILL 117
               ++  S   + D  S++L + + ++  K  L   N   +  L  AGF SE SL I  
Sbjct: 56  ----NTGDSGAPSGDAVSETLEHGMVEMAKKPFLNFSNHETRRLLIHAGFHSENSLAIFN 111

Query: 118 VVRLVVPIIFLILGIIWIFGYDKL----LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
            +RL++ ++  ++ ++ +  + K+    + Y F + +G   ++       PS+ + +L +
Sbjct: 112 AIRLLLLLLGAVISVLILNFFPKIAGIWIIYIFCMFIGGAFIL-------PSMVLQSLAK 164

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           +R   ++  +PDALDLL++C E+G+ +  AL+RVA+++      L+ E+ L  +++    
Sbjct: 165 RRMRLLRVGFPDALDLLVVCCEAGLGLMAALQRVAKELAFSHPSLASELELVCSKVRAGL 224

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
             +VA + F  RT ++ ++    A+ QS R GT I ++LRV   E R +RL  AE++AA 
Sbjct: 225 TIKVALQEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAAEEQAAK 284

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L  K+  PM+    P   +V +GPA+L ++
Sbjct: 285 LAVKMIFPMMCCIWPSFFIVAVGPAVLKVM 314


>gi|21673275|ref|NP_661340.1| TadC protein [Chlorobium tepidum TLS]
 gi|21646364|gb|AAM71682.1| TadC protein [Chlorobium tepidum TLS]
          Length = 312

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 93/329 (28%), Positives = 169/329 (51%), Gaps = 26/329 (7%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           + DA +    + +  ++ S+++A+    L S  ++KR+  +  +R             D 
Sbjct: 1   MLDALQFLTIVLSGAAVASVVFALYNWWL-SNTVKKRLSQIVRQRWA---------PADV 50

Query: 68  ASSRLRTRDS-KSLRNFVKKLNLKAILVDENIV-NKLRAAGFRSE------YSLNILLVV 119
           AS R  T     ++ N + KL+L       + V  +   AG R++      Y++  LLV 
Sbjct: 51  ASPRKPTPQKIDTVINILSKLSLPEEGWQSSTVRTRFLQAGIRNKNAPQYYYAVKTLLVF 110

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
            L V ++FL L     F   KL   P  L +  ++L    G+  P + +  + +KR   +
Sbjct: 111 GLPV-MLFLFLR----FAQPKL---PVILFLIFMLLSAAAGYYLPEIVMDFITKKRVERM 162

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           + + PD ++L+++C ESG+SID A+ R+++++      L++E  L   E+     R  + 
Sbjct: 163 RNSLPDMIELMVVCTESGMSIDAAIARISQEMARTHPDLAQEFYLAGLEMRAGATRIDSL 222

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
            N   RT +D + +    LIQ++++GTS+ +SLRV     R++R   AE+ AA +  KL 
Sbjct: 223 RNMALRTSLDELHDLVSMLIQAEKFGTSMAESLRVQSEVMRTKRTQRAEELAAKIPVKLV 282

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           +P+ +F  P L++V++GPAIL +ID +K 
Sbjct: 283 LPLGLFIFPTLLIVMLGPAILQLIDVLKH 311


>gi|303248308|ref|ZP_07334570.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490333|gb|EFL50245.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 314

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 128/219 (58%), Gaps = 4/219 (1%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AGFR   ++ I   +++   ++ L++G+ ++    ++   P Q ++ A +     GF  P
Sbjct: 92  AGFRQPGAVEIYWGLKVGAALVGLLVGV-FLAASGRI---PAQYKMFAALACVAGGFYLP 147

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            V + + V+KRQ +I    PDALDLL++CVE+G+ +D A+ RV  ++  +   LS E+ L
Sbjct: 148 GVVLDSRVKKRQKAILHGLPDALDLLVVCVEAGMGLDAAIYRVCLEMTHKEPILSSELRL 207

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
              EL    +R+ A +N  NR  ++ + +    LIQ+D +GTSI  +LRV     R++R 
Sbjct: 208 LTLELRAGKSRREALKNLSNRVGLEDMGSLVAMLIQTDMFGTSIAQTLRVYADSMRTKRF 267

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             AE+ AA L  KL  P+++F  P L++VI+GPA +S++
Sbjct: 268 QLAEELAAKLPVKLLFPLVLFIFPTLLIVILGPAGISLM 306


>gi|50119739|ref|YP_048906.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610265|emb|CAG73708.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 319

 Score =  119 bits (297), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 123/224 (54%), Gaps = 13/224 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG----AVILIGY-V 159
           AG R   ++  L++ +      FL + ++W +        P   R G    A  LIG+ V
Sbjct: 99  AGLRRNEAVGWLVMGKFAAGA-FLAIALVWGW-------LPPADRAGLTGVAAGLIGFFV 150

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  ++
Sbjct: 151 GSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMA 210

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  E+
Sbjct: 211 DELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADES 270

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ +I
Sbjct: 271 RKTLILGLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVI 314


>gi|253687073|ref|YP_003016263.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753651|gb|ACT11727.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 319

 Score =  119 bits (297), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 123/224 (54%), Gaps = 13/224 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG----AVILIGY-V 159
           AG R   ++  L++ +     +F I  ++W +        P   R G    A  LIG+ V
Sbjct: 99  AGIRRNEAVGWLVMGKFAAGALFAI-ALVWGW-------LPPADRAGLTGVAAGLIGFFV 150

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  ++
Sbjct: 151 GSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMA 210

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  E+
Sbjct: 211 DELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADES 270

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ ++
Sbjct: 271 RKTLILSLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVV 314


>gi|163846103|ref|YP_001634147.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523838|ref|YP_002568308.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
 gi|163667392|gb|ABY33758.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447717|gb|ACM51983.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
          Length = 311

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 134/250 (53%), Gaps = 12/250 (4%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII-FLILGIIWIF 136
           +SL N + +  LK     E +   L+ AG     S N+ + +R+ + I+ F+++G++ +F
Sbjct: 64  RSLLNTLGRFGLKQ--NQERLRINLQLAGNPGNISPNMFIGLRMALAIVLFVVIGLL-VF 120

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G       PF   +   ++ G +G+  P +W+   +++R+ +I +A PDALDLL I VE+
Sbjct: 121 G-----RLPFMQALMGALIAGMIGYILPGIWLDRKIKERKKNILKALPDALDLLCISVEA 175

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G++ D AL+RVA+    +   LS E    + ++     R+ A  +   RT ++ V+    
Sbjct: 176 GLAFDLALQRVAQKWDNE---LSREFQRVLQDIRLGRTRREALRDLVTRTGVEDVQTFVS 232

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           A+IQ+D+ G S+   LR+   + R  R   AE+ A     K+ +PM+    P L +VI+G
Sbjct: 233 AVIQADQLGVSMSKILRIQSDQLRVRRRQRAEEAAQKAPVKMLIPMVFLIFPALFVVILG 292

Query: 317 PAILSIIDTM 326
           PA+  I+  +
Sbjct: 293 PAVPRIMQAL 302


>gi|227326306|ref|ZP_03830330.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 319

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 123/224 (54%), Gaps = 13/224 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG----AVILIGY-V 159
           AG R   ++  L++ +     +F I  ++W +        P   R G    A  LIG+ V
Sbjct: 99  AGIRRSEAVGWLVMGKFAAGALFAI-ALVWGW-------LPPADRAGLTGVAAGLIGFFV 150

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  ++
Sbjct: 151 GSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMA 210

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  E+
Sbjct: 211 DELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADES 270

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ +I
Sbjct: 271 RKTLILGLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVI 314


>gi|294140782|ref|YP_003556760.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
 gi|293327251|dbj|BAJ01982.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
          Length = 322

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 103/180 (57%), Gaps = 7/180 (3%)

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
           Y   L VG   L+       PS+ + NL  +R   ++  +PDALDLL++C E+G+ +  A
Sbjct: 143 YVVALLVGGAYLL-------PSMVLQNLASRRMKELRAGFPDALDLLVVCCEAGLGLLAA 195

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           L+RVA ++    V L+ E+ L  +++      +VA + F +RT +D ++    A+ QS R
Sbjct: 196 LQRVANELAISHVSLASELDLVCSKVRAGLTIKVALQEFTDRTGLDDIKGLNSAISQSIR 255

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            GT I  +LRV   E R +RL EAE++AA L  K+  PM++   P   +V +GPA+L ++
Sbjct: 256 LGTGIAATLRVFSDEYRDKRLQEAEEQAAKLAVKMIFPMMLGIWPSFFIVAVGPAVLKVM 315


>gi|56697924|ref|YP_168295.1| TadC family type II/IV secretion system protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679661|gb|AAV96327.1| type II/IV secretion system protein, TadC subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 326

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 130/224 (58%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG++S+ ++      ++ + ++ L+LG++++F  +   +   Q  +  V+  G   
Sbjct: 97  KLRQAGYQSKDAVRFFHFAQMALGLVGLVLGVLYVFVIEADKDLDGQAMLIRVLGPGGAA 156

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+  V  R+ +I RA+PDALD+LL+CVE+G S+DQ++ RV++++      L++
Sbjct: 157 YFLPRYWITRRVDTRKENITRAFPDALDMLLVCVEAGQSLDQSIVRVSKELRASYPDLAD 216

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+     +     +   R  +  V +    +IQS ++GTSI ++LRV   E R
Sbjct: 217 EFEMVAYEMKAGKEKDKVLRDMGTRCGVVDVSSFVTVMIQSSQFGTSIAEALRVYAGEMR 276

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            +R+M AE+ A  L  K+T+  ++  +P L+++++GP+   I+D
Sbjct: 277 DKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVGPSAKGIMD 320


>gi|209515956|ref|ZP_03264817.1| type II secretion system protein [Burkholderia sp. H160]
 gi|209503614|gb|EEA03609.1| type II secretion system protein [Burkholderia sp. H160]
          Length = 316

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 125/226 (55%), Gaps = 7/226 (3%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR---VGAVILIGYVGF 161
           AGFR   ++++++  +L+   +F +  I+      ++ EY F  R   +G V ++G +  
Sbjct: 95  AGFRERRAVSMMIGFKLLAGALFALAAIVIGPYVPRIGEY-FVFRALMMGGVFIVGMI-- 151

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P + ++ L+ +RQ +I    PDALDLL+IC  +G S+   ++RVA ++     PL++E
Sbjct: 152 -LPEIALNALISRRQKAIASCLPDALDLLVICTNAGNSLVVGVKRVARELETICPPLADE 210

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
             +   EL    +   A  N   R  +  VR     LIQS +YGT I  SLR+L    R+
Sbjct: 211 FAVAGDELQVSGDSAGALRNLAARIGLPSVRALVTTLIQSQQYGTPITHSLRMLSRAERT 270

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            ++M  E+KAA L  K+T+PM++F LP + L+  GPA++ +I   K
Sbjct: 271 AQMMALEEKAAKLATKMTMPMMLFILPTVGLIAAGPAVIRLIAVFK 316


>gi|149175288|ref|ZP_01853910.1| probable secretion system protein TadC [Planctomyces maris DSM
           8797]
 gi|148845897|gb|EDL60238.1| probable secretion system protein TadC [Planctomyces maris DSM
           8797]
          Length = 308

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 150/276 (54%), Gaps = 14/276 (5%)

Query: 55  LRKQQITSLQKDSAS-SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
           LR   + +  +D+ S S L  + + +L    K L  K+ L +  +  +L  AG+ SE + 
Sbjct: 40  LRNPHLRNNPEDANSASSLFEKAAPALS---KALTPKSELEENQLKVRLANAGYNSEAAP 96

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG---AVILIGYVGFCAPSVWISN 170
           +I L +++ + ++ ++LG  + F       Y F +      ++++ G +GF  P + +  
Sbjct: 97  SIFLSLKVALGLLGVVLGSGYGF-------YNFGMTQNGWTSLVIAGGIGFYLPEIALRL 149

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           L++ R   I  + PDALDLL++CVE+G+ +D A+RRV+E++   +  +  E  L   +L 
Sbjct: 150 LIKGRVERIFLSLPDALDLLVVCVEAGLGLDAAMRRVSEELEETAPDVCSEFALCNLQLQ 209

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
               R+    +   R+ +D +R     LIQ+D++G+SI  +LRV     R +R   AE++
Sbjct: 210 MGRPRREVLHDLGIRSGVDDMRALAAILIQADKFGSSIAQALRVQSDSMRVKRSQLAEEQ 269

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           AA    K+  P+++F  P + +V++GPA + +I+ +
Sbjct: 270 AAMTAVKMIFPLVLFIFPGIFVVLVGPAAIMMINGL 305


>gi|82703469|ref|YP_413035.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411534|gb|ABB75643.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 313

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 100/163 (61%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P++ +  LV +R+  +  ++PDA+DL+ +CVE+G+ +D A+ RVAE++  +S  L+
Sbjct: 140 GYYLPNLVLGRLVLQRKRELFESFPDAIDLMTVCVEAGLGLDAAMVRVAEEMRLRSKALA 199

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E+ L   EL     R+ A  N   RT ++ +      L+Q+DR+GTS+  SLRV     
Sbjct: 200 SELHLVSLELRAGRTREQALRNLAMRTGVEEIEALVSMLVQADRFGTSVAASLRVHSDTL 259

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+ R + AE+ AA +  KL  P+I F  P L+LV++GPA ++I
Sbjct: 260 RTTRRLRAEEAAAKIALKLLFPLIFFIFPSLLLVLMGPAFINI 302


>gi|167842403|ref|ZP_02469087.1| bacterial type II secretion system protein F domain [Burkholderia
           thailandensis MSMB43]
          Length = 244

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 125/229 (54%), Gaps = 5/229 (2%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR  +++++++ ++LVV     +  ++      +  +Y   LRV  +++ 
Sbjct: 14  KLAARLASAGFRECHAVSVMVGLKLVVGACAGLAALVVGAHVPRAGDY-VVLRV--LMMA 70

Query: 157 G--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           G   +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++   
Sbjct: 71  GAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLSVAIRRVASELKTI 130

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL++E  +   EL        A      R  +  +R     L+QS +YGT I  SLR+
Sbjct: 131 CPPLADEFSVCANELQIGGEPAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRM 190

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 191 LSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 239


>gi|220918108|ref|YP_002493412.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955962|gb|ACL66346.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 319

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 128/226 (56%), Gaps = 4/226 (1%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L   GFR  +++++ L ++L + +  L+  +       + +E  F +     +L    G
Sbjct: 91  RLEQGGFRGPHAVSVHLALKLTLAVGLLLTFLFVNAHRAERIEPAFVV----AVLAFAAG 146

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           F  P + +++ +  RQ +++R  PDALDLL+ CVE+G+ +D +++RV+E+I      L+ 
Sbjct: 147 FYLPDLLLTSRISSRQLTLERGLPDALDLLVTCVEAGLGLDASVQRVSEEIHRAWPQLAT 206

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+  T  E+     R  AF     RT +  +++ +  L Q++ +GTS+  +LRV     R
Sbjct: 207 ELRTTFLEVKAGIPRIEAFRRLATRTGVKDLKSLSATLAQTEIFGTSVALALRVQSDGMR 266

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R+  AE+KAA +  K+T+P+I+  LP L+ VI+GPAI+ I+  +
Sbjct: 267 VRRMHRAEEKAAYVSVKMTLPLILCILPSLLAVIMGPAIIGIMRAL 312


>gi|186474108|ref|YP_001861450.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184196440|gb|ACC74404.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 323

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 105/163 (64%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P+V +S LV+ RQ +I    PDALDL+ +CVE+G+ +D A++RVAE+IG +S  L 
Sbjct: 149 GFYLPNVVLSRLVEARQRTIFEDLPDALDLMTVCVEAGLGLDAAMQRVAEEIGVKSRALK 208

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+ L + EL     R  A  N   RT ++ +   T  LIQ+DR+GTS+GDSLRV +   
Sbjct: 209 DELELVLLELRAGSARDKALRNLALRTGVEDIDTLTSMLIQADRFGTSVGDSLRVFIDAL 268

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+ R + AE++AA +  KL  P++    P LI+V+IGPA + +
Sbjct: 269 RTRRRLRAEEQAAKIALKLLFPLMFCIFPTLIVVLIGPAAMRV 311


>gi|83950071|ref|ZP_00958804.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837970|gb|EAP77266.1| type II/IV secretion system protein, TadC subfamily  protein
           [Roseovarius nubinhibens ISM]
          Length = 323

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 109/174 (62%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +++ G +G+ AP  W++   Q+RQ  I+  +PD+LD++L+CVE+G S+DQ++ RV+E+I 
Sbjct: 144 ILVPGAIGYLAPKYWVTKRQQQRQEEIQDGFPDSLDMMLVCVEAGQSMDQSIVRVSEEIR 203

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L++E  L   ++    ++        +R  +  + +    L+QS  +GTS+GD+L
Sbjct: 204 ASYPALADEYQLVAQQIKAGRDKASVLNEMGDRCGVQDISSFVTVLVQSQTFGTSVGDAL 263

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           RV  +E R +R+M AE+KA  +  K+T+  +   +P L+++++GP++L I+D M
Sbjct: 264 RVYAAEMRDKRVMRAEEKANKIPTKMTLCTMGLTVPPLLIILVGPSVLGIMDLM 317


>gi|78357408|ref|YP_388857.1| hypothetical protein Dde_2365 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219813|gb|ABB39162.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 324

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 147/287 (51%), Gaps = 9/287 (3%)

Query: 39  GELEKRMKSVAVEREI---LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVD 95
           G L  R ++  ++R +   +   +I+ +Q  + + + R + +  L + +  +  +    +
Sbjct: 28  GLLNGRQRAKQLQRRVRHHISPTRISGMQSAADTQQGRQQLTAKLNDLMSTIGERLAPRN 87

Query: 96  ENIVNK----LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
           E  + +    L  AG+RS  +  IL   +    ++ L  G++      + +  P  +   
Sbjct: 88  EEQMGQTNLALVRAGYRSRKAPLILWGAKAGCMLLGLTCGLLIRLAAGETI--PAGMLAL 145

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
             I    +G   P  W+S+ V+ R+  ++ + PDALDLL++CVE+G+ +DQA+ RVA ++
Sbjct: 146 LFICPAVLGLYLPDAWVSSKVRTRRRLMEDSLPDALDLLVVCVEAGMGLDQAIGRVAREL 205

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
              S  L EE+ + ++EL     R  + +N  +R  ++ V +    +IQ+D +GTSI  +
Sbjct: 206 SLSSPVLGEELSMLVSELRAGKTRSESLKNLAHRVGLEDVNSLVTLIIQADAFGTSIAHT 265

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           LRV     R+ R   AE+ AA +  KL  P++   LP L + I+GPA
Sbjct: 266 LRVYSDTMRTTRFQRAEEIAAKMPVKLLFPLVFCILPALFVAIMGPA 312


>gi|253701804|ref|YP_003022993.1| type II secretion system protein [Geobacter sp. M21]
 gi|251776654|gb|ACT19235.1| type II secretion system protein [Geobacter sp. M21]
          Length = 302

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 122/234 (52%), Gaps = 15/234 (6%)

Query: 95  DENIVNKLRAAGFRSEYSLNIL---LVVRLVVPIIFLILGII---WIFGYDKLLEYPFQL 148
           +   V  L AAGFR +     L   L++  V+P+I+L+         F    LL      
Sbjct: 73  ESKYVKALVAAGFRKDAFYRFLGAKLLLAGVLPLIYLLAVATPTRTFFTTQTLL------ 126

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
              A    G +G+ AP+ W+   V+ RQ  I    PD LDL+ +CVE+G+S+D AL R  
Sbjct: 127 ---ATAFFGIIGYLAPTYWLHLKVKARQLEIFHTLPDILDLVTLCVEAGLSMDAALIRTT 183

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           E    +  PL+ E+     E+     R  + ++   RT+++ + + T  + Q++R+GTS+
Sbjct: 184 ETPQFRDNPLAIEIRQVTMEVRAGKPRVESLKDMALRTRVEDIGSFTTMVTQAERFGTSL 243

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             +LR    E R++R   AE+ AA    KL  P+I+F  P L++VI+GPA++ I
Sbjct: 244 SHALRTFSDELRTKRRQTAEEAAAKTTIKLIFPLIMFIFPALLVVILGPAVVQI 297


>gi|84685156|ref|ZP_01013055.1| Putative Flp pilus assembly protein TadC [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666888|gb|EAQ13359.1| Putative Flp pilus assembly protein TadC [Rhodobacterales bacterium
           HTCC2654]
          Length = 329

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 145/293 (49%), Gaps = 33/293 (11%)

Query: 65  KDSASSRLR----------TRDSKSLRNFVKKLNLKAILVDE-----NIVNKLRAAGFRS 109
           +D A+ R+R           RD     + + +  LKA++ +E      I ++LR AGF  
Sbjct: 41  RDPAAERMRAASAAYGRAANRDLLKTPDALPEGMLKALIPEERAERTQIRDQLRRAGFGG 100

Query: 110 EYSLNILLVVRLVV----PIIFLIL-------GIIWIFGYDKL---LEYPFQLRVGAVIL 155
             +L    V+RL++    P+I L L       G+ W    DKL   L +    R+  V +
Sbjct: 101 PNALRNFFVLRLILATAAPVIALALTALNMSIGLPWFL--DKLVGGLTFISASRL--VAI 156

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
              +GF +P++W+   ++ RQ+ I+  +P+ALDLL I  E+G+  D A+ RV + +   S
Sbjct: 157 CTAIGFWSPTIWLKRKIRARQAEIEAGFPNALDLLQISTEAGMGFDAAMTRVGQSLATVS 216

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             +SEE LL  AE+    +R+ A  +   R  +  V    Q + QS  YGTSI  +L   
Sbjct: 217 PAISEEFLLCQAEILASRDRRQALADMAERMGVAEVSAFAQVVSQSMEYGTSIAKALNAY 276

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            +E R  R M+A +KA  L  +++  M +  LP L L+ +GP ++  +    D
Sbjct: 277 AAEMREMREMKAIEKANRLPVQMSGVMSVMMLPALFLITLGPTVIRYLSVFGD 329


>gi|322434108|ref|YP_004216320.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161835|gb|ADW67540.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 302

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 127/231 (54%), Gaps = 13/231 (5%)

Query: 94  VDEN--IVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
           ++EN  +  + + AGFR+  + +I    RL+ P   ++ GII           P Q +V 
Sbjct: 74  MNENAKLSERFQGAGFRTASARDIYFAARLIGPAAAIVFGII----------MP-QNKVF 122

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            ++++G + + AP + +S +V+ R+  I+ + PD +DLL+ICV++G+ +DQA+ RV +++
Sbjct: 123 WMMMVGGILYLAPDIILSRMVKGRREKIRLSIPDMIDLLVICVDAGLGMDQAMLRVGQEL 182

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G     + EE++    E      R  +++    RTQ+  +      L+Q++R+GT I  +
Sbjct: 183 GTTHPQIYEEIMQINREQRAGKLRLESWQAMAQRTQLPEIDGFVNMLMQNERFGTPIARA 242

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L       R +R   AE+ AA    K+  P+++F  P + +V++GPA +SI
Sbjct: 243 LSTFGDNIRQKRRQRAEELAAKTTVKIIFPLVLFIFPSMFIVLLGPAGISI 293


>gi|225181994|ref|ZP_03735426.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167279|gb|EEG76098.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 305

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 125/222 (56%), Gaps = 13/222 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
            GF ++  L + +V    +P  F +L     FG D L    F +    V + G +G+  P
Sbjct: 95  GGFSAKDYLGMKVVFAFGLPFFFYLL-----FGRD-LSPQTFLI----VAIAGVLGWRLP 144

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            + + N  + R++SI++++PD LDLL + V +G+  D AL +V E   G   P++EE   
Sbjct: 145 EMKLENTARSRKASIEKSFPDTLDLLTVSVGAGLGFDGALAKVVEKSEG---PVAEEFRR 201

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + E+     R+ A  +F  RT +D V++ T A++Q+D+ G +IG +L+V   + R +R 
Sbjct: 202 VLQEIKMGKARREALRDFGERTGIDDVKSFTGAIVQADQLGLNIGKTLKVQSEQMRRKRR 261

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              E++A  +  K+ +P++ F  P + +V++GPA++ I++T+
Sbjct: 262 QRVEEQAMKVPVKMLLPLVAFIFPTIFIVLLGPAMIQIVETL 303


>gi|163733537|ref|ZP_02140980.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
 gi|161393325|gb|EDQ17651.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
          Length = 327

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 140/275 (50%), Gaps = 17/275 (6%)

Query: 57  KQQITSLQKDSASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           K+QI +    +   RLR  + ++ L+ F   L  + +         LR AG++S+ ++  
Sbjct: 51  KKQIQTPGSSAPEQRLRQGERNEQLQKFASFLEPQDVAELSARQLMLRQAGYQSQDAVRF 110

Query: 116 LLVVRLVVP-------IIFL-ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
               +  +         ++L +LG    F   K++ Y         I+ G VG+  P  W
Sbjct: 111 FHFAQFALGLAGLLLAFVYLNLLGHGEGFTTQKMMIY--------TIIPGAVGYYLPVYW 162

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +   V  R+  I R +PD+LD++L+CVE+G S+DQ + RV++++      L++E  +   
Sbjct: 163 VRRRVDTRKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAY 222

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           E+    ++     +F  R  +  V +    L QS ++GTSI ++LRV   E R +R+M A
Sbjct: 223 EMKAGKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAGEMRDKRVMRA 282

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           E+ A  L  K+T+  ++  +P L+++++GP++  I
Sbjct: 283 EEAANKLPTKMTLATMMLTVPPLLIILVGPSVHGI 317


>gi|163751752|ref|ZP_02158970.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
 gi|161328404|gb|EDP99563.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
          Length = 322

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 127/231 (54%), Gaps = 3/231 (1%)

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           L +++    L  AG  SE +L +   VRL++ +I   L ++ +  +    E    + V  
Sbjct: 88  LTNDDTRRLLIHAGLHSENALAVFSSVRLILLLISAGLSVLILSLFP---EISGMMSVYV 144

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V L+    +  PS+ + +L  +R  +++  +PDALDLL++C E+G+ +  AL+RVA ++ 
Sbjct: 145 VALMVGGAYLLPSMVLQHLASRRMKNLRAGFPDALDLLVVCCEAGLGLLAALQRVANELA 204

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+ E+ L  +++      +VA + F  RT ++ ++    A+ QS R GT I  +L
Sbjct: 205 ISHASLASELDLVCSKVRAGLTIKVALQEFTERTGLEDIKGLNSAISQSIRLGTGIAATL 264

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R+   E R +RL +AE++AA L  K+  PM++   P   +V +GPA+L ++
Sbjct: 265 RIFSDEYRDKRLQDAEEQAAKLAVKMIFPMMLCIWPSFFIVAVGPAVLKVM 315


>gi|300692336|ref|YP_003753331.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
 gi|299079396|emb|CBJ52067.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
          Length = 313

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 134/237 (56%), Gaps = 10/237 (4%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVV----PIIFLILGIIWIFGYDKLLEYPFQLRV 150
           D ++  +   AG+R+  ++ I   V+ ++    P++   L +   F   + L++   L V
Sbjct: 78  DSSLHTRFVHAGWRAPEAIPIYFGVKTILAFGLPVLLFPLAL-GQFDASQRLQFLTVLFV 136

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
            A I     GF  P++ ++  ++ RQ  +  ++PD+LDL+++CVE+G+ +D A+ RV ++
Sbjct: 137 AAAI-----GFYLPNLVLAWKIKYRQRDVFESFPDSLDLIMVCVEAGLGLDAAILRVVDE 191

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +      +++E  L   EL    +R+ A  +F  RT +D V      LIQ+DR+GTSI  
Sbjct: 192 MRAARPVMAQEYELLTLELRAGLSREKALRHFAARTGVDDVSLLVAMLIQADRFGTSIAA 251

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           SLRV     R++R M AE++AA +G K+  P+I    P + +V++G A++ I++ ++
Sbjct: 252 SLRVHSDMLRTKRQMLAEERAAKIGTKILFPLIFCIFPSIYVVLLGSALIQIVEALR 308


>gi|309780755|ref|ZP_07675496.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308920437|gb|EFP66093.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 313

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 101/164 (61%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P+V ++  +++R+  I  A+PD+LDL+++CVE+G+ +D A+ RV ED+      ++ E  
Sbjct: 145 PNVVLAMKIKRRKRDIFEAFPDSLDLIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYE 204

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L   EL     R+ A  NF  RT ++ V      LIQ+DR+GTS+ +SLRV     R++R
Sbjct: 205 LLTLELRAGLAREKALRNFAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKR 264

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            M AE++AA +G K+  P+I    P L +V++GPA + I+  ++
Sbjct: 265 QMLAEERAAKIGTKVLFPLIFCLFPALYVVLLGPAGIQIMAGLR 308


>gi|83749633|ref|ZP_00946616.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|207744163|ref|YP_002260555.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
 gi|83723694|gb|EAP70889.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|206595567|emb|CAQ62494.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
          Length = 314

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 106/176 (60%), Gaps = 2/176 (1%)

Query: 154 ILIG--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           +L+G   +GF  P+V +   +++RQ  I  A+PD+LDL+++CVE+G+ +D A+ RV E++
Sbjct: 133 VLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEM 192

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 ++EE  +   EL     R+ A  N   RT ++ V      LIQ+DR+GTS+ +S
Sbjct: 193 RTARPAMAEEYEILTLELRAGLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAES 252

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LRV     R++R M AE++AA +  K+  P+I    P L +V++GPA + ++  ++
Sbjct: 253 LRVHSDMLRTKRHMLAEERAAKISTKILFPLIFCIFPSLFVVLLGPAAIQVVGALR 308


>gi|241662160|ref|YP_002980520.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864187|gb|ACS61848.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 313

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 101/164 (61%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P+V ++  +++R+  I  A+PD+LDL+++CVE+G+ +D A+ RV ED+      ++ E  
Sbjct: 145 PNVVLAMKIKRRKRDIFEAFPDSLDLIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYE 204

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L   EL     R+ A  NF  RT ++ V      LIQ+DR+GTS+ +SLRV     R++R
Sbjct: 205 LLTLELRAGLAREKALRNFAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKR 264

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            M AE++AA +G K+  P+I    P L +V++GPA + I+  ++
Sbjct: 265 QMLAEERAAKIGTKVLFPLIFCLFPALYVVLLGPAGIQIMAGLR 308


>gi|207728101|ref|YP_002256495.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
 gi|206591346|emb|CAQ56958.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
          Length = 314

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 106/176 (60%), Gaps = 2/176 (1%)

Query: 154 ILIG--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           +L+G   +GF  P+V +   +++RQ  I  A+PD+LDL+++CVE+G+ +D A+ RV E++
Sbjct: 133 VLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEM 192

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 ++EE  +   EL     R+ A  N   RT ++ V      LIQ+DR+GTS+ +S
Sbjct: 193 RTARPAMAEEYEILTLELRAGLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAES 252

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LRV     R++R M AE++AA +  K+  P+I    P L +V++GPA + ++  ++
Sbjct: 253 LRVHSDMLRTKRHMLAEERAAKISTKILFPLIFCIFPSLFVVLLGPAAIQVVGALR 308


>gi|328952510|ref|YP_004369844.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452834|gb|AEB08663.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 312

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 102/171 (59%), Gaps = 2/171 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P+V +     +R+  I +  PD LDLL IC+E+G+S+D AL RV+ ++   +  LS
Sbjct: 142 GYYLPAVILRRQASERRLKIWQELPDVLDLLNICIEAGLSLDSALYRVSRELRDIAPVLS 201

Query: 220 EEMLLTIAEL-SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
            E+     E+ S LP ++V  E   +R Q++ +      L+QS R GT I +SL+V    
Sbjct: 202 RELAQYFLEIQSGLPRKEV-LEKIVDRNQVNALSGVVNVLMQSSRLGTDIAESLKVYSVS 260

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            R+ER+  AE++ A +  KLT PM +  LP L+LV++GPA++ +++ +  H
Sbjct: 261 LRTERMQAAEEQGAKVSTKLTFPMTMLILPALLLVVLGPAMIKMLEKLSQH 311


>gi|259418040|ref|ZP_05741959.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346946|gb|EEW58760.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 323

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 123/219 (56%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG++S+ ++ +   ++  + +  L LG+ +++  +  ++Y        V+  G   
Sbjct: 97  KLRQAGYQSKDAVRLFHFLQFALGLSGLGLGLFFVYVMNADVDYTTNQMAMRVLGPGAAC 156

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+  +++R+ +I RA+PDALD++L+CVE+G S+DQA+ RV +++      L+E
Sbjct: 157 YYLPRYWITRRIEERKQAITRAFPDALDMMLVCVEAGQSLDQAIVRVGKELRASYPELAE 216

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+     +     +   R  +  V +    +IQS  +GTSI D+LRV   E R
Sbjct: 217 EFEIVAYEMKAGKEKDKVLRDMGTRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMR 276

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            +R+M AE+ A  L  K+T+  +   +P L+ ++I P++
Sbjct: 277 DKRVMRAEEAANKLPTKMTLATMGLTVPPLLAILIAPSV 315


>gi|326797332|ref|YP_004315152.1| type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
 gi|326548096|gb|ADZ93316.1| Type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
          Length = 316

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 119/219 (54%), Gaps = 3/219 (1%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG R   SL +    +L V +   ++ + ++   +K          G++I++    F A 
Sbjct: 96  AGLRHSQSLGLYTFGKLAVGLFLSVMFVFFVL--EKGDRLSLSALAGSLIILFLSSFSA- 152

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            +W+      R   +  + PDALDL++IC E+G+ + +  + V++++   S  L+EE+  
Sbjct: 153 EIWLKMRAASRGGKLSSSLPDALDLMVICAEAGLPLGRIFKTVSKELAFSSPELAEEIGY 212

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T AEL  L +R  A  N  +R  +D V      LIQ++RYGT +  +LR +  E+R   +
Sbjct: 213 THAELQILSDRSKALMNLADRCGVDNVAAMVSTLIQAERYGTPLSQALRTISVESRKNMV 272

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +E E+KA  L  +L+VP+++F LP +I ++  PA++ II
Sbjct: 273 LELEEKAGKLPAQLSVPLMVFILPPVIAMMGTPAMIRII 311


>gi|302391033|ref|YP_003826853.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203110|gb|ADL11788.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 306

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 99/173 (57%), Gaps = 3/173 (1%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           ++ G+ GF  P   +S  + +RQ  +++A PD LDLL + VE+G+  D AL RV + I G
Sbjct: 134 LIFGFAGFVIPRFLLSKKISERQKKMQQALPDVLDLLTVSVEAGLGFDSALVRVVDKIAG 193

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
              P+SEE    + E+     R+ A  +   RT ++ + N   A++Q+D+ G SIG  LR
Sbjct: 194 ---PISEEFERLLQEIRMGKPRRDAMRDLGERTNVEDLTNFITAIVQADKLGVSIGKVLR 250

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           V   + R +R   AE +A     K+ +P++ F  P L ++++GPA + +++++
Sbjct: 251 VQSKQIRQKRRQRAEAQAMKAPIKMLLPLVFFIFPTLFIILLGPAAIKVMNSL 303


>gi|103488240|ref|YP_617801.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98978317|gb|ABF54468.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 326

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 126/237 (53%), Gaps = 20/237 (8%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           + +  ++ AAG+RS ++           P I+ +L +  IF     L  P  L    V L
Sbjct: 90  QGLRRRMLAAGYRSPHA-----------PKIYTLLRLALIFALPSALVLPQLLSETPVDL 138

Query: 156 ---------IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
                    +  +G   PS++++    +R+  I   +PD LDL+L+CVE+G+ ++ AL R
Sbjct: 139 FMLYLQGAGLALMGLVIPSLFLTAKADRRRQEILNGFPDCLDLMLVCVEAGMGLEAALDR 198

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V  ++      ++E++  T  EL    +R+ A     +R+ +D +R     LIQSD+ G+
Sbjct: 199 VGREMTLSHPLVAEQISQTTLELRAGASREEALRALADRSGVDEIRAFATLLIQSDKLGS 258

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           SI  +LR+  +E R +R M AE+KA  L   L++P++   LPV+I V++ PA++ +I
Sbjct: 259 SIATTLRIYAAEMREKRRMRAEEKAHRLPVLLSIPLVACMLPVMIGVLMLPAVIRVI 315


>gi|261820219|ref|YP_003258325.1| type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
 gi|261604232|gb|ACX86718.1| Type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
          Length = 319

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 103/173 (59%), Gaps = 1/173 (0%)

Query: 152 AVILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A  LIG+ VG   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V+++
Sbjct: 142 AAGLIGFFVGSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKE 201

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +G  S  +++E+  T AEL  L +R +A  +   RT++  + +    LIQ++RYGT +  
Sbjct: 202 LGLSSPEMADELHYTAAELQILSDRTLAMRHLAERTRVSEIESMVATLIQAERYGTPLSQ 261

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +LR +  E+R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ +I
Sbjct: 262 ALRTIADESRKTLILGLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVI 314


>gi|99082191|ref|YP_614345.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038471|gb|ABF65083.1| hypothetical protein TM1040_2351 [Ruegeria sp. TM1040]
          Length = 323

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 121/219 (55%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KLR AG++S+ ++ +   ++  + +  L  G+  ++  +  +EY        V+  G   
Sbjct: 97  KLRQAGYQSKDAVRLFHFLQFALGLAGLGFGLFLVYVLNADVEYTTNQLAMRVLGPGAAA 156

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P  WI+  +++R+ +I RA+PDALD++L+CVE+G S+DQ++ RV +++      L+E
Sbjct: 157 YYLPRYWITRRIEERKQAITRAFPDALDMMLVCVEAGQSLDQSIVRVGKELQASYPELAE 216

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  +   E+     +     +   R  +  V +    +IQS  +GTSI D+LRV   E R
Sbjct: 217 EFEIVAHEMKAGKEKDKVLRDMATRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMR 276

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            +R+M AE+ A  L  K+T+  +   +P L+ ++I P++
Sbjct: 277 DKRVMRAEEAANKLPTKMTLATMGLTVPPLLAILIAPSV 315


>gi|152994352|ref|YP_001339187.1| type II secretion system protein [Marinomonas sp. MWYL1]
 gi|150835276|gb|ABR69252.1| type II secretion system protein [Marinomonas sp. MWYL1]
          Length = 316

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 127/223 (56%), Gaps = 11/223 (4%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV----GAVILIGYVG 160
           AGFR + +L +    +  + II ++L   ++FG   +LE   +L +    G+++L+ + G
Sbjct: 96  AGFRRQNALGVFTFCKFSLGIICILL---FLFG---VLESGNRLSLNGLAGSLMLL-FFG 148

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
             A  VW+      R   +  + PDALDL++IC E+G+ + +  + V++++   +  ++E
Sbjct: 149 SFAAEVWLKMRAASRGGRLSSSLPDALDLMVICAEAGLPLGRIFKTVSKELAFSAPEIAE 208

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+  T AEL  L +R  A  N   R  ++ V      LIQ++RYGT +  +LR +  E+R
Sbjct: 209 ELGYTHAELQILSDRTKALLNLSERCGVENVEAMVSTLIQAERYGTPLSQALRTISEESR 268

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              +++ E+KA  L  +L+VP+++F LP +I ++  PA++ II
Sbjct: 269 KRLVLDLEEKAGKLPAQLSVPLMVFILPPVIAMMGTPAMIRII 311


>gi|145219378|ref|YP_001130087.1| type II secretion system protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205542|gb|ABP36585.1| type II secretion system protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 313

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 103/180 (57%)

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           PF   +  V+     G+  P + +  + QKR   ++ + PD +DL++IC ESG+ ID A+
Sbjct: 130 PFTQSMMLVLSTAAAGYYLPELALRFITQKRHERMRDSLPDMIDLMVICTESGMGIDSAI 189

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            R++ ++   +  L++E  L++ E+     R  A  N   RT++  + +     +Q+ ++
Sbjct: 190 ARISREMARGNPDLAQEFYLSVLEIRAGATRIEALRNLALRTRLKDMDDLVTMFVQAHKF 249

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           GT I  +LRV     RS R   AE+ AA +  K+TVP+++F  P L++V++GPAI+ I++
Sbjct: 250 GTGIAQALRVQSDMLRSRRTQRAEEMAAKIPVKMTVPLVLFIFPTLLMVLLGPAIIQIME 309


>gi|78186531|ref|YP_374574.1| TadC protein [Chlorobium luteolum DSM 273]
 gi|78166433|gb|ABB23531.1| TadC protein [Chlorobium luteolum DSM 273]
          Length = 313

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 121/225 (53%), Gaps = 4/225 (1%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIF-LILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           K   AG RS+ +      V+ ++ ++    LG+   F    +   P    +  V+     
Sbjct: 88  KFLQAGIRSKNAPRYYFAVKTLLTVVLPAALGLFLYFFRPGV---PLTQSLLLVLSTAAA 144

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P + +  + Q+R   ++ + PD +DL+++C ESG+ ID A+ R++ ++   +  L+
Sbjct: 145 GYYIPELALRFITQQRHERMRNSLPDMIDLMVVCTESGMGIDSAIARISREMARGNPDLA 204

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E  L++ E+     R  A  N   RT +  + +     +Q+D++GT + +SLRV     
Sbjct: 205 QEFYLSVLEIRAGATRIEALRNLALRTNLKDMNDLVTMFVQADKFGTGMAESLRVQSDML 264

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           RS R   AE+ AA +  K+T+P+++F  P L++V++GPAI+ I++
Sbjct: 265 RSRRTQRAEEMAAKIPVKMTIPLVLFIFPTLLMVLLGPAIIQIME 309


>gi|78186665|ref|YP_374708.1| TadC protein [Chlorobium luteolum DSM 273]
 gi|78166567|gb|ABB23665.1| TadC protein [Chlorobium luteolum DSM 273]
          Length = 315

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 105/177 (59%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+     G+  P + +  + +KR   ++ + PD +DL++IC ESG+ ID A+ R+++++ 
Sbjct: 136 VVCTAAAGYYLPEMLLGFITRKRIGRLRDSLPDMIDLMVICTESGMGIDAAITRISKEMA 195

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G +  L++E  L+  E+     R  A  N   R++++ + +    L Q+DR+GTS+ +SL
Sbjct: 196 GTNPDLAQEFYLSALEIRAGATRIEALRNLALRSRLEDLDDLVSVLAQADRFGTSLAESL 255

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           RV     RS R   AE+ AA +  K+ +P+I+F  P L++V++GPA++ ++  + + 
Sbjct: 256 RVQSDMMRSRRTQRAEELAAKIPVKMLLPLILFIFPTLMMVLLGPAVIQVMHALSNK 312


>gi|163745841|ref|ZP_02153200.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161380586|gb|EDQ04996.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 326

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 133/260 (51%), Gaps = 5/260 (1%)

Query: 66  DSASSRLRTRDSKS-LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           D A  +LR  D  + L+ F K L  + +         LR AG+RS  ++ +    +  + 
Sbjct: 61  DGARQQLRQSDQNAQLQKFAKFLEPEDVAELSAKQLMLRQAGYRSRDAVRLYYFAQFALG 120

Query: 125 IIFLILGIIW--IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           I+ L+ G+++  + G  + +    Q  +   I  G +G+  P  W+   V  R+  I R 
Sbjct: 121 ILGLVGGLVYTKVLGGGEGMTT--QQTMMWAIGPGAIGYYLPKYWVRRRVDSRKEEITRG 178

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALD++L+CVE+G S+DQ + RV  ++      L+EE  +   E+    +R     + 
Sbjct: 179 FPDALDMMLVCVEAGQSLDQCIVRVGRELRASYPALAEEFEMVAYEMKAGKDRITVLNDM 238

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  V +    LIQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  
Sbjct: 239 SERCGVQDVSSFVTVLIQSAAFGTSIADALRVYAEEMRDKRVMRAEEAANKLPTKMTLAT 298

Query: 303 IIFFLPVLILVIIGPAILSI 322
           +   +P L++++IGP+   I
Sbjct: 299 MGLTVPPLLIILIGPSAHGI 318


>gi|221633000|ref|YP_002522225.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
 gi|221157259|gb|ACM06386.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
          Length = 303

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 103/184 (55%), Gaps = 5/184 (2%)

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           P Q RVG   ++  +G+  P+ W+S  + +R+ +I+RA PDA+DLL+I VE+G+  DQAL
Sbjct: 124 PVQYRVGLPFVLAALGWIVPNAWLSRRIAQRKRAIQRALPDAIDLLVISVEAGLGFDQAL 183

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSF-LPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
            RV E    +   L+ E   T++E+   +P RQ A  +   R  +D +     +L+Q+D+
Sbjct: 184 LRVVEKWDNE---LTREFARTLSEMRMGIPRRQ-ALRDLARRVNVDDLNVFIASLVQADQ 239

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            G SI   LR   ++ R  R   A++ A     K+  PM+    P L +VI+GPAI  I+
Sbjct: 240 LGVSISQVLRAQANQMRLRRRQRAQELAHKAPIKMIFPMVFLIFPALYVVILGPAIPRIV 299

Query: 324 DTMK 327
           +  +
Sbjct: 300 EAFR 303


>gi|89899611|ref|YP_522082.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89344348|gb|ABD68551.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 312

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 102/174 (58%), Gaps = 4/174 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P++ +S+LV  RQ  I  ++PDALDL+ +CVE+G+  + A+ RVA+D+  +S  L+
Sbjct: 139 GYYGPNLVLSHLVMVRQREIFESFPDALDLMTVCVEAGLGTEAAMMRVADDLQFKSPALA 198

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +EM L   EL     R+ A  N   RT ++ V      + Q++R+GTSI  SLR+     
Sbjct: 199 DEMRLVNLELRAGAVRERALRNLAIRTGVEEVDGFVTMISQAERFGTSIAASLRIHAELL 258

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI----IDTMKDH 329
           R+ R   AE+ AA +  KL  P+I    P L++V++GPA++ I    + TM  H
Sbjct: 259 RTRRRQRAEEAAAKIALKLLFPLIFCIFPSLMVVLMGPAMIQIYRVLLPTMGGH 312


>gi|296122167|ref|YP_003629945.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014507|gb|ADG67746.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 312

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 160/319 (50%), Gaps = 25/319 (7%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVER------EILRKQQITSLQKDSASS 70
           A    ++IF+ I   V  +L   ++  R +S A +R       +LR+QQ    QK+  S+
Sbjct: 6   ATIVPLAIFASITLAVFAAL---QIFSREQSRASQRLDEFNNPLLREQQRG--QKNGMSN 60

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR---LVVPIIF 127
            L     K+     K L  K+ L    +  +L  AGF S  +  I L ++   LVV ++ 
Sbjct: 61  LL----EKAAPALSKALEPKSELEQSQLKIRLANAGFHSPQAPMIYLAIKTVCLVVGLVL 116

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
                ++ +G         Q  +  +I+    GF  P   ++ L+ KR+ +I    PD L
Sbjct: 117 GGGLGMYRYGTT-------QAGLTTLIIAAGAGFYLPEGVLAYLISKRKQAIFLQLPDVL 169

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL++CVE+G+ +D  LRRVAE++   +  +  E+ +   +L    NR+    +   RT 
Sbjct: 170 DLLVVCVEAGLGLDAGLRRVAEELKDTAPEICGELAMCNLQLQMGRNRRDMLHDLGVRTG 229

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D V+     +IQ+D++G+SI  +LRV     R +R   AE+KA     ++  PM+IF  
Sbjct: 230 VDDVKALVAIMIQADKFGSSIAQALRVQSDSMRVKRRQIAEEKAQKTAVQMLFPMVIFIF 289

Query: 308 PVLILVIIGPAILSIIDTM 326
           P + +V++GPA + ++D +
Sbjct: 290 PGIFVVLVGPAAIKMMDQL 308


>gi|322419939|ref|YP_004199162.1| Type II secretion system F domain-containing protein [Geobacter sp.
           M18]
 gi|320126326|gb|ADW13886.1| Type II secretion system F domain protein [Geobacter sp. M18]
          Length = 303

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 120/226 (53%), Gaps = 13/226 (5%)

Query: 102 LRAAGFRSE-----YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
           L AAG++ E     +   ILL   L  P  +L+  ++      K      QL +GA+IL 
Sbjct: 80  LVAAGYKKESVFVFFGCKILLACGL--PGFYLLFYVM-----SKGFTMNRQLILGALIL- 131

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G+ APS W+ +   +RQ  I    PD LDL+ +CV++G+S+D AL +  E     + 
Sbjct: 132 AILGYLAPSYWLYHQYNERQLKIFHTLPDILDLITVCVDAGLSMDAALIKTTETPQFAND 191

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E+ +   E      R  + ++   RT +D VR     L Q++R+GTS+  +L V  
Sbjct: 192 PLAKEIKIATMETRAGKPRIESLKDMAERTMVDDVRAFVTMLSQTERFGTSLSQALSVHA 251

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
              R++R   AE+ AA    K+  P+I+F  P L++VI+GPA + I
Sbjct: 252 ESLRTKRRQMAEEAAAKTTIKMVFPLILFIFPALLVVILGPAYVQI 297


>gi|167845808|ref|ZP_02471316.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei B7210]
 gi|167894380|ref|ZP_02481782.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 7894]
          Length = 237

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 7   KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 65

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 66  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 125

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 126 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 185

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 186 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 232


>gi|167911026|ref|ZP_02498117.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 112]
          Length = 264

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 34  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 92

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 93  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 152

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 153 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 212

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 213 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 259


>gi|167738668|ref|ZP_02411442.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 14]
          Length = 253

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 23  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 81

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 82  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 141

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 142 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 201

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 202 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 248


>gi|126440858|ref|YP_001058913.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|254198255|ref|ZP_04904677.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei S13]
 gi|126220351|gb|ABN83857.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 668]
 gi|169654996|gb|EDS87689.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei S13]
          Length = 314

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 84  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 142

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 143 FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 202

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 203 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 262

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 263 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 309


>gi|167824262|ref|ZP_02455733.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 9]
 gi|167919042|ref|ZP_02506133.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei BCC215]
          Length = 246

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 16  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 74

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 75  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 134

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 135 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 194

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 195 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 241


>gi|126454623|ref|YP_001066155.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242317969|ref|ZP_04816985.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106b]
 gi|126228265|gb|ABN91805.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106a]
 gi|242141208|gb|EES27610.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106b]
          Length = 314

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 84  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 142

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 143 FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 202

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 203 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 262

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 263 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 309


>gi|167902780|ref|ZP_02489985.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei NCTC 13177]
          Length = 270

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 40  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 98

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 99  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 158

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 159 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 218

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 219 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 265


>gi|53719426|ref|YP_108412.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76810064|ref|YP_333441.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|121598751|ref|YP_993001.1| type II secretion system protein F [Burkholderia mallei SAVP1]
 gi|124385777|ref|YP_001026333.1| type II secretion system protein F [Burkholderia mallei NCTC 10229]
 gi|126450336|ref|YP_001080393.1| type II secretion system protein F [Burkholderia mallei NCTC 10247]
 gi|134282407|ref|ZP_01769112.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 305]
 gi|217421557|ref|ZP_03453061.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 576]
 gi|226196355|ref|ZP_03791937.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237812170|ref|YP_002896621.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|254177530|ref|ZP_04884185.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|254188724|ref|ZP_04895235.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254259567|ref|ZP_04950621.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1710a]
 gi|254297711|ref|ZP_04965164.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 406e]
 gi|254358538|ref|ZP_04974811.1| type II secretion system protein [Burkholderia mallei 2002721280]
 gi|52209840|emb|CAH35812.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76579517|gb|ABA48992.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|121227561|gb|ABM50079.1| bacterial type II secretion system protein F domain [Burkholderia
           mallei SAVP1]
 gi|126243206|gb|ABO06299.1| bacterial type II secretion system F domain protein [Burkholderia
           mallei NCTC 10247]
 gi|134246445|gb|EBA46534.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 305]
 gi|148027665|gb|EDK85686.1| type II secretion system protein [Burkholderia mallei 2002721280]
 gi|157807239|gb|EDO84409.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 406e]
 gi|157936403|gb|EDO92073.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698569|gb|EDP88539.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|217395299|gb|EEC35317.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 576]
 gi|225931572|gb|EEH27577.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237503370|gb|ACQ95688.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|254218256|gb|EET07640.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1710a]
          Length = 314

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 84  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 142

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 143 FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 202

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 203 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 262

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 263 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 309


>gi|167719676|ref|ZP_02402912.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei DM98]
          Length = 249

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 19  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 77

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 78  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 137

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 138 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 197

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 198 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 244


>gi|167821658|ref|ZP_02453338.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 91]
          Length = 266

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 122/227 (53%), Gaps = 1/227 (0%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV  +   
Sbjct: 36  KLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRVLMMAGA 94

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA ++     
Sbjct: 95  FVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICP 154

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  SLR+L 
Sbjct: 155 PLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLS 214

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I
Sbjct: 215 RTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLI 261


>gi|148655425|ref|YP_001275630.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567535|gb|ABQ89680.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 311

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 99/168 (58%), Gaps = 3/168 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P +W+   ++KR+ +I +A PDALDLL ICVE+G+S DQA++R+ E       PL
Sbjct: 142 MGYLLPGIWLGQQIKKRKKAIVKALPDALDLLCICVEAGLSFDQAMQRLTEK---WDDPL 198

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S+E    +++      R+ A ++  +R  +D V+    A+IQ+++ G SIG  LR+   +
Sbjct: 199 SKEFKRVLSDTRLGRPRRDAMKDMIDRCGVDDVQTFIGAVIQAEQLGVSIGRILRIQSDQ 258

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R  R   AE++A     K+  PM+    P L +VI+GPA+  I+ ++
Sbjct: 259 MRIRRRQRAEEEAHKAPIKMLFPMVFLIFPALFIVILGPAVPRIMKSL 306


>gi|27365656|ref|NP_761184.1| type II/IV secretion system protein TadC [Vibrio vulnificus CMCP6]
 gi|27361804|gb|AAO10711.1| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus CMCP6]
          Length = 293

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 100/164 (60%), Gaps = 2/164 (1%)

Query: 153 VILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           ++L+GYV G   P  W++    + +  +K++ PDA+DLL++CVESG+S+++A  RVA  +
Sbjct: 118 LVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLCVESGLSLNRAFERVARYL 177

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
             Q  P++E+  +T AEL  L +R  A  N   RT +  +      L  +D+YG+ + D+
Sbjct: 178 QEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHTLATTLTMADKYGSPLADT 237

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVI 314
           LR +  + R +R ++ E++A  L  K+T + M +  LP+L++VI
Sbjct: 238 LRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVMVI 281


>gi|37680188|ref|NP_934797.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37198935|dbj|BAC94768.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 293

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 100/164 (60%), Gaps = 2/164 (1%)

Query: 153 VILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           ++L+GYV G   P  W++    + +  +K++ PDA+DLL++CVESG+S+++A  RVA  +
Sbjct: 118 LVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLCVESGLSLNRAFERVARYL 177

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
             Q  P++E+  +T AEL  L +R  A  N   RT +  +      L  +D+YG+ + D+
Sbjct: 178 QEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHTLATTLTMADKYGSPLADT 237

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVI 314
           LR +  + R +R ++ E++A  L  K+T + M +  LP+L++VI
Sbjct: 238 LRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVMVI 281


>gi|320156058|ref|YP_004188437.1| flp pilus assembly protein TadC [Vibrio vulnificus MO6-24/O]
 gi|319931370|gb|ADV86234.1| flp pilus assembly protein TadC [Vibrio vulnificus MO6-24/O]
          Length = 293

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 100/164 (60%), Gaps = 2/164 (1%)

Query: 153 VILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           ++L+GYV G   P  W++    + +  +K++ PDA+DLL++CVESG+S+++A  RVA  +
Sbjct: 118 LVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLCVESGLSLNRAFERVARYL 177

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
             Q  P++E+  +T AEL  L +R  A  N   RT +  +      L  +D+YG+ + D+
Sbjct: 178 QEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHTLATTLTMADKYGSPLADT 237

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVI 314
           LR +  + R +R ++ E++A  L  K+T + M +  LP+L++VI
Sbjct: 238 LRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVMVI 281


>gi|320101695|ref|YP_004177286.1| type II secretion system F domain-containing protein [Isosphaera
           pallida ATCC 43644]
 gi|319748977|gb|ADV60737.1| Type II secretion system F domain protein [Isosphaera pallida ATCC
           43644]
          Length = 318

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 120/232 (51%), Gaps = 32/232 (13%)

Query: 105 AGFRSEYSLNILLVVRL---------VVPII-----FLILGIIWIFGYDKLLEYPFQLRV 150
           AGFRS  +++I + V+L         VVP++     F   GI++             + +
Sbjct: 98  AGFRSPNAVSIFMGVKLIFFLTSVAVVVPLVYTNYGFTTTGILY-------------MAI 144

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           GA I     G  APS ++  L  +RQ  I    PDALDL+++CVE+G+ +D A  R+A +
Sbjct: 145 GAAI-----GMIAPSFFLGYLKSRRQEQIFLTLPDALDLMVVCVEAGLGLDAAFNRIASE 199

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +   +  L EE  +   ++     R+    +   RT +  +R     LIQ++R+G+SI  
Sbjct: 200 LQTAAPVLCEEFAIANFQIRMGRPRREVLRDLGVRTGVADLRALAAVLIQAERFGSSIAS 259

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +LRV     R +R   AE+KAA    KL  P+++F  P + +V++GPA +SI
Sbjct: 260 ALRVQSDSMRIKRRQIAEEKAAKTAVKLLFPLVLFIFPGIFVVLVGPAAISI 311


>gi|227114881|ref|ZP_03828537.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 319

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 103/173 (59%), Gaps = 1/173 (0%)

Query: 152 AVILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A  LIG+ VG   P  W+      R   +  A PDALDL+++C E+G+ I + L+ V+++
Sbjct: 142 AAGLIGFFVGSMVPEWWLKWRAASRGEKLACAVPDALDLMVVCAEAGLPIGRVLQVVSKE 201

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +G  S  +++E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  
Sbjct: 202 LGLSSPEMADELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQ 261

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +LR +  E+R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ ++
Sbjct: 262 ALRTIADESRKTLILSLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVV 314


>gi|261252092|ref|ZP_05944665.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
 gi|260935483|gb|EEX91472.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
          Length = 314

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 127/258 (49%), Gaps = 11/258 (4%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII-FLILGI 132
           +R  KSL +    +        E+I  KL  AG+    +L     ++ V  ++ FL+   
Sbjct: 65  SRLEKSLESLAPAMKSSNSKESESIRVKLMHAGYHDASALTFFYAMKGVSMVVGFLMAAG 124

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFC--APSVWISNLVQKRQSSIKRAWPDALDLL 190
           I+ F        P ++ +  + +IG V F    P+V +S +V KRQS I+   PDALDLL
Sbjct: 125 IYFFA-------P-EMSMRNIAMIGSVAFGLYCPNVVLSMMVDKRQSRIRSGIPDALDLL 176

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           ++C ESG+  + ALRRVA+++       ++E+     ++S       AF +   RT +  
Sbjct: 177 VVCTESGLGFNAALRRVADELTISHPDFADELDTVCVKISAGVEMSDAFNDLIKRTGLSE 236

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +      L  + R G S+  +LR    + R +R  E E+ AA +  K+  P++IF  P  
Sbjct: 237 IAGLVTMLAHASRIGGSLSQTLREYTEDYRDKRNQEIEEIAAKIPTKMIFPLLIFIWPCF 296

Query: 311 ILVIIGPAILSIIDTMKD 328
            +V IGP++L    TM +
Sbjct: 297 FIVAIGPSMLLFTSTMGN 314


>gi|187927682|ref|YP_001898169.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|187724572|gb|ACD25737.1| type II secretion system protein [Ralstonia pickettii 12J]
          Length = 320

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 105/168 (62%)

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L+  +G+  P+  ++  V+ RQ  +   +PD LDLL +CVE+G+ +D A+ RV++++  +
Sbjct: 140 LLSAIGYYLPNAALARKVEHRQRDVFEEFPDMLDLLTVCVEAGLGLDAAMMRVSDELALR 199

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              ++EEM LT+ EL     ++ A  N   RT ++ V      LIQ+DR+GTS+ DSLRV
Sbjct: 200 CPVMAEEMELTLLELRSGFPKEKALTNLALRTGVEDVDRFASMLIQADRFGTSLADSLRV 259

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L    R++R M AE++AA +  KL  P+I F  P L+LV++GPA + I
Sbjct: 260 LSDMLRTKRRMRAEEQAAKIALKLLFPLIFFIFPTLLLVLLGPAFIQI 307


>gi|27365114|ref|NP_760642.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|320155497|ref|YP_004187876.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
 gi|27361260|gb|AAO10169.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|319930809|gb|ADV85673.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
          Length = 314

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 140/277 (50%), Gaps = 16/277 (5%)

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVD----ENIVNKLRAAGFRSEYS 112
           K+++  + K+ +   L+ + S+ + N ++ L    +  D    E+I ++L  AGF +  +
Sbjct: 46  KKKLEQIHKEVSGKALKKK-SRKVENTLESLAPIVVGKDSKEKESIRSQLMHAGFHNRDA 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEY--PFQLRVGAVILIGYVG-FCAPSVWIS 169
           L +   ++    I F +LG    FG    + +  P       V+++   G    P++ ++
Sbjct: 105 LTVFYAIK----IFFAVLG----FGGAAAVFFLLPDMDNSTLVMVVAVAGGLYIPNIGLN 156

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
           + V+KRQ  I+   PDALDLL++C ESG+  + ALR+VA+++       ++E+    A++
Sbjct: 157 HFVKKRQRMIRAGVPDALDLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCAKI 216

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
                   AFE    RT +  +      L  + + G S+  +LR    + R +R  E E+
Sbjct: 217 KAGVEMSTAFEELVTRTGLSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEE 276

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            AA +  K+  P+++F  P   +V +GPA+LS+ D +
Sbjct: 277 IAAKIPTKMIFPLLLFIWPCFFIVAVGPALLSLSDAL 313


>gi|197117442|ref|YP_002137869.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197086802|gb|ACH38073.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 302

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 120/234 (51%), Gaps = 15/234 (6%)

Query: 95  DENIVNKLRAAGFRSEYSLNIL---LVVRLVVPIIFLILGIIW---IFGYDKLLEYPFQL 148
           +   V  L AAGFR +     L   L++  V+P+I L+         F    LL      
Sbjct: 73  ESKYVKALVAAGFRKDAVYRFLGAKLLLAGVLPLICLLAVATTSRTFFTTQTLL------ 126

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
              A      +G+ AP+ W+   V+ RQ  I    PD LDL+ +CVE+G+SID AL R  
Sbjct: 127 ---ATAFFSIIGYLAPTYWLHLKVKARQLEIFHPLPDILDLVTLCVEAGLSIDAALIRTT 183

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           E    +  PL+ E+     E+     R  + ++   RT+++ + + T  + Q++R+GTS+
Sbjct: 184 ETPQFRDNPLAIEIRQVTMEVRAGKPRVESLKDMAVRTRVEDIGSFTTMVAQAERFGTSL 243

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             +LR    E R++R   AE+ AA    KL  P+I+F  P L++VI+GPA++ +
Sbjct: 244 SHALRTFSDELRTKRRQMAEEAAAKTTIKLIFPLIMFIFPALLVVILGPAVVKL 297


>gi|323700365|ref|ZP_08112277.1| Type II secretion system F domain [Desulfovibrio sp. ND132]
 gi|323460297|gb|EGB16162.1| Type II secretion system F domain [Desulfovibrio desulfuricans
           ND132]
          Length = 318

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 129/262 (49%), Gaps = 15/262 (5%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLR----AAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           KS+ +F  +L  K    +   ++K R     AG R   S  I   ++      FL +G+ 
Sbjct: 62  KSVVDFFGRLGTKIGPTETEEIDKGRLRLIQAGMRKPDSYKIFQGLK-----GFLAVGLA 116

Query: 134 WIFGYDKLL---EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             F   + L   +    +     + +  VG   P  W+S  + +R+ ++    PDALDLL
Sbjct: 117 GGFLLVRFLFIEDMSIAMTAFGTVTLAAVGVYGPEYWLSKKINRRKLAVGDELPDALDLL 176

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           ++CVESG+ +DQA+ RV +++      +S E  L   EL     R  A  +   R  +D 
Sbjct: 177 VVCVESGMGLDQAVDRVCQEMKNSGPIISSEFKLLTLELRAGKARIDALRSLAERVGLDD 236

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           + + T  LIQ+D +G S+G +LRV     R +R   AE+KAA +   L +P++ F LP L
Sbjct: 237 LNSLTSLLIQADAFGISVGRTLRVYSDAMRVKRSQRAEEKAAKMPVLLLLPLVAFILPTL 296

Query: 311 ILVIIGPAILSIID---TMKDH 329
            + I+GPA++  +D    M  H
Sbjct: 297 FVAILGPAVIMSMDMFLKMNSH 318


>gi|37680835|ref|NP_935444.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37199584|dbj|BAC95415.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 329

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 140/277 (50%), Gaps = 16/277 (5%)

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVD----ENIVNKLRAAGFRSEYS 112
           K+++  + K+ +   L+ + S+ + N ++ L    +  D    E+I ++L  AGF +  +
Sbjct: 61  KKKLEQIHKEVSGKALKKK-SRKVENTLESLAPIVVGKDSKEKESIRSQLMHAGFHNRDA 119

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEY--PFQLRVGAVILIGYVG-FCAPSVWIS 169
           L +   ++    I F +LG    FG    + +  P       V+++   G    P++ ++
Sbjct: 120 LTVFYAIK----IFFAVLG----FGGAAAVFFLLPDMDNSTLVMVVAVAGGLYIPNIGLN 171

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
           + V+KRQ  I+   PDALDLL++C ESG+  + ALR+VA+++       ++E+    A++
Sbjct: 172 HFVKKRQRMIRAGVPDALDLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCAKI 231

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
                   AFE    RT +  +      L  + + G S+  +LR    + R +R  E E+
Sbjct: 232 KAGVEMSTAFEELVTRTGLSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEE 291

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            AA +  K+  P+++F  P   +V +GPA+LS+ D +
Sbjct: 292 IAAKIPTKMIFPLLLFIWPCFFIVAVGPALLSLSDAL 328


>gi|193213109|ref|YP_001999062.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
 gi|193086586|gb|ACF11862.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
          Length = 313

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 146/274 (53%), Gaps = 20/274 (7%)

Query: 66  DSASSR-LRTRDSKSLRNFVKKLNLKAILVDEN-----IVNKLRAAGFRSEYSLNILLVV 119
           D  SS+ ++++   ++ N + KL+L     DE      +  K   AG R++ +      +
Sbjct: 50  DKPSSKPVKSQRVATVVNILSKLSLP----DEGWQSSAVRVKFLQAGIRNQNAPQYYFAI 105

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV----GFCAPSVWISNLVQKR 175
           + ++ ++F +L  +++     +L  P +L++  +IL   +    G+  P + +  + Q+R
Sbjct: 106 KTLLTLVFPVLLALFL-----VLNQP-KLQLIHIILFALLTAAAGYYLPELLLRFITQRR 159

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
              ++   PD ++L++IC E+G+SID A  R++ ++      LS+E  L+  E+     R
Sbjct: 160 IERMRNGLPDMIELMVICTEAGMSIDAASTRISREMARSYPDLSQEFYLSSLEMRAGATR 219

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
             A  N   R  ++ + +    LIQ+D++GTS+ DSLRV     R+ R   AE+ A  + 
Sbjct: 220 LDALRNMALRVGLEELEDLVSVLIQADKFGTSLADSLRVHSDVMRTRRSQRAEELANKVP 279

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            K+ +P+I+F  P L++V++GPAI+ ++D +   
Sbjct: 280 VKMLLPLILFIFPTLLMVLLGPAIIQLLDVLSKQ 313


>gi|162147495|ref|YP_001601956.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786072|emb|CAP55654.1| putative type II secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 313

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 148/286 (51%), Gaps = 20/286 (6%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNL---KAILVDENIVNKLR----A 104
           R  LR +Q+  L    A++ +RT D +    F++++ +   ++ L+    + +L+    +
Sbjct: 35  RRTLRLRQLHELSVGEANA-VRTIDGRIWFRFLERIGVFFARSGLLSAKTLGELQQTLSS 93

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG----YDKLLEYPFQLRVGAVILIGYVG 160
             F     L + +  + V  ++ +++G  W+       D +L     L  GA +    VG
Sbjct: 94  VSFLGTRFLPVFIGAKAVTLVVGIVVG--WLIHEETRSDGMLYLVLSL--GAPV----VG 145

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
             AP   +  +      ++ +  PDALD+L+IC E+G+ I+ A+ RV  ++   +  ++ 
Sbjct: 146 LLAPDFVVKRMQAHYLRNVDQGIPDALDMLVICAEAGLPIEAAIGRVGREMTAVNRSVAN 205

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  LT  E+    +R+  F +F  RT +  +R    AL Q+ + G+S+  +LRVL  E R
Sbjct: 206 EFRLTAQEMGVASDRRDVFLHFGERTNLSSMRRIGSALNQTLQAGSSVTQALRVLSVEMR 265

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            + L E E +AA L   LT+PMI+F LPV+ LV+ GPA ++++  +
Sbjct: 266 KDALTEYEARAARLPVLLTLPMILFILPVVFLVVGGPAAVTVMHAL 311


>gi|300704935|ref|YP_003746538.1| tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072599|emb|CBJ43949.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
          Length = 314

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 107/176 (60%), Gaps = 2/176 (1%)

Query: 154 ILIG--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           +L+G   +GF  P+V +   +++RQ  I  A+PD+LDL+++CVE+G+ +D A+ RV E++
Sbjct: 133 VLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEM 192

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 ++EE  L   EL     R+ A  N   RT ++ V      LIQ+DR+GTS+ +S
Sbjct: 193 RTARPAMAEEYELLTLELRAGLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAES 252

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LRV     R++R M AE++AA +G K+  P+I    P L +V++GPA + ++  ++
Sbjct: 253 LRVHSDMLRTKRHMLAEERAAKIGTKILFPLIFCIFPSLFVVLLGPAAIQVVGALR 308


>gi|209545602|ref|YP_002277831.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533279|gb|ACI53216.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 313

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 148/284 (52%), Gaps = 16/284 (5%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNL---KAILVDENIVNKLR----A 104
           R  LR +Q+  L    A++ +RT D +    F++++ +   ++ L+    + +L+    +
Sbjct: 35  RRTLRLRQLHELSVGEANA-VRTIDGRIWFRFLERIGVFFARSGLLSAKTLGELQQTLSS 93

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG--YVGFC 162
             F     L + +  + V  ++ +++G  W+   +   +    L    V+ +G   VG  
Sbjct: 94  VSFLGTRFLPVFIGAKAVTLVVGIVVG--WLIHEETRSDGMLYL----VLSLGAPMVGLL 147

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           AP   +  +      ++ +  PDALD+L+IC E+G+ I+ A+ RV  ++   +  ++ E 
Sbjct: 148 APDFIVKRMQAHYLRNVDQGIPDALDMLVICAEAGLPIEAAIGRVGREMTAVNRSVANEF 207

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            LT  E+    +R+  F +F  RT +  +R    AL Q+ + G+S+  +LRVL  E R +
Sbjct: 208 RLTAQEMGVASDRRDVFLHFGERTNLSSMRRIGSALNQTLQAGSSVTQALRVLSVEMRKD 267

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            L E E +AA L   LT+PMI+F LPV+ LV+ GPA ++++  +
Sbjct: 268 ALTEYEARAARLPVLLTLPMILFILPVVFLVVGGPAAVTVMHAL 311


>gi|218710398|ref|YP_002418019.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
 gi|218323417|emb|CAV19594.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
          Length = 323

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 130/254 (51%), Gaps = 18/254 (7%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG--IIWI 135
           +SL  F+ K N K    +E    KL  AGF  + +L++   ++++  ++ +I G  + +I
Sbjct: 76  ESLSPFISKGNKKD---NETYSQKLMHAGFHEKNALSVFYALKVLSSLVGIIAGFMVYYI 132

Query: 136 -FG--YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            FG  Y+ LL          ++   ++G   P++ +S L ++RQ  I+   PDALDLL++
Sbjct: 133 SFGGSYNNLL----------IMTCVFLGTFTPNIILSKLQKERQKKIRNGVPDALDLLVV 182

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + AL RVA ++      L++E+    A++        A   F +RT +  + 
Sbjct: 183 CTESGLGFNAALGRVASELYVSQPELADELETVFAKIQAGVTMPDALRQFIDRTGLVELE 242

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+  +LR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 243 GLVSLLSHASRMGGSLAQTLRDYTVDFRDKRQQAAEEIAAKIPTKMLFPMLLFIWPCFFI 302

Query: 313 VIIGPAILSIIDTM 326
           V +GP I+ +ID +
Sbjct: 303 VALGPGIIIVIDAL 316


>gi|115376389|ref|ZP_01463626.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
 gi|115366596|gb|EAU65594.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
          Length = 238

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 116/229 (50%), Gaps = 10/229 (4%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
           +  +  KL  AG  S Y    ++ ++ +  +I LI+G+I   G  + L +         +
Sbjct: 14  ESKMRRKLIKAGDPSGYKPEDIMALQEIGLVIGLIMGLILANGLSQHLAWS--------L 65

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L    G   P++W+++ V++R  +I RA P  LDLL + VE+G+    AL +V E   G+
Sbjct: 66  LAALFGLYYPAIWVNDQVKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVEK--GK 123

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
           S PL EEM + + +L     R+ A +    R  +  +     ALIQ+D+ GTS+G  LR+
Sbjct: 124 SGPLKEEMSIVLKQLKMGKTREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRI 183

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             ++ R +R   AEK A     K+  P+I    P + +V+ GP +   +
Sbjct: 184 QSTQMRIDRTQRAEKLAGEAPVKMLFPLIACIFPTVFMVLFGPIVFQFM 232


>gi|310822671|ref|YP_003955029.1| type II secretion system protein f domain-containing protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395743|gb|ADO73202.1| Type II secretion system protein F domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 296

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 114/223 (51%), Gaps = 10/223 (4%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL  AG  S Y    ++ ++ +  +I LI+G+I   G  + L +         +L    G
Sbjct: 78  KLIKAGDPSGYKPEDIMALQEIGLVIGLIMGLILANGLSQHLAWS--------LLAALFG 129

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P++W+++ V++R  +I RA P  LDLL + VE+G+    AL +V E   G+S PL E
Sbjct: 130 LYYPAIWVNDQVKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVEK--GKSGPLKE 187

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           EM + + +L     R+ A +    R  +  +     ALIQ+D+ GTS+G  LR+  ++ R
Sbjct: 188 EMSIVLKQLKMGKTREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRIQSTQMR 247

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            +R   AEK A     K+  P+I    P + +V+ GP +   +
Sbjct: 248 IDRTQRAEKLAGEAPVKMLFPLIACIFPTVFMVLFGPIVFQFM 290


>gi|220913386|ref|YP_002488695.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860264|gb|ACL40606.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 291

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 132/249 (53%), Gaps = 13/249 (5%)

Query: 77  SKSLRNFVKKLNLKAILVDENIVNK-LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
           S+ L  F +++  K     E  ++K L  AG   ++ L  +L+V+ ++     ++G +  
Sbjct: 52  SQHLVEFSQRITPKGY---EGWLDKQLSGAGRPKQWPLARILMVKPMLAFGGALIGFMLF 108

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
            G       P   R    +LI  +G+  P + + N  QKR+ +I+   P+ALD +LI V+
Sbjct: 109 LGA------PSAGRFVMAVLIVALGYFVPDLLLRNRAQKRREAIRLELPNALDQMLISVQ 162

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+  + A+ R  E+  G   PL+EE++ T+ ++    +R+ A+     R  +  VR   
Sbjct: 163 AGLGFETAMGRAGENGRG---PLAEELIRTLQDIQVGRSRKEAYLALSERVDVPSVRTFV 219

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           +A++Q+D YG +I + L+    + R +R   AE+ A  +  K+  P+I F LP L +V++
Sbjct: 220 RAVVQADAYGIAIANVLKTQAKDMRIKRRQLAEEHAMKMPVKMLFPLIFFILPTLFIVLL 279

Query: 316 GPAILSIID 324
           GPA+L I+ 
Sbjct: 280 GPAVLQIMS 288


>gi|323491540|ref|ZP_08096719.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
 gi|323314116|gb|EGA67201.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
          Length = 313

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 132/271 (48%), Gaps = 6/271 (2%)

Query: 57  KQQITSLQKDSASSRLRT-RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           K +++ L+  + + + +T R   +L +    +        E+I  KL  AG+    +L +
Sbjct: 46  KAKLSQLKSANGTEKHKTKRLENTLESLAPAMQPSNSKESESIREKLMHAGYLDANALTV 105

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
              ++ +  +I L++   + F           +R  A+++   VG   P+V +  +V KR
Sbjct: 106 FYALKGMSTVIGLLMAAGFFF-----FAPDMSMRNLAMVVSVAVGLYGPNVVLGFMVDKR 160

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           QS I+   PDALDLL++C ESG+  + ALRRVA+++       ++E+     +++     
Sbjct: 161 QSKIRGGIPDALDLLVVCTESGLGFNAALRRVADELTISHPEFADELDTVCVKVNAGVEM 220

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
             AF +   RT +  +      L  + + G S+  +LR    + R +R  E E+ AA + 
Sbjct: 221 SDAFNDLIQRTGLKEIAGLVTMLAHASKIGGSLSQTLREYTEDYRDKRNQEIEEVAAKIP 280

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            K+  P++IF  P   +V IGP++L    TM
Sbjct: 281 TKMIFPLLIFIWPCFFIVAIGPSMLLFTATM 311


>gi|149909167|ref|ZP_01897824.1| putative type IV pilus protein [Moritella sp. PE36]
 gi|149807691|gb|EDM67637.1| putative type IV pilus protein [Moritella sp. PE36]
          Length = 294

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 156/305 (51%), Gaps = 20/305 (6%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLR 81
           +++  LI   VI  + +G+ ++R         +L++  + S+++    + L   +S S  
Sbjct: 7   IAVALLITGAVIALMFNGQAQRR-------ELLLQRLTLVSVEQSRRFTHLPQAESTS-- 57

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
           +   +LN     V  +I   L  AGF    +    L+ ++ V    LI G+ W +  D  
Sbjct: 58  SLWPRLN-----VAPDISMLLVKAGFHGPRAGAYFLLSKISV---MLISGLAWQWYVDFD 109

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
           L+   +  +   ++    G      W+    +     I  A PDALDL++ICVESG++++
Sbjct: 110 LD---KFVLAKTLVFAISGGLLAEHWLKWRARTVNYRIALALPDALDLMVICVESGLTLE 166

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
              +RV  ++   S  LS E L+T AEL  L +R  A  N   RT +  V N   AL Q+
Sbjct: 167 AVFQRVGHEMTAVSPELSREWLITEAELRLLDSRLTALNNLAKRTDLVEVENMVIALSQA 226

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           ++YG+ I  ++R++ S++R  + +  E+K   +  K+++P+++  +  ++++I+ P I++
Sbjct: 227 EKYGSKIAPTMRLIASDSRQYQYLRLEEKVGKIPAKMSLPVVVLIMLPVVVLIVAPTIIA 286

Query: 322 IIDTM 326
           ++D++
Sbjct: 287 LLDSI 291


>gi|87199542|ref|YP_496799.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135223|gb|ABD25965.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 322

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 138/278 (49%), Gaps = 10/278 (3%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSK---SLRNFVKKLNLKAILVDEN---IVNKLRAA 105
           R  LR   + S   + A + L    S    S+ N +++  L   L D N   +  KL AA
Sbjct: 40  RAHLRTVSVDSGASNGAETSLAQSRSGPFWSIVNVIERTGLS--LADSNPDALRTKLIAA 97

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPS 165
           GF +  +  I  + RL++  +     I ++      L       VG+V   G +G  AP+
Sbjct: 98  GFEATEAPTIYTLSRLILVFLLPACAISYLMLTGSELTIFKLYMVGSVS--GLLGLIAPA 155

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
            ++     +R  +I   +P+ LDL+L+CVE+G+ ++ A  RV+ +I      ++  ++ T
Sbjct: 156 WFVRIKADRRMEAITNGFPNCLDLILVCVEAGLGMEAAFDRVSREIARAEPQVAHLLVRT 215

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
              L     R+ A         +D +R+    LIQS++ GTSIG +LRV  SE R +R M
Sbjct: 216 NLHLRAGATREEALHRMATLAGVDEIRSFATLLIQSEKLGTSIGTTLRVFASEMREKRRM 275

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            AE+KA  L   +++P++   LP +I V++ PA + ++
Sbjct: 276 RAEEKAHRLPVLISLPLVTCMLPTMIGVLMIPAAIRVV 313


>gi|27378607|ref|NP_770136.1| hypothetical protein blr3496 [Bradyrhizobium japonicum USDA 110]
 gi|27351755|dbj|BAC48761.1| blr3496 [Bradyrhizobium japonicum USDA 110]
          Length = 302

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 99/165 (60%), Gaps = 2/165 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG   P + ++ L ++  ++I+   PD +DLL++C E+G+ ++  L RVA+++   + P+
Sbjct: 132 VGILGPRLILAVLKRRFDAAIRVGTPDMIDLLVVCSEAGMGLESGLARVAQEMSETNPPM 191

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           +  +   + +L  LPNR  AF+     T  D +R     + QS +YGT +G +LR +  +
Sbjct: 192 ARVLHCLLDDLRILPNRSDAFDKLG--TTSDGLRRFGTMVAQSLQYGTPVGQALRNIAVD 249

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            R ER+ + E++A  LG KLT+PM++F LP + +V+ G  IL ++
Sbjct: 250 LRRERITKLEERAHKLGAKLTIPMVLFLLPAMFVVLGGSPILHLV 294


>gi|317123667|ref|YP_004097779.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315587755|gb|ADU47052.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 306

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 148/312 (47%), Gaps = 29/312 (9%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           AV++F L+ A+   S GSG      KS+A+   ++        Q+ +  + L  +D    
Sbjct: 12  AVAVFGLVLAL---SFGSGGPTGVAKSLAMIEGVVT-------QRSAVKTELDAKDRLVE 61

Query: 81  RNFVKKLNLKAIL----VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
             F +   +  +L      + +   L  AG  S ++   ++  + V  +I L+LG+ +  
Sbjct: 62  PIFNRAQRIATVLSPQGTSDRLARGLERAGNPSPWTAERVMGAKGVALLIGLLLGVAY-- 119

Query: 137 GYDKLLEYPFQLRVGAVILIGYVG--FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                    F LR G V  +G+ G  F  P++ + N   +RQ  +     +ALD+L +CV
Sbjct: 120 -------GGFSLR-GFVFALGFGGAAFWLPNLLVYNAALRRQEQVATGLAEALDMLTVCV 171

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G   D AL +VA    G   P+S E    ++E+    +R  AF    +R  +  V+N 
Sbjct: 172 EAGQGFDAALVQVARSTDG---PISGEFARVLSEVQIGKSRSEAFAGLGDRVSLSDVKNF 228

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A+IQ+D+ G  I   LR   +  R  R   AE+KA  +  K+  P+++   P + +VI
Sbjct: 229 VSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVTVKILFPLLLCIFPAMFVVI 288

Query: 315 IGPAILSIIDTM 326
           +GP I+ +I T+
Sbjct: 289 LGPGIIRMITTL 300


>gi|319940445|ref|ZP_08014790.1| hypothetical protein HMPREF9464_00009 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806071|gb|EFW02820.1| hypothetical protein HMPREF9464_00009 [Sutterella wadsworthensis
           3_1_45B]
          Length = 303

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 107/180 (59%), Gaps = 3/180 (1%)

Query: 150 VGAVILIG---YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
           +G + L+G   + G   P   + ++  +R ++++R+ PDALDL++IC E+G+   + ++ 
Sbjct: 122 IGTIALMGAGYFAGGILPEWVLKSMAARRYTALERSMPDALDLMVICAEAGLPFTRIVKV 181

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V+ ++   +  L+ E+ LT AEL  +P R  A  N   RT++  +      LIQ++++GT
Sbjct: 182 VSRELELSAPVLAHELTLTNAELEIMPERSAALRNLAERTRVPSIEGMVSTLIQAEQFGT 241

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            +  +L  + +E+RS  ++  E++A  L  +L++P++   LP ++ ++  PA++ +I ++
Sbjct: 242 PLAQALHNIAAESRSTLILTLEERAGKLPARLSLPLMTLILPPVVAIVAAPALMRVIRSL 301


>gi|302037432|ref|YP_003797754.1| pilus assembly protein TadC [Candidatus Nitrospira defluvii]
 gi|300605496|emb|CBK41829.1| Pilus assembly protein TadC [Candidatus Nitrospira defluvii]
          Length = 318

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 104/168 (61%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
            G+  P +W+   ++ RQ +I  A+PDALDL+++CVE+G+S+D A+ RV +++      L
Sbjct: 145 AGWYGPDLWLQRRIESRQRNILAAFPDALDLMVVCVEAGLSLDVAITRVGQELQLMHREL 204

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           SEE+     EL    +RQ A  N   R Q++ V++    L+Q++R+GTS+G +LR     
Sbjct: 205 SEELRALYLELRTGRSRQQALRNAGLRIQLEEVQSFVALLVQTERFGTSVGQALRAHADG 264

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R+ + ++A + AA L  KL +P+I F  P L++V++GPA + +I  +
Sbjct: 265 LRTRQDLQATEMAAKLPVKLLLPLIFFIFPSLLVVLLGPAAIQVIRQL 312


>gi|319951073|ref|ZP_08024926.1| Type II secretion system F domain protein [Dietzia cinnamea P4]
 gi|319435233|gb|EFV90500.1| Type II secretion system F domain protein [Dietzia cinnamea P4]
          Length = 300

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 160/321 (49%), Gaps = 40/321 (12%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVA-----VEREILRKQQITSLQKDSA 68
           LAV + TA S+F L +AV      SG    R ++VA     ++     +  +T +  D +
Sbjct: 7   LAVFVLTA-SMFLLAFAVF-----SGRDTVRARTVANLRRGIDDGFASQVDLTGVDDDDS 60

Query: 69  SSRL-----RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
            SRL     R     ++R   +KL+++A              G    +S+  L+V ++VV
Sbjct: 61  RSRLYEVARRLTPVGTVRRL-EKLSIRA--------------GRPRGWSIQRLVVAKIVV 105

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P+I ++LG+        L   P  L +   +    V +  P + + +  Q+R   I    
Sbjct: 106 PLIVVLLGLAL------LRTNPEPLLLLLTLGTAVVCYFLPELLLQSRGQERNDEIALEL 159

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
            D LD + I VE+G+  D A+ R   +  G   PL++E++ T+ E+     R+ A+E   
Sbjct: 160 ADTLDQMTIAVEAGLGFDAAMARAGRNGTG---PLAQELIRTLQEIQVGQLRRTAYEQLA 216

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +  +R   +A+IQ+D YG S+ D LR   SE R +R   AE+KA  +  K+  P++
Sbjct: 217 LRTDVPDLRRFIRAIIQADAYGISVADVLRTQASEMRLKRRQRAEEKAQQVPVKVIFPLL 276

Query: 304 IFFLPVLILVIIGPAILSIID 324
           +  LPVL +V++GP ++++++
Sbjct: 277 VCILPVLFIVLLGPTVINMME 297


>gi|167584966|ref|ZP_02377354.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 324

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 107/170 (62%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++++G +G+  P+V +S  +  RQ  I   +PDALDLL +CVE+G+S+D AL +V E++ 
Sbjct: 141 LVVLGAIGYYLPNVVLSRRIASRQRVIFEDFPDALDLLTVCVEAGLSLDSALLKVCEELQ 200

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  ++ E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSIGDSL
Sbjct: 201 FRSPIVASELDLMLLEMRSGFTKEAALRNLALRTGVEDIESFCAMLIQADRFGTSIGDSL 260

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           RVL    R+ R M AE++AA +  KL  P+I    P L+ V++GPA + I
Sbjct: 261 RVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHI 310


>gi|188586923|ref|YP_001918468.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351610|gb|ACB85880.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 317

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 114/202 (56%), Gaps = 9/202 (4%)

Query: 127 FLI--LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           FLI  LG++    +   L  P  +  G V++I  +GF  P +W+S+ V  R++ I+RA P
Sbjct: 119 FLIICLGLVMAVFFVTFLSTP--VWTGMVLVI--LGFIGPKLWLSSKVNTRKNEIQRALP 174

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           + LDLL + VE+G+  + +L++VAE+  G   PL+ E+     E+S   +R+ A  +   
Sbjct: 175 EFLDLLTVSVEAGLGFESSLKKVAEEGTG---PLAVEIKRVTQEISMGKSRKEALIDLKE 231

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  +  +     A+IQ+++ G  I   L+V   E R +R   AE++A     KL +P+I+
Sbjct: 232 RIDLQDLSTFINAIIQAEQLGVGISRVLKVESKEFRRKRRQRAEEQAMKAPVKLLIPLIL 291

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
           F  P + ++++GPA L I+D +
Sbjct: 292 FIFPTIFIILLGPAALRIMDNL 313


>gi|308050051|ref|YP_003913617.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
 gi|307632241|gb|ADN76543.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
          Length = 321

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 93/172 (54%), Gaps = 1/172 (0%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+L+G +    PS  +      R   I+  +PDALDLL++C ESG  +  AL+RV+ ++ 
Sbjct: 146 VMLMG-LAILTPSFILDRFAASRMRKIRNGFPDALDLLVVCCESGQGLLAALQRVSVELR 204

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+EE+LL   +         A   F  RT +D +R    A+ QS R GT I ++L
Sbjct: 205 VSHKELAEELLLVCQKNRAGIELSTALHEFSERTGLDDIRGLNGAITQSLRLGTGIAETL 264

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           RV   E R +R+  AE+ AA LG K+  PM+    P   +V +GPA++ +++
Sbjct: 265 RVYADEYRDKRMQAAEEMAAKLGVKIIFPMLTCIWPSFFIVAVGPAVIKVME 316


>gi|119717342|ref|YP_924307.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538003|gb|ABL82620.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 304

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 95/165 (57%), Gaps = 3/165 (1%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P +++      R   I+RA PDA+DLL I VE+G+  D A+++VA+   G   PL++
Sbjct: 142 YFGPRLYLYQKSYDRSERIRRALPDAIDLLTISVEAGLGFDAAVQQVAQHTEG---PLAD 198

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+   + E+    +R  A  +   RT +  +R    A++Q+D  G  I   LRV   E R
Sbjct: 199 ELSRVLREMQLGQSRSAALRSLSARTTVPELRGFVGAMVQADALGIPIAQVLRVQSREIR 258

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            +R   AE++A  +  K+TVP+I   LP L +V++GPA+L+I+DT
Sbjct: 259 VKRRQHAEERAQQVPVKITVPLIFCILPCLFVVVLGPAVLNIMDT 303


>gi|269960464|ref|ZP_06174836.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834541|gb|EEZ88628.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 314

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 115/229 (50%), Gaps = 7/229 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPII-FLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
           NKL  AGF    SL++   ++ V  II  +I  ++++   +    Y F      + L  +
Sbjct: 92  NKLMHAGFHQSNSLSMFYAIKSVTTIIGVMIATLVYLTIPESKYLYTF------MALAVF 145

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG   P   +  ++ KRQ +I+   PD LDLL++C ESG+  + ALRRVA+++      L
Sbjct: 146 VGLVLPDFILRRMIDKRQRAIRAGVPDMLDLLVVCTESGLGFNAALRRVADELVISHPEL 205

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E+     ++        A      RT +D +      L  + R G S+ +SLR    +
Sbjct: 206 ADEVDTVCNKIQAGKPMPEALRELVYRTGLDELMGLVSMLSHASRIGGSLVNSLREYTED 265

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            R +R   AE+ AA +  K+  PM++F  P   +V IGPA++S+ +  K
Sbjct: 266 YRDKRQQAAEEMAAKIPVKMMFPMVLFIWPCFFIVAIGPALISLAEAFK 314


>gi|269126091|ref|YP_003299461.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311049|gb|ACY97423.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 307

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 94/166 (56%), Gaps = 3/166 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P + + N   +RQ  +KR+ PD LDLL++ VE+G+  D AL RVA+   G   PL+
Sbjct: 141 GFFLPDILLYNAGLRRQEELKRSLPDTLDLLVVSVEAGLGFDAALTRVAQHTSG---PLA 197

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           EE+   + E+    +R  A  +   R  ++ VR    AL+Q+   G SIG  LR    E 
Sbjct: 198 EELARVLQEIRIGKSRTEALRSMGERVAVEEVRTFIAALVQASELGMSIGVVLREQAREA 257

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           R +R   AE+ A  +  K+  P+++  LP LI+ ++GP +LSI+++
Sbjct: 258 RLKRRQRAEEMAQKVPVKVMFPVVLCILPALIITVVGPGVLSIMES 303


>gi|239814537|ref|YP_002943447.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801114|gb|ACS18181.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 301

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 97/160 (60%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P++ +  +++ RQ  I   +PDA DL+L+CVE+G+ +D AL +V E+I  +S  L++E+ 
Sbjct: 131 PNIVLRMMIKSRQREIFENFPDAADLMLVCVEAGLGLDAALVKVTEEIRVKSEALAQELH 190

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T  E+     R+ +  N   RT ++ +      L Q+DR+GTSIG+SLRV   + R +R
Sbjct: 191 WTNLEMRAGSTREKSLRNLALRTGVEEIGTFATMLTQADRFGTSIGESLRVFSEDLRHKR 250

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + AE+ AA +  K+ +P+++   P +  VI+ PA + I+
Sbjct: 251 QVRAEELAAKVPTKMLLPLVVCIFPCISAVILTPAAIRIV 290


>gi|219850073|ref|YP_002464506.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544332|gb|ACL26070.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 129/249 (51%), Gaps = 10/249 (4%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           ++L +++ +  LK     E +   L+ AG     S N+ + +R+ + +    + +  + G
Sbjct: 64  RALLSYLGRFGLKQ--NQERLRANLQMAGNPGNISPNMFIGLRMALALTLATVIVPLVIG 121

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              L++      +  V +   +G+  P +W+   +++R+ +I +A PDALDLL I VE+G
Sbjct: 122 RLSLIQA-----LAGVAIAFMIGYILPGIWLDRKIKERKKNILKALPDALDLLCISVEAG 176

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++ D AL+RVA+    +   LS E    + ++     R+ A  +   RT ++ V+    A
Sbjct: 177 LAFDLALQRVAQKWDNE---LSHEFQRVLQDIRLGRTRREALRDMAARTGVEDVQTFVSA 233

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+D+ G S+   LR+   + R+ R   AE+ A     K+ +PM+    P L +VI+GP
Sbjct: 234 VIQADQLGVSMSKILRIQSDQLRTRRRQRAEEAAQKAPVKMLIPMVFLIFPALFVVILGP 293

Query: 318 AILSIIDTM 326
           A+  I+  +
Sbjct: 294 AVPRIMSAL 302


>gi|148261008|ref|YP_001235135.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|146402689|gb|ABQ31216.1| type II secretion system protein [Acidiphilium cryptum JF-5]
          Length = 307

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 121/230 (52%), Gaps = 4/230 (1%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E + + LR AG R + +L + +  +L+      +L ++      + L       V A ++
Sbjct: 81  EELRHTLRMAGIRDKGALALFVGTKLLSLTGLSVLSLL----MSRFLHMTAGHAVIAAVV 136

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               G   P + I    ++    ++    DALDL++IC ++G+S++ AL RVA ++    
Sbjct: 137 GAIGGLLLPDIIIQQRRKRFIQKVEGGLADALDLMVICADAGLSLESALVRVAGELQLTH 196

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             +++E  LT  E+    N + +      RT +D ++     LIQ+ +YGT +  +LR L
Sbjct: 197 PAVAQEFTLTAQEMRIGGNIRDSLNALGVRTGLDSLKRLASTLIQTLQYGTPLTQALRTL 256

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            SE R E+L   E++AA L   LT+PMIIF LP + LV+ GPA+L ++ +
Sbjct: 257 SSELRQEQLTRFEERAARLPVLLTLPMIIFILPCVFLVVGGPAVLKLLAS 306


>gi|87310969|ref|ZP_01093094.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
 gi|87286259|gb|EAQ78168.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
          Length = 288

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 118/228 (51%), Gaps = 12/228 (5%)

Query: 99  VNKLRAAGFRSEYSLNILLVVRL---VVPI-IFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
             +L   GF S  ++++ ++ RL   V P+ I L + ++ IF        PF   +   +
Sbjct: 50  TRRLVLGGFHSPTAISLFMLARLLLMVCPVFIALAIALLGIF--------PFHTTILVGV 101

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
            +G++G   P +W+ +  Q+RQ  ++ + PD +DL++ C+E G+   +A+  V +++   
Sbjct: 102 CLGFIGILIPELWLRSCTQQRQKRLRESLPDFVDLVVTCLEGGMGAAEAISHVHQELTST 161

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              LS E+ L   + +   +   +F     RT ++ VR  +  L  S R+G+++G+++  
Sbjct: 162 HADLSYELGLVARDGTLGISLDKSFRRMAERTGVEEVRTLSTFLEHSQRFGSAMGEAMHE 221

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L    R +R   AE++A     K+ +P ++F  P + +V+ GPA + I
Sbjct: 222 LSDMLRYQREQRAEERAQQASVKILIPTLLFIFPTIFVVLAGPAAIQI 269


>gi|326404408|ref|YP_004284490.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|325051270|dbj|BAJ81608.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 307

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 121/230 (52%), Gaps = 4/230 (1%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E + + LR AG R + +L + +  +L+      +L ++      + L       V A ++
Sbjct: 81  EELRHTLRMAGIRDKGALALFVGTKLLSLTGLSVLSLL----MSRFLHMTAGHAVIAAVV 136

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               G   P + I    ++    ++    DALDL++IC ++G+S++ AL RVA ++    
Sbjct: 137 GAIGGLLLPDIIIQQRRKRFIQKVEGGLADALDLMVICADAGLSLESALVRVAGELQLTH 196

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             +++E  LT  E+    N + +      RT +D ++     LIQ+ +YGT +  +LR L
Sbjct: 197 PAVAQEFTLTAQEMRIGGNIRDSLNALGVRTGLDSLKRLASTLIQTLQYGTPLTQALRTL 256

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            SE R E+L   E++AA L   LT+PMIIF LP + LV+ GPA+L ++ +
Sbjct: 257 SSELRQEQLTRFEERAARLPVLLTLPMIIFILPCVFLVVGGPAVLKLLAS 306


>gi|294139875|ref|YP_003555853.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
 gi|293326344|dbj|BAJ01075.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
          Length = 293

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 152/277 (54%), Gaps = 17/277 (6%)

Query: 60  ITSLQKDSASSRLRTRD------SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
           + + Q+D   +RL+  +      SK   N   +L  K I V ++I   L  AGF S+++ 
Sbjct: 25  VKARQRDGVVARLQLVERGAIAFSKPQNNNNNQLKSK-IRVSDDIKALLLRAGFYSDHAA 83

Query: 114 NILLVVRLVVPIIFLILGIIWI-FGYDKLLEYPFQLRVGAVI-LIGYVGFCAPSVWISNL 171
           ++ +V +L+V I   I  + +  F  DK++     L  G V  +IG +G      W+   
Sbjct: 84  SLFVVAKLLVAISCFIGWMAYSGFSLDKII-----LAKGVVFAVIGGIGV---EHWVKFR 135

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            +   S I  A PDALDL+++CVESG++++    RV +++   S  LS E L+T AEL  
Sbjct: 136 ARLVSSRIAGATPDALDLMVVCVESGLTLEAVFGRVGQEMVNFSPELSREWLITEAELRL 195

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
           L +R  A +N   RT +  + N   AL Q+++YG+ I  S+R++ S++R  + +  E+K 
Sbjct: 196 LDSRPQALKNLALRTGIIEIENMVIALSQAEKYGSPIAKSMRLIASDSRQHQYLALEEKV 255

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             +  K+++P+++  +  ++++I+ P I+ ++ ++ +
Sbjct: 256 GKIPAKMSMPLVVLVMIPVVVLIVAPTIIELMTSIGE 292


>gi|84387237|ref|ZP_00990258.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
 gi|84377884|gb|EAP94746.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
          Length = 323

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 133/278 (47%), Gaps = 22/278 (7%)

Query: 58  QQITSLQKDSASSRLRTRDS----KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
           +++  + +D A +  +  D     +SL  F+ K N K    +E    KL  AGF  + SL
Sbjct: 52  KKLRQISEDGAPTGRKPYDFSNTLESLSPFISKGNKKD---NETYSEKLMHAGFHEKSSL 108

Query: 114 NILLVVRLVVPII-----FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWI 168
           ++   ++++  +I     F++  I     Y+ LL          ++   ++G   P++ +
Sbjct: 109 SVFYALKVLSSLIGIVAAFMVYYIALGGDYNNLL----------IMTCVFLGTFTPNIIL 158

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE 228
           S L ++RQ  I+   PDALDLL++C ESG+  + AL RVA ++       ++E+    A+
Sbjct: 159 SKLQKERQKKIRNGVPDALDLLVVCTESGLGFNAALGRVASELYVSQPEFADELETVFAK 218

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAE 288
           +        A      RT +  +      L  + R G S+  +LR    + R +R   AE
Sbjct: 219 IQAGVTMPDALRQLIERTGLVELEGLVSLLSHASRMGGSLAQTLRDYTEDFRDKRQQAAE 278

Query: 289 KKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           + AA +  K+  PM+IF  P   +V +GP +L ++D +
Sbjct: 279 EIAAKIPTKMLFPMLIFIWPCFFIVALGPGLLIVMDAL 316


>gi|197118215|ref|YP_002138642.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197087575|gb|ACH38846.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 304

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 112/230 (48%), Gaps = 13/230 (5%)

Query: 104 AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI-----GY 158
           AAGF+ E ++ + L  +L        L  +   GY  L   P      ++ ++       
Sbjct: 83  AAGFKKE-AVYVFLGAKL-------FLAFLLPAGYLMLFALPRGTMASSISILVATACAV 134

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
            G+  P++W+      R+++I  A PD LDLL +CVE+G+ +D A+ + AE+   ++ PL
Sbjct: 135 AGYLLPTIWLDRRAGVRKTAIFHALPDVLDLLTVCVEAGLGLDAAIIKTAENFQEKNCPL 194

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E    I E+     R  A +    RT +D ++     LIQ+++ GTS+G +LR+    
Sbjct: 195 IAEFNAVILEIRAGRPRSEALKGLAERTTLDDIKALVSMLIQTEKLGTSLGKTLRIYSDS 254

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R++R   AE++AA    K+  P+     P  ++V++ PA   I    K 
Sbjct: 255 LRTKRKQLAEERAAKTAVKMLFPLTFCVFPAFMVVLLVPAFFRIFQMFKH 304


>gi|317154600|ref|YP_004122648.1| type II secretion system F domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944851|gb|ADU63902.1| Type II secretion system F domain protein [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 317

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 93/166 (56%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G   P VW+     KR+ ++    PDALDLL++CVESG+ +DQAL RV  ++      +
Sbjct: 145 LGVYGPEVWLRRRTTKRRLAVANELPDALDLLVVCVESGMGLDQALDRVCHEMRTSGPVI 204

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S E  L   EL     R  A      R  +D + + T  L+Q+D +G S+G +LRV    
Sbjct: 205 SAEFKLLTLELRAGKGRGDALRGLSERVGLDDLNSLTSLLVQADIFGISVGRTLRVYSDA 264

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            R++R   AE+KAA L   L +P+I F LP L + I+GPA++  ID
Sbjct: 265 MRTKRSQRAEEKAAKLPVLLLLPLIGFILPALFIAIMGPAVILFID 310


>gi|315181052|gb|ADT87966.1| Flp pilus assembly protein TadC [Vibrio furnissii NCTC 11218]
          Length = 318

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 134/273 (49%), Gaps = 5/273 (1%)

Query: 50  VEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRS 109
           ++R++   ++  +++     ++ R +   +L +    ++ K I   E++ ++L  AG+  
Sbjct: 45  IQRQLEEIRKAGTVKTPGNLTKKRDKIHNTLESIAPIMSPKNIKERESVRHQLMHAGYHD 104

Query: 110 EYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
             +LN    ++++  +  + +  +  F Y  +           V+    +G   P+  + 
Sbjct: 105 ASALNTFYALKVLSTLAGVSISALMYFLYPDMKNLKL-----IVVFSVAMGLFLPNFLLD 159

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
            +V+KR+S IK   PDALDLL++C ESG+  + ALRRVA+++      L++E+    A++
Sbjct: 160 RMVKKRKSRIKGGIPDALDLLVVCTESGLGFNAALRRVADELMISHPDLADELDTVCAKI 219

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
                   A      RT +  +      L  + R G SI  +LR    + R +R  E E+
Sbjct: 220 KAGVEMSEAMAQLVERTGLTEISGLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEIEE 279

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            AA +  K+  P+++F  P   +V +GP++LS+
Sbjct: 280 IAAKIPTKMIFPLLLFIWPCFFIVAVGPSMLSL 312


>gi|258621455|ref|ZP_05716489.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|258627496|ref|ZP_05722277.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|262171240|ref|ZP_06038918.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
 gi|258580302|gb|EEW05270.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|258586843|gb|EEW11558.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|261892316|gb|EEY38302.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
          Length = 314

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 121/233 (51%), Gaps = 11/233 (4%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF-QLRVGAVIL 155
           +I  +L  AGF +  +L++   ++      F ILG    F    L+ +    +  G +++
Sbjct: 89  SIRTQLMHAGFHNRDALSLFYALK----TSFAILG----FSGAALVFFLLPDMDNGTLVM 140

Query: 156 IGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +  V  G   P++ + + V++RQ +I+   PDALDLL++C ESG+  + ALR+VA+++  
Sbjct: 141 LVSVAGGLYLPNMGLHHFVKERQRTIRAGVPDALDLLVVCTESGLGFNAALRKVADELAI 200

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
                ++E+    A++        AF+    RT +  +R     L  + + G S+  +LR
Sbjct: 201 SHPEFADELDTVCAKIKAGVEMHTAFDELVARTGLTEIRGLVNMLSHASKIGGSLSQTLR 260

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               + R +R  E E+ AA +  K+  P+++F  P   +V IGPA+LS+ D +
Sbjct: 261 DYTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIWPCFFIVAIGPALLSLSDAL 313


>gi|116623251|ref|YP_825407.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226413|gb|ABJ85122.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 304

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 89/164 (54%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+ AP  ++   V +R+ +I+R  P+ LDL+++CVESG+ IDQ   +VA+++      + 
Sbjct: 131 GYLAPMQYVQFCVGRRRKAIERGLPNTLDLMVVCVESGLGIDQTTLQVAKELHWAHPEIC 190

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E  +   EL     R  A  N   RT +D V+     L+Q+DR+GTSI  SLR      
Sbjct: 191 AEFTVMNLELRAGIRRAEALHNLAERTGVDDVKKLVAVLVQTDRFGTSIAQSLRGHAEYL 250

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           R+     AE++A+ L  KL  P+    LP L +V IGP I  ++
Sbjct: 251 RTMARQRAEERASKLAVKLVFPIFFCVLPSLFVVTIGPVITRLV 294


>gi|269836553|ref|YP_003318781.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785816|gb|ACZ37959.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 307

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 95/169 (56%), Gaps = 3/169 (1%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G +G+  P VW+ N +++R+S+I RA PDA+DLL I VE+G+  D AL+RV E    +  
Sbjct: 139 GGIGYLLPGVWLGNRIKRRKSAIIRALPDAIDLLTISVEAGLGFDPALQRVVEKWDNE-- 196

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            L+ E    ++E+    +R+ A  +   RT +D +     A++Q+D+ G SI   LRV  
Sbjct: 197 -LTREFARMLSEIRMGQSRREALRDLAERTNVDDLNVFVSAVVQADQLGVSITQVLRVQS 255

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            + R  R   AE++A     K+  PM+    P L +V++GPA+  + D 
Sbjct: 256 KQMRMRRRQRAEEQAHKAPVKMIFPMVFLIFPALYIVLLGPAVPIVWDA 304


>gi|219883050|ref|YP_002478214.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219862056|gb|ACL42397.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 293

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 141/276 (51%), Gaps = 19/276 (6%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENI--VNKLRA-AGFR 108
           RE++R+      ++ S       +DS + R +      +   +   I  +++L A AG  
Sbjct: 31  REVVRENLFRGFEESS-------KDSTAGRRWSLAATARRFTMPRAIARLDRLHALAGRP 83

Query: 109 SEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWI 168
           + + L  ++  + V+ ++  +LG++   G       P  L V AV +  Y     P + +
Sbjct: 84  AAWPLERVIAAKPVLAVVAFLLGLLLYTGRPG---APLMLLVIAVTVTAYF---VPDLLL 137

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE 228
            +  Q+RQ  I    PD LD ++I VE+G+  D A+ R  +   G   PL+ E++ T+ +
Sbjct: 138 QSRGQERQKLIGLELPDTLDQMMIAVEAGLGFDSAMARAGDKGKG---PLANELVRTLQD 194

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAE 288
           +    +R+ A+E    RT +  +    ++++Q+D YG SI   LR    E R +R   AE
Sbjct: 195 MQIGRSRREAYEALGERTSVPDLDAFIRSVVQADIYGISISKVLRTQAGEIRLKRRQRAE 254

Query: 289 KKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           +KA  +  K+ +P+++  LPVL + ++GPA+L++I+
Sbjct: 255 EKAMQIPVKVIIPLMLCILPVLFIALLGPAVLNVIN 290


>gi|262165914|ref|ZP_06033651.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
 gi|262025630|gb|EEY44298.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
          Length = 314

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 120/232 (51%), Gaps = 9/232 (3%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
           +I  +L  AGF +  +L++   ++      F ILG+    G   +      +  G ++++
Sbjct: 89  SIRTQLMHAGFHNRDALSLFYALK----TSFAILGVS---GAALVFFLLPDMDNGTLVML 141

Query: 157 GYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
             V  G   P++ + + V++RQ +I+   PDALDLL++C ESG+  + ALR+VA+++   
Sbjct: 142 VSVAGGLYLPNMGLHHFVKERQRTIRAGVPDALDLLVVCTESGLGFNAALRKVADELTIS 201

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
               ++E+    A++        AF+    RT +  +R     L  + + G S+  +LR 
Sbjct: 202 HPEFADELDTVCAKIKAGVEMHTAFDELVARTGLTEIRGLVNMLSHASKIGGSLSQTLRD 261

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              + R +R  E E+ AA +  K+  P+++F  P   +V IGPA+LS+ D +
Sbjct: 262 YTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIWPCFFIVAIGPALLSLSDAL 313


>gi|260771470|ref|ZP_05880395.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
 gi|260613596|gb|EEX38790.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
          Length = 318

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 134/273 (49%), Gaps = 5/273 (1%)

Query: 50  VEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRS 109
           ++R++   ++  +++     ++ R +   +L +    ++ K I   E++ ++L  AG+  
Sbjct: 45  IQRQLEEIRKEGTVKTPGNLAKKRDKIHNTLESIAPIMSPKNIKERESVRHQLMHAGYHD 104

Query: 110 EYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
             +LN    ++++  +  + +  +  F Y  +           V+    +G   P+  + 
Sbjct: 105 ASALNTFYALKVLSTLAGVSISALMYFLYPDMKNLKL-----IVVFSVAMGLFLPNFLLD 159

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
            +V+KR+S IK   PDALDLL++C ESG+  + ALRRVA+++      L++E+    A++
Sbjct: 160 RMVKKRKSRIKGGIPDALDLLVVCTESGLGFNAALRRVADELMISHPDLADELDTVCAKI 219

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
                   A      RT +  +      L  + R G SI  +LR    + R +R  E E+
Sbjct: 220 KAGVEMSEAMAQLVERTGLTEISGLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEIEE 279

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            AA +  K+  P+++F  P   +V +GP++LS+
Sbjct: 280 IAAKIPTKMIFPLLLFIWPCFFIVAVGPSMLSL 312


>gi|28899184|ref|NP_798789.1| putative tight adherence TadC-like transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836802|ref|ZP_01989469.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|260361577|ref|ZP_05774604.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|260876734|ref|ZP_05889089.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|260898188|ref|ZP_05906684.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|260900405|ref|ZP_05908800.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|28807408|dbj|BAC60673.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749948|gb|EDM60693.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|308089100|gb|EFO38795.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|308091488|gb|EFO41183.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|308109137|gb|EFO46677.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|308113997|gb|EFO51537.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|328474278|gb|EGF45083.1| putative tight adherence TadC-like transmembrane protein [Vibrio
           parahaemolyticus 10329]
          Length = 313

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 115/229 (50%), Gaps = 5/229 (2%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           NKL  AGF    SL++   ++ +  I+ +++ ++    Y  + E  +     A  L  ++
Sbjct: 90  NKLMHAGFHQSNSLSMFYAIKSITTILGIMIAVLV---YLTVPESKYLYTYMA--LSAFI 144

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P   +  +V KRQ +I+   PD LDLL++C ESG+  + ALRRVA++I      L+
Sbjct: 145 GLLIPDFMLRRMVNKRQQAIRAGVPDMLDLLVVCTESGLGFNAALRRVADEIVISHPELA 204

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+     ++        +      RT ++ +      L  + R G S+ +SLR    + 
Sbjct: 205 DEVDTVCNKIQAGKPMPESLRELVVRTGLEELMGLVSMLSHASRIGGSLVNSLREYTEDY 264

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           R +R   AE+ AA +  K+  PM+IF  P   +V IGPA++S+ +   +
Sbjct: 265 RDKRQQAAEEIAAKIPVKMMFPMVIFIWPCFFIVAIGPALISLAEAFSN 313


>gi|23009311|ref|ZP_00050407.1| COG2064: Flp pilus assembly protein TadC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 195

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 101/179 (56%), Gaps = 4/179 (2%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+ T ++  + ++ ++ P + + +L KRMK V+ ERE +R+++   L        LRT  
Sbjct: 17  AVLTGIAAAATVFTLIQPLIETDQLGKRMKLVSDEREQIRQRERERLNNRVT---LRTEP 73

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
              ++  V++ NL   L  +    KL  AG+R   +    L  RLVVPI+  +  + ++F
Sbjct: 74  KAYMKRVVERFNLSRWLGTDTAKIKLTMAGYRGAGAETAFLFFRLVVPIVLTVGALFYLF 133

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
             + +L+ P  +R G  +  G++G   P V++SN + KRQ+ I+RA PDAL+L LICVE
Sbjct: 134 VLE-VLDQPPLIRFGLSLFAGFIGLKLPEVYLSNRISKRQAEIRRAGPDALELWLICVE 191


>gi|320161469|ref|YP_004174693.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995322|dbj|BAJ64093.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 319

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 118/231 (51%), Gaps = 7/231 (3%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF-LILGIIWIFGYDKLLEYPFQLRVGAVI 154
           ++I  KL  AG   +    + L ++ +    F  +L +   FG      +PF  +   V+
Sbjct: 88  QDINRKLELAGNPGKLDATVFLALQFIAGGFFGAVLFLAMYFGQSN---WPFGQKFLVVL 144

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
               +GF  P +W+++ + +RQ  I+++ PDALDLL ICVE+G+  D A+ +VAE    +
Sbjct: 145 GGTLLGFFFPQIWLTSKISRRQKEIRKSMPDALDLLTICVEAGLGFDAAMAKVAEKWESE 204

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              LS      I E+     R+ A  +   R  +  + +   A+IQS++ G S+   LR+
Sbjct: 205 ---LSLAFARVIQEIQLGKTRRDALRDMAERIGIPEMTSFVAAVIQSEQLGVSMAKVLRI 261

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
              + R  R   AE++A     K+ +PM +   P L++V++ PA L ++++
Sbjct: 262 QSDQMRVRRRQAAEEEAHKAPVKMLIPMALLIFPSLMIVLMTPAALRLMNS 312


>gi|172065281|ref|YP_001815993.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171997523|gb|ACB68440.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 324

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 105/170 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++ +  +G+  P+V +S  +  RQ  I   +PDALDLL +CVE+G+ +D AL RV+E++ 
Sbjct: 142 LVALAGIGYYVPNVILSRRIATRQRVIFEDFPDALDLLTVCVEAGLGLDAALMRVSEELR 201

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +S E+ L + E+     ++ A  NF  RT  + + +    LIQ+DR+GTSI +SL
Sbjct: 202 FRSEVVSGELDLLLLEMRSGFTKETALRNFALRTGTEDIESFCAMLIQADRFGTSIAESL 261

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           RVL    R+ R M AE++AA +  KL  P+I    P L+ V++GPA++ +
Sbjct: 262 RVLSDMLRTRRRMRAEERAAKIALKLLFPLIFNIFPALMCVLLGPAMIHV 311


>gi|260776710|ref|ZP_05885605.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607933|gb|EEX34198.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 314

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 134/277 (48%), Gaps = 13/277 (4%)

Query: 57  KQQITSLQKDSASSRLRT-----RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEY 111
           K ++  L++ + S +L+         +SL   +K  N K     E+I  KL  AG+    
Sbjct: 46  KLKLEQLRQSTRSDKLKKSRRLDHTLESLAPVMKPSNSKE---SESIRQKLMHAGYHDAN 102

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           +L +    + +     + +G+    G+  L      L +  V  +G  G   P++ + +L
Sbjct: 103 ALTVFYAFKGMT----VAVGLGLAAGFYFLTPDMAMLNLVMVASVGG-GLYVPNILLGHL 157

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           V+KRQS I+   PDALDL+++C ESG+  + ALRRVA+++       ++E+     +++ 
Sbjct: 158 VKKRQSRIRGGIPDALDLMVVCTESGLGFNSALRRVADEVAISHPDFADELDTVCVKINA 217

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                 AF +   RT +  +      L  + R G S+  +LR    + R +R  E E+ A
Sbjct: 218 GVEMSDAFNDLIERTGLIEIAGLVTMLAHASRIGGSLAQTLREYTDDYRDKRNQEVEEIA 277

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           A +  K+  P+++F  P   +V IGP++L    T+ +
Sbjct: 278 AKIPTKMIFPLLLFIWPCFFIVAIGPSMLLFTSTLGN 314


>gi|297618076|ref|YP_003703235.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145913|gb|ADI02670.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 295

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 95/175 (54%), Gaps = 3/175 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++L+G  G   P ++++   ++R   I ++ PD LDLL + VE+G+  D AL++V E   
Sbjct: 124 LVLLGMAGLLLPDMYLNLCRRQRSEGILKSLPDVLDLLSVSVEAGLGFDAALQKVVEKSQ 183

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G   PL++E    + E+     R+ A  +   R ++D V     A++Q+D  G SI + L
Sbjct: 184 G---PLADEFDTALNEIRMGKPRREALRDMARRVEVDDVSTFVGAVVQADTLGVSISNVL 240

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            V   + R +R   AE+KA     K+ +PM+ F  P + +V++GPA+L I    K
Sbjct: 241 TVQAEQVRQKRRQRAEEKAQKAPVKILIPMLFFIFPTIFIVLLGPALLQIGKVFK 295


>gi|115361041|ref|YP_778178.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115286369|gb|ABI91844.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 323

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 103/164 (62%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P+V +S  +  RQ  I   +PDALDLL +CVE+G+ +D AL RV+E++  +S  +
Sbjct: 147 IGYYVPNVILSRRIATRQRVIFEDFPDALDLLTVCVEAGLGLDAALMRVSEELRFRSEVV 206

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L + E+     ++ A  NF  RT ++ + +    LIQ+DR+GTSI +SLRVL   
Sbjct: 207 AGELDLLLLEMRSGFTKETALRNFALRTGVEDIESFCAMLIQADRFGTSIAESLRVLSDM 266

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R+ R M AE++AA +  KL  P+I    P L+ V++GPA++ +
Sbjct: 267 LRTRRRMRAEERAAKIALKLLFPLIFNIFPALMCVLLGPAMIHV 310


>gi|153834029|ref|ZP_01986696.1| Flp pilus assembly protein TadC [Vibrio harveyi HY01]
 gi|148869584|gb|EDL68574.1| Flp pilus assembly protein TadC [Vibrio harveyi HY01]
          Length = 315

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 115/226 (50%), Gaps = 7/226 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILG-IIWIFGYDKLLEYPFQLRVGAVILIGY 158
           NKL  AGF    SL++   ++ +  II +++  +I++   +    Y +      + L   
Sbjct: 92  NKLMHAGFHQSNSLSMFYAIKSITTIIGVMMATLIYLTIPESKYLYTY------MALAAL 145

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G   P + +  +V KRQ +I+   PD LDLL++C ESG+  + ALRRVA+++      L
Sbjct: 146 IGLITPDMILRRMVNKRQKAIRAGIPDMLDLLVVCTESGLGFNAALRRVADELVISHPEL 205

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E+     ++        A      RT ++ +      L  + R G S+ +SLR    +
Sbjct: 206 ADEIDTVCNKIQAGKPMPEALRELVVRTGLEEIMGLVSMLSHASRIGGSLVNSLREYTED 265

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            R +R   AE+ AA +  K+  PM++F  P   +V +GPA++++ +
Sbjct: 266 YRDKRQQAAEEVAAKIPVKMMFPMVLFIWPCFFIVAVGPALITLAE 311


>gi|296134293|ref|YP_003641540.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032871|gb|ADG83639.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 304

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 123/228 (53%), Gaps = 11/228 (4%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF--GYDKLLEYPFQLRVGAVILIG 157
            KL AAG   + S N  +V++  + ++  ++GI+ +   G+      P  + V  V L G
Sbjct: 85  RKLLAAGNPLDLSPNEFMVIQYALTLLLPVIGIVVVLPLGWS-----PVGM-VAVVALGG 138

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            +GF  P  ++      RQ  I+   PD LDLL + VE+G+  D A+ +V E I G    
Sbjct: 139 TIGFLLPEYYLKAKSAARQEEIQDTLPDVLDLLTVSVEAGLGFDAAMVKVVEKIKGV--- 195

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           LS+E    + E+     R+ A ++   RT ++ V++   A+IQ+D+ G SIG+ LRV   
Sbjct: 196 LSQECARMLQEVKMGKPRRDALKDLGVRTGVEDVQSFVGAVIQADQLGVSIGNVLRVQSE 255

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           + R +R   AE+KA     K+ +P+IIF  P + +V++GPA + ++ T
Sbjct: 256 QMRQKRRQRAEQKAMKAPVKMLIPLIIFIFPTIFIVVLGPAAIQVLKT 303


>gi|148976302|ref|ZP_01813026.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
 gi|145964396|gb|EDK29651.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
          Length = 283

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 95/160 (59%), Gaps = 4/160 (2%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++ ++ +    I R  PDA+DL++ICV SG++++   R V E++   S  LS E LLT 
Sbjct: 125 WVNQVLMQ----ISRVVPDAIDLMVICVASGLTLESVFRCVGEEMRSISPALSREWLLTA 180

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            E+S L + Q A  N   R Q+  + N    + Q+ +YGT + D+L+++ S++R    +E
Sbjct: 181 TEISVLDSPQTALNNLDKRVQLPDINNVVTTMNQALQYGTPLADALKLIASDSRQYYFLE 240

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            E+    +  K++ P+++F +  ++ +II P +L+++ T+
Sbjct: 241 LEEWVGKIPAKMSFPLVVFIMLPVVAIIIAPIMLNLMQTL 280


>gi|254506677|ref|ZP_05118817.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
 gi|219550258|gb|EED27243.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
          Length = 314

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 134/275 (48%), Gaps = 9/275 (3%)

Query: 57  KQQITSLQKDSASSRLRT--RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           K ++  L+K +   +L+   R   +L +    L        +++  +L  AG+    +L 
Sbjct: 46  KVRLEELKKTAPGEKLKKGRRLGNTLDSIAPTLTPSNSKESQSLRQQLMHAGYHDANALT 105

Query: 115 ILLVVRLVVPIIFL-ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
           +   ++ +  ++ + I  +++ F  D        L++  V  +  VG   P++ ++  V 
Sbjct: 106 VFYAIKGMAILVGVGIAAMLYFFVPDM-----SNLKLAMVASVA-VGLYTPNIGLNYFVN 159

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           KRQS I+   PDALDLL++C ESG+    ALRRVA+++       ++E+     ++    
Sbjct: 160 KRQSRIRGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFADELDTVCVKIKAGV 219

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
               AF++   RT +  +      L  + R G S+  +LR    + R +R  E E+ AA 
Sbjct: 220 EMSDAFDDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDFRDKRNQEIEEIAAK 279

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           +  K+  P+++F  P   +V IGP++LSI  T+ +
Sbjct: 280 IPTKMIFPLLLFIWPCFFIVAIGPSMLSITSTLGN 314


>gi|295700365|ref|YP_003608258.1| type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
 gi|295439578|gb|ADG18747.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
          Length = 322

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 133/225 (59%), Gaps = 8/225 (3%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG---YDKLLEYPFQLRVGAVILIG 157
           +L  AG+RS  ++ + L  +  + +   +L ++ ++G      LLE     R   ++++ 
Sbjct: 91  QLMNAGWRSANAVPVYLAAKTALALTLPLLAMLALYGSSFASSLLE-----RAIVLVVLA 145

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
             G+  P+V +S     RQ S+   +PDALDLL +CVE+G+ +D +L +V E+I  +S  
Sbjct: 146 AFGYYLPNVVLSRRTAARQRSLVEDFPDALDLLTVCVEAGLGLDASLMKVGEEIRLRSAV 205

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           ++ E+ L + E+    +++ A  NF  RT ++ + + +  LIQ++R+GTSIG SLRVL  
Sbjct: 206 VASELELMLLEMRSGFSKEKALRNFSLRTGVEDIDSFSAMLIQAERFGTSIGASLRVLSD 265

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             R+ R M AE++AA +  KL  P++    P L++V++GPA++ I
Sbjct: 266 TLRTRRRMRAEERAAKIALKLLFPLMFCIFPALLVVLMGPAMIHI 310


>gi|311743553|ref|ZP_07717359.1| type II secretion system protein F protein [Aeromicrobium marinum
           DSM 15272]
 gi|311312683|gb|EFQ82594.1| type II secretion system protein F protein [Aeromicrobium marinum
           DSM 15272]
          Length = 298

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 123/223 (55%), Gaps = 9/223 (4%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+ + ++   +L++++  P+I  +   +  F + +       + VG+VI    V +  P
Sbjct: 83  AGYPAGWTWQKILILKIAAPLILAV--AMREFAFSEFSMVNTTVGVGSVI----VAYLLP 136

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            + +S+  ++RQ++++   PDALD ++I +ESG+  + AL   AE   G     ++E++ 
Sbjct: 137 DLLLSSRARERQAAMELELPDALDKIVISLESGLGFESALMNAAETGKGD---FADELVR 193

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++     R+ A+E   NRT+ + +R   ++LIQ++  G S+   +R   ++ R +R 
Sbjct: 194 TLQDIQVGMPRRAAYEALVNRTESEDIRRFVRSLIQAEETGVSVSTVVRNQSADMRMKRK 253

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + AE KA  +  KL  P+I    PVL ++++ P +++ I+  K
Sbjct: 254 LRAEGKAQQVSVKLLFPLIFCLFPVLFVIVLAPGVMTAIEGFK 296


>gi|84498181|ref|ZP_00996978.1| probable secretion system protein TadC [Janibacter sp. HTCC2649]
 gi|84381681|gb|EAP97564.1| probable secretion system protein TadC [Janibacter sp. HTCC2649]
          Length = 301

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 3/164 (1%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           F  P + + N   +RQ  +++ + DALD+L +CVESG   D AL +VA ++ G   P++ 
Sbjct: 136 FFLPDLLVYNAGIRRQEQLRKGFADALDMLTVCVESGQGFDAALGQVARNVTG---PIAG 192

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E    ++E      R  AF+    R     V+N   AL+Q+DR G  I   LR    E R
Sbjct: 193 EFARVLSEFQIGMTRGQAFQGMAERNTSPEVKNFVSALVQADRLGVPIAGVLREQTKEMR 252

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
             R   AE+KA  +  K+  P+++   PV+ +VI+GPA ++I D
Sbjct: 253 VVRRQLAEEKAQKVTVKVVFPVLLCIFPVIFVVILGPAAINIYD 296


>gi|78060306|ref|YP_366881.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
 gi|77964856|gb|ABB06237.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
          Length = 324

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 108/173 (62%), Gaps = 2/173 (1%)

Query: 152 AVILIGY--VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           + IL+ +  +G+  P++ +S  V+ RQ  I   +PDALDLL +CVE+G+ +D AL +V+E
Sbjct: 139 SAILVAFAGIGYYIPNIVLSQRVKVRQQKIFEDFPDALDLLTVCVEAGLGLDAALMKVSE 198

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++   S  ++ E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSI 
Sbjct: 199 ELRFSSEVVASELDLLLLEMRSGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSIS 258

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +SLRVL    R+ R M AE++AA +  KL  P+I    P L+LV++GPA++ +
Sbjct: 259 ESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMLVLLGPAMIHV 311


>gi|197295161|ref|YP_002153702.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944640|emb|CAR57244.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 324

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 109/173 (63%), Gaps = 2/173 (1%)

Query: 152 AVILIGY--VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +VIL+    +G+  P+V +S  V+ RQ  I   +PDALDLL +CVE+G+ +D AL +V+E
Sbjct: 139 SVILVALAGIGYYIPNVVLSQRVKVRQQKIFEDFPDALDLLTVCVEAGLGLDAALMKVSE 198

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++  +S  ++ E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSI 
Sbjct: 199 ELRFRSEVVASELDLLLLEMRSGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSIS 258

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +SLRVL    R+ R M AE++AA +  KL  P+I    P L++V++GPA++ +
Sbjct: 259 ESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMVVLLGPAMIHV 311


>gi|170700844|ref|ZP_02891833.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170134252|gb|EDT02591.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 324

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 102/164 (62%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P++ ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL RV+E++  +S  +
Sbjct: 148 IGYYVPNMILTRRIATRQRVIFEDFPDALDLLTVCVEAGLGLDAALMRVSEELRFRSEVV 207

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S E+ L + E+     ++ A  NF  RT  + + +    LIQ+DR+GTSI +SLRVL   
Sbjct: 208 SGELDLLLLEMRSGFTKETALRNFALRTGTEDIESFCAMLIQADRFGTSIAESLRVLSDM 267

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R+ R M AE++AA +  KL  P+I    P L+ V++GPA++ +
Sbjct: 268 LRTRRRMRAEERAAKIALKLLFPLIFCIFPALMCVLLGPAMIHV 311


>gi|269966900|ref|ZP_06180973.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           alginolyticus 40B]
 gi|269828567|gb|EEZ82828.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           alginolyticus 40B]
          Length = 313

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 113/231 (48%), Gaps = 9/231 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY--DKLLEYPFQLRVGAVILIG 157
           NKL  AGF    +L++   ++ V  I+ +++  +  F     K L     L V       
Sbjct: 90  NKLMHAGFHESNALSMFYAIKSVTTILGVMVAALVYFSVPESKYLYTYMALSV------- 142

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           ++G   P   +  +V KRQ +I+   PD LDLL++C ESG+  + ALRRVA+++      
Sbjct: 143 FIGLLFPDFILRRMVNKRQQAIRAGVPDMLDLLVVCTESGLGFNAALRRVADELVISHPE 202

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L++E+     ++        A      RT ++ +      L  + R G S+ +SLR    
Sbjct: 203 LADEIDTVCNKIKAGKPMPEALRELVLRTGLEELMGLVSMLSHASRIGGSLVNSLREYTE 262

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           + R +R   AE+ AA +  K+  PM++F  P   +V IGPA++S+ +   +
Sbjct: 263 DYRDKRQQAAEEIAAKIPVKMMFPMVLFIWPCFFIVAIGPALISLAEAFSN 313


>gi|254229337|ref|ZP_04922754.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262393424|ref|YP_003285278.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio sp. Ex25]
 gi|151938145|gb|EDN56986.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262337018|gb|ACY50813.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio sp. Ex25]
          Length = 313

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 113/231 (48%), Gaps = 9/231 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY--DKLLEYPFQLRVGAVILIG 157
           NKL  AGF    +L++   ++ V  I+ +++  +  F     K L     L V       
Sbjct: 90  NKLMHAGFHESNALSMFYAIKSVTTILGVMVAALVYFSIPESKYLYTYMALSV------- 142

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           ++G   P   +  +V KRQ +I+   PD LDLL++C ESG+  + ALRRVA+++      
Sbjct: 143 FIGLLIPDFILRRMVNKRQQAIRAGVPDMLDLLVVCTESGLGFNAALRRVADELVISHPE 202

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L++E+     ++        A      RT ++ +      L  + R G S+ +SLR    
Sbjct: 203 LADEIDTVCNKIKAGKPMPEALRELVLRTGLEELMGLVSMLSHASRIGGSLVNSLREYTE 262

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           + R +R   AE+ AA +  K+  PM++F  P   +V IGPA++S+ +   +
Sbjct: 263 DYRDKRQQAAEEIAAKIPVKMMFPMVLFIWPCFFIVAIGPALISLAEAFSN 313


>gi|156741661|ref|YP_001431790.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232989|gb|ABU57772.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 311

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 100/170 (58%), Gaps = 3/170 (1%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G +G+  P +W+   ++KR+ +I +A PDALDLL ICVE+G+S DQA++R+ E       
Sbjct: 140 GVMGYLLPGIWLGQQIKKRKKAIIKALPDALDLLCICVEAGLSFDQAMQRLTEK---WED 196

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PLS+E    +++      R+ A ++  +R  +D V+    A+IQ+++ G SIG  LR+  
Sbjct: 197 PLSKEFKRVLSDTRLGRPRRDAMKDMIDRCGVDDVQTFIGAVIQAEQLGVSIGRILRIQS 256

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            + R  R   AE++A     K+  PM+    P L +VI+GPA+  I+ ++
Sbjct: 257 DQMRIRRRQRAEEEAHKAPIKMLFPMVFLIFPALFIVILGPAVPRIMKSL 306


>gi|312139259|ref|YP_004006595.1| type ii secretion system integral membrane subunit [Rhodococcus
           equi 103S]
 gi|311888598|emb|CBH47910.1| putative type II secretion system integral membrane subunit
           [Rhodococcus equi 103S]
          Length = 296

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 101/163 (61%), Gaps = 3/163 (1%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + + +  Q+RQ++I+ A  D LD + I VE+G+  + A++R A++  G   PL+EE +
Sbjct: 134 PELLLQSRGQERQAAIELALADTLDQMTIAVEAGLGFEAAMQRAAKNGKG---PLAEEFI 190

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ ++    +R++A+ +   RT+   +R   +A+IQ+D YG +I + LR   SE R +R
Sbjct: 191 RTLQDIQMGQSRRIAYLDLAARTKAPNLRRFLRAVIQADEYGVAIAEVLRTQASEMRLKR 250

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              AE+KA  +  K+  P++   LP + +VI+GPA++++++ +
Sbjct: 251 RQSAEEKAMKVPVKVLFPLMTCILPTIFIVILGPAVINMMEVL 293


>gi|325673436|ref|ZP_08153127.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
 gi|325555457|gb|EGD25128.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
          Length = 296

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 101/163 (61%), Gaps = 3/163 (1%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + + +  Q+RQ++I+ A  D LD + I VE+G+  + A++R A++  G   PL+EE +
Sbjct: 134 PELLLQSRGQERQAAIELALADTLDQMTIAVEAGLGFEAAMQRAAKNGKG---PLAEEFI 190

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ ++    +R++A+ +   RT+   +R   +A+IQ+D YG +I + LR   SE R +R
Sbjct: 191 RTLQDIQMGQSRRIAYLDLAARTKAPNLRRFLRAVIQADEYGVAIAEVLRTQASEMRLKR 250

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              AE+KA  +  K+  P++   LP + +VI+GPA++++++ +
Sbjct: 251 RQSAEEKAMKVPVKVLFPLMTCILPTIFIVILGPAVINMMEVL 293


>gi|170734860|ref|YP_001773974.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169820898|gb|ACA95479.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 324

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 104/164 (63%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P++ +S  V+ RQ  I   +PDALDLL +CVE+G+ +D AL +V+E++  +S  +
Sbjct: 148 IGYYIPNIVLSQRVKVRQRKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFRSEVV 207

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSI +SLRVL   
Sbjct: 208 ASELDLLLLEMRSGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESLRVLSDM 267

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R+ R M AE++AA +  KL  P+I    P L++V++GPA++ +
Sbjct: 268 LRTRRRMRAEERAAKIALKLLFPLIFCIFPALMMVLLGPAMIHV 311


>gi|86147459|ref|ZP_01065771.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
 gi|85834752|gb|EAQ52898.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
          Length = 323

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 129/275 (46%), Gaps = 19/275 (6%)

Query: 58  QQITSLQKDSASSRLR-TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNIL 116
           +QI+S +  S+      T   +SL  F+ + N K    +E    KL  AG+  + +L++ 
Sbjct: 55  KQISSGRHTSSRKPYDFTNTLESLTPFIGRGNKKD---NETYSEKLMHAGYHEKSALSVF 111

Query: 117 LVVRLVVPIIFLILGIIWIF-----GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
              +++  ++  +   +  +      Y+ LL          ++   +VG   P+  +S +
Sbjct: 112 YAFKVLSALVGFVCAFMVFYLAIGGSYNNLL----------IVTCIFVGTFLPNFILSKM 161

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            + RQ  IK   PDALDLL++C ESG+  + AL RVA ++      L++E+    A++  
Sbjct: 162 QKDRQRKIKNGVPDALDLLVVCTESGLGFNAALGRVANELYISQPELADELDTVFAKIQA 221

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                 A      RT +  +      L  + R G S+  +LR    + R +R   AE+ A
Sbjct: 222 GVTMPDALSQLVERTGLHELDGLVSLLSHASRMGGSLAQTLRDYTEDFRDKRQQAAEEIA 281

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           A +  K+  PM++F  P   +V +GP ++ ++D +
Sbjct: 282 AKIPTKMLFPMLLFIWPCFFIVALGPGMMIVMDAL 316


>gi|107028240|ref|YP_625335.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116687151|ref|YP_840398.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|105897404|gb|ABF80362.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116652866|gb|ABK13505.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 324

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 104/164 (63%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P++ +S  V+ RQ  I   +PDALDLL +CVE+G+ +D AL +V+E++  +S  +
Sbjct: 148 IGYYIPNIVLSQRVKVRQRKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFRSEVV 207

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSI +SLRVL   
Sbjct: 208 ASELDLLLLEMRSGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESLRVLSDM 267

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R+ R M AE++AA +  KL  P+I    P L++V++GPA++ +
Sbjct: 268 LRTRRRMRAEERAAKIALKLLFPLIFCIFPALMMVLLGPAMIHV 311


>gi|13471027|ref|NP_102596.1| integral membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021771|dbj|BAB48382.1| probable integral membrane protein [Mesorhizobium loti MAFF303099]
          Length = 305

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 135/268 (50%), Gaps = 17/268 (6%)

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN---KLRAAGFRSEYSLNILLVVR 120
           QK +A+  +R R  K  + F  K +       EN+     KL  AG+    ++    ++R
Sbjct: 48  QKKNANV-VRERAVKRAQEFYAKSD------PENVARLRMKLIQAGYMEPRAVGTFFIIR 100

Query: 121 LVVPIIFLILGIIWIFGYDKLL---EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
                  L+ G I  F  ++ L   E     R   VIL G  G+  P + ++  V+++  
Sbjct: 101 FSA----LVGGAIGAFVLNQWLASAEATMTSRWAFVILSGVAGYFLPGLVLTQQVREKMR 156

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
             +  +PD +DL+++C ++G+S++  + RV++++      LS+ + L   EL    +   
Sbjct: 157 EYRNGFPDFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRAGRSLDD 216

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           A +   +R  +D VR+    L QS   GTS+  +LRV   E R +R+  AE+KA +L  K
Sbjct: 217 ALKALADRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAK 276

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDT 325
           +++P+ +  LPV++++ I P I+ +  +
Sbjct: 277 MSIPVTVCILPVVLMIAIIPIIVKMTGS 304


>gi|134291849|ref|YP_001115618.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135038|gb|ABO59363.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 327

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 105/170 (61%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++ +  +G+  P+  +S  + KRQ +I   +PDALDLL +CVE+G+ +D AL RV+E++ 
Sbjct: 145 LVALAGIGYYLPNFVLSRRITKRQRTIFEDFPDALDLLTVCVEAGLGLDAALMRVSEELR 204

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  +S E+ L + E+     +  A  N   RT ++ + +    LIQ+DR+GTS+ +SL
Sbjct: 205 FRSEVVSGELDLLLLEMRSGFTKDTALRNLALRTGVEDIESFCAMLIQADRFGTSVAESL 264

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           RVL    R+ R M AE++AA +  KL  P+I    P L+ V++GPA++ +
Sbjct: 265 RVLSDMLRTRRRMRAEERAARIALKLLFPLIFCIFPALMGVLLGPAMIHV 314


>gi|148976656|ref|ZP_01813343.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
 gi|145964007|gb|EDK29265.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
          Length = 323

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 122/254 (48%), Gaps = 18/254 (7%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF- 136
           +SL  F+ + N K    +E    KL  AG+  + +L++   ++++  +I  +   +  + 
Sbjct: 76  ESLTPFIGRGNQKD---NETYSEKLMHAGYHEKSALSVFYALKILSMLIGFVCAFVVFYL 132

Query: 137 ----GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
                Y+ LL          +I   +VG   P+  ++ + ++RQ  I+   PDALDLL++
Sbjct: 133 SIGGSYNNLL----------IITCIFVGTFLPNFLLNKMQKERQRKIRNGVPDALDLLVV 182

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + AL RVA ++      L++E+    A++        A      RT +  + 
Sbjct: 183 CTESGLGFNAALGRVANELYISQPELADELDTVCAKIQAGVTMPDALTQLVERTGLHELE 242

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+  +LR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 243 GLVSLLSHASRMGGSLAQTLRDYTDDFRDKRQQAAEEIAAKIPTKMLFPMLLFIWPCFFI 302

Query: 313 VIIGPAILSIIDTM 326
           V +GP ++ ++D +
Sbjct: 303 VALGPGMMIVMDAL 316


>gi|296131925|ref|YP_003639172.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296030503|gb|ADG81271.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 319

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 117/228 (51%), Gaps = 10/228 (4%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E +  +L  AG  S+ ++   L +R V+ +  L++  +W++       +   L +  +I+
Sbjct: 91  EKLERQLALAGNPSDLNVGGFLGLRFVLFVAGLLIADVWLY-------FGMPLALFVLIV 143

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
           +   GF  PS+WI+ L + RQ  I    PD LD + + +++G+ +D A+ +V   + G  
Sbjct: 144 LPMCGFVLPSIWINMLAKSRQEQIALGLPDFLDGMSVTLQAGVPLDAAMNQVVNHMEG-- 201

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            PL+EE+     EL     R+ A+    NR + + +    Q+LIQ  + G  I  + +V+
Sbjct: 202 -PLAEELQRFNRELELGVPREEAYHRLVNRNECEELETLVQSLIQGSKLGVPIARTFKVM 260

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             + R  R  + ++KAA   PK+T+       P ++L I+G  +L+II
Sbjct: 261 ADDMRITRFNKVKEKAAKASPKVTLVTSFIITPGVMLAILGLIVLNII 308


>gi|108756874|ref|YP_632816.1| type II secretion system protein F domain [Myxococcus xanthus DK
           1622]
 gi|108460754|gb|ABF85939.1| type II secretion system protein F domain protein [Myxococcus
           xanthus DK 1622]
          Length = 296

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 12/220 (5%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD-KLLEYPFQLRVGAVILIGYVGFCA 163
           AG    Y    ++ ++ V  ++ LI+G+I + G+   L+  P  L           G   
Sbjct: 82  AGEPQAYKPEDIMALQEVSAVVGLIMGLILLNGFGVSLVWAPLFL---------LFGMYY 132

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P +W+++ V+KR   I RA P +LDLL + VE+G+    AL +V E   G+  PL EE+ 
Sbjct: 133 PLMWLNDQVKKRHLLISRALPYSLDLLTLSVEAGLDFTAALAKVVEK--GKPGPLREELQ 190

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L + +L     R+   ++   R  +  +     ALIQ+D+ GTS+G  LR+  ++ R +R
Sbjct: 191 LVLKQLKMGKTREEGLKSMIVRVDLPPLTTFVTALIQADKMGTSLGKVLRIQSTQMRIDR 250

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              AEK A     K+  P+I    P + +V+ GP +   +
Sbjct: 251 TQRAEKLAGEAPVKMLFPLIACIFPTVFMVLFGPIVFQFM 290


>gi|260463899|ref|ZP_05812095.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030274|gb|EEW31554.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 122/236 (51%), Gaps = 10/236 (4%)

Query: 96  ENIVN---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLL---EYPFQLR 149
           EN+     KL  AG+    ++ +  ++R       LI G I  F  ++ L   +     R
Sbjct: 89  ENVARLRMKLIQAGYMEPRAVGMFFIIRFSA----LIGGAIGAFVLNRWLASADATMTSR 144

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
              +IL G  G+  P + +S   +++    +  +PD +DL+++C ++G+S++  + RV++
Sbjct: 145 WAFIILSGVAGYFLPGLVLSQKTREKMREYRNGFPDFMDLMIVCSDAGMSMEAGIERVSK 204

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++      LS+ + L   EL    +   A +   +R  +D VR+    L QS   GTS+ 
Sbjct: 205 ELARTYPALSQNLQLVSLELRAGRSLDDALKALADRLSLDEVRSFATLLQQSKELGTSLS 264

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            +LRV   E R +R+  AE+KA +L  K+++P+ +  LPV++++ I P I+ +  T
Sbjct: 265 GALRVFSDEMRHKRMSLAEEKAHALPAKMSIPVTVCILPVVLMIAIIPIIVKMTGT 320


>gi|319783869|ref|YP_004143345.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169757|gb|ADV13295.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 320

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 122/233 (52%), Gaps = 10/233 (4%)

Query: 96  ENIVN---KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP---FQLR 149
           EN+     KL  AG+    ++    ++R       +I   I +F  ++ +  P      R
Sbjct: 89  ENVARLRMKLIQAGYMEPRAVGTFFLIRFTA----MIGTAIGVFVLNRWMASPDATMASR 144

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
              VIL G  G+  P + +S  V++R+   +  +PD +DL+++C ++G+S++  + RV++
Sbjct: 145 WTFVILSGAAGYFLPGLVLSQKVRERRREYRNGFPDFMDLMIVCSDAGMSMEAGIERVSK 204

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++      LS+ + L   EL    +   A +   +R  +D VR+    L QS   GTS+ 
Sbjct: 205 ELAKTYPALSQNLQLVSLELRAGRSLDDALKALADRLSLDEVRSFATLLQQSKELGTSLS 264

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            +LRV   + R +R+  AE+KA +L  K++VP+++  LPV++++   P I+ +
Sbjct: 265 GALRVFSDDMRHKRMSLAEEKAHALPAKMSVPVVVCILPVVLMIAAIPVIVKM 317


>gi|225174956|ref|ZP_03728953.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169596|gb|EEG78393.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 306

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 125/238 (52%), Gaps = 7/238 (2%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           NL    + +N+   L  AG     ++N LL ++++  I   +LG+ ++       ++P  
Sbjct: 72  NLAPSEIRQNMEKNLIYAGHPWNLTVNTLLGLQVLFGIGLPVLGLFFLGIVAPEHQFPGL 131

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             +  ++L   +    P+  +     +RQ  I+R+ PD LDLLL+ V++G++ D AL++V
Sbjct: 132 FALLLLVLGFMM----PNTIVKRKATERQKEIQRSLPDMLDLLLVSVDAGLAFDMALKKV 187

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A+ + G+   LS E+   + E+     R  A  +  NRT +  +     A+IQ+++ G++
Sbjct: 188 ADKMPGE---LSREIGKALDEIRMGKTRIEALRSMANRTGVPDISTFISAVIQAEQLGSN 244

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           I  +L V  +  R  R M AE++A     K+  P++ F  P L +V++GPA + I+ T
Sbjct: 245 IAKTLDVQANTMRQRRRMRAEEEAMRAPIKMLFPLVFFIFPALFVVLLGPAGIRIVQT 302


>gi|296122064|ref|YP_003629842.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014404|gb|ADG67643.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 426

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 123/230 (53%), Gaps = 10/230 (4%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVR---LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           ++I + L AAG+ S  ++     VR   +++P++F   G++ +F   +       + +GA
Sbjct: 165 DSIRSDLYAAGYYSPRAVMNFSAVRYLAMILPMLFC--GVLLLFVPPRFEP----IVIGA 218

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++L+  VG+  P + + N  + R++ I++A PD LD+L +CV  G+++  +L R+  ++ 
Sbjct: 219 IVLMPIVGWSLPRLMVRNKARDRRNEIEKAMPDLLDMLNMCVSQGMTVPASLERIRVEMK 278

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G + P  E+ L  I E S + +  VA +NF  R  +  V + T  L+Q+ R GTS+  +L
Sbjct: 279 G-AYPALEQELKIINEQSRIGSMDVALKNFSQRVDVPEVHSFTSLLMQTSRMGTSVSGAL 337

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
                  R      AE+K      +L  P ++  +P + L ++GPAI+ +
Sbjct: 338 TEYAETMRESLKQRAEEKGNRATFRLLFPTVLCLMPAVYLFLMGPAIIEL 387


>gi|303241709|ref|ZP_07328206.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590710|gb|EFL60461.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 306

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 121/235 (51%), Gaps = 19/235 (8%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
           ++ +VN         +  +N+ +++ +++P  F+  G+ +  G D          V +++
Sbjct: 84  EKKVVNAGNPFNLSMKDWINMQVIIVVILP--FITSGVCYYLGLD----------VRSIV 131

Query: 155 LIGYVGFCA----PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
            +G +  C     P++ ++  + +RQ  I  + PD LDLL + VE+G+  D AL +V + 
Sbjct: 132 FVGIIEICFGLLFPNLVLNKQIAQRQKKILNSLPDVLDLLTVSVEAGLGFDGALAKVIDK 191

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           + G   P++ E    + E+     ++ A ++   R  +  +     ++IQ+D+ G SIG+
Sbjct: 192 MPG---PIAIEFENVLQEMKVGKQKRDALKDMAERVGLHDLTTFVGSIIQADQLGVSIGN 248

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            LR+   + R +R   A++KA     K+ +PM++F  P +  V+IGP I+ +I T
Sbjct: 249 VLRIQSEQMREKRRQRAKEKAMKAPVKMLIPMVLFIFPTIFSVLIGPVIIKVIYT 303


>gi|254255261|ref|ZP_04948577.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
 gi|124900998|gb|EAY71748.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
          Length = 324

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 103/164 (62%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P++ +S  V  RQ  I   +PDALDLL +CVE+G+ +D AL +V+E++  +S  +
Sbjct: 148 IGYYVPNLVLSQRVAARQQKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFRSDVV 207

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L + E+     ++ A  N   RT ++ + +    LIQ+DR+GTSI +SLRVL   
Sbjct: 208 AGELDLLLLEMRSGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESLRVLSDL 267

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            R+ R M AE++AA +  KL  P+I    P L++V++GPA++ +
Sbjct: 268 LRTRRRMRAEERAAKIALKLLFPLIFCIFPALMVVLLGPAMIHV 311


>gi|54302281|ref|YP_132274.1| tight adherence TadC-like transmembrane protein [Photobacterium
           profundum SS9]
 gi|46915703|emb|CAG22474.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum SS9]
          Length = 322

 Score = 99.0 bits (245), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 151/307 (49%), Gaps = 21/307 (6%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVA-VEREILRKQQITSLQKDSASSRLRTRDSKS 79
           +V  F+L  A++I +L    L+KR+ S++ + ++  +K   +S   ++  S  +     S
Sbjct: 29  SVVTFTLCLALLITNL-LNPLKKRLHSLSHISKDTTKKSAESSALDNTLESMDKYISPSS 87

Query: 80  L--RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           +  RN  K L              L  AG+  + +L     +++++ +IF   G++    
Sbjct: 88  MKERNQTKTL--------------LMHAGYEQKQALTNFYAIKIIL-VIFAFFGVLISSK 132

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
           +  L E   Q  +   +L   +    P+  +    +KR  ++  A+PDALDLL++  E+G
Sbjct: 133 F--LPELSTQKILFYTLLAMAIATFLPNFVLQKKAKKRIQTLSNAFPDALDLLVVTTEAG 190

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +    AL RVA +I   S  LS E+ +   ++       +A   F  RT +  ++     
Sbjct: 191 LGFLAALNRVANEIDALSPELSSELQIVCRKVRLGVPLPIALSQFIERTGLLELQGLVSI 250

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           + QS + G+S+GD+LR    E R  R+ +AE++AA +G K+  P++    P    V IGP
Sbjct: 251 ISQSVKLGSSMGDTLREYAIEFRDRRMQKAEEEAAKIGTKMIFPLVTCIWPGFFTVAIGP 310

Query: 318 AILSIID 324
           AI+++++
Sbjct: 311 AIIAVLE 317


>gi|168699471|ref|ZP_02731748.1| probable secretion system protein TadC [Gemmata obscuriglobus UQM
           2246]
          Length = 307

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 89/160 (55%)

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           APSV +   ++KRQ  I+ A PDALD++++ VE G S++ AL   A++I      L  E+
Sbjct: 142 APSVLLGARIEKRQRLIRNALPDALDIMVLSVEGGSSLNAALMWAADEIRDVHPVLGAEL 201

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
           L+   E+    +   AF+ F  R  +   R+   ALIQS++YG S+G +LR      R +
Sbjct: 202 LVVQREVQLGLSMGDAFQGFARRCGIPEGRDLAAALIQSEKYGASVGKALRTFADSARQD 261

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R   AE+ A     K+  PM++   P + +V++GPA + +
Sbjct: 262 RQAWAEEVAQKASVKVVFPMLLCIFPAIFIVLLGPAAVQM 301


>gi|332798625|ref|YP_004460124.1| Type II secretion system F domain-containing protein
           [Tepidanaerobacter sp. Re1]
 gi|332696360|gb|AEE90817.1| Type II secretion system F domain protein [Tepidanaerobacter sp.
           Re1]
          Length = 307

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 113/236 (47%), Gaps = 15/236 (6%)

Query: 95  DENIVNKLRAAGFR---SEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
           +E +  +L+ A  R    EY   +LL         F  + ++ +  Y  +L     LR+ 
Sbjct: 82  EERLNQQLKQAEIRMGAREYQAAVLL---------FTFVCVVGMVLYSTMLGLSVSLRIL 132

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
             +L  Y G       +   + KR+++I    PD LDLL + V +G+  DQAL  V E +
Sbjct: 133 FGMLGIYAGLVLSRFDLKRNIIKRKTAIYHQLPDTLDLLSVSVSAGLGFDQALSYVVEHM 192

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   PL +E+  T  E+S    R+ A E    R + D +     A+ Q+D  G SI + 
Sbjct: 193 EG---PLIQELDTTQREISMGIPRKEALERLAARCECDEIYIFVGAINQADELGASIKNV 249

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +    +  R       E++A  L  K+ VPM++F LPV  ++I+GPAI S+I  +K
Sbjct: 250 METQAAAIRLTHKQNVEEQAQKLSVKMMVPMVLFILPVTFIIILGPAIPSVISALK 305


>gi|325964126|ref|YP_004242032.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470213|gb|ADX73898.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 294

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 97/172 (56%), Gaps = 3/172 (1%)

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           ++G+  P + + +  ++RQ  I+    + LD +LI VE+G+  + A+ R  E+  G   P
Sbjct: 126 FMGYFIPDLLLYSKGKERQKVIQLELANTLDQMLISVEAGLGFEGAMARAGENGKG---P 182

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L+EE++ T+ ++    +R+ A+     RT +  +R+  QA+IQ+D YG +I   LRV   
Sbjct: 183 LAEELVRTLQDMQVGRSRREAYLALAERTSIPELRSFVQAIIQADTYGIAISRVLRVQAK 242

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
             R +R   AE+KA  L   +  P++ F  PVL + I+GPA+++ + T+   
Sbjct: 243 VMRMKRRQRAEEKAMKLPVMILFPLLFFIFPVLFIAILGPAVINTVVTLSGQ 294


>gi|323499916|ref|ZP_08104875.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
 gi|323315157|gb|EGA68209.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
          Length = 314

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 91/169 (53%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P+V ++ +V+KRQS I+   PDALDLL++C ESG+    ALRRVA+++       +
Sbjct: 146 GLYIPNVGLNYVVKKRQSRIRGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFA 205

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+     ++        AFE+   RT +  +      L  + R G S+  +LR    + 
Sbjct: 206 DELDTVCVKIKAGVEMSDAFEDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDF 265

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           R +R  E E+ AA +  K+  P+++F  P   +V IGP++L +  T+ +
Sbjct: 266 RDKRNQEIEEIAAKIPTKMIFPLLLFIWPCFFIVAIGPSMLFLTATLGN 314


>gi|323529408|ref|YP_004231560.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386410|gb|ADX58500.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 319

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 106/178 (59%), Gaps = 2/178 (1%)

Query: 147 QLRVGAVIL--IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           Q  V A+IL  +  +G+  P+  ++    +RQ +I   +PDALDLL +CVE+G+ +D AL
Sbjct: 132 QFAVSALILAMLAAIGYYVPNAVLARCRARRQRAIVEGFPDALDLLTVCVEAGLGMDAAL 191

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            RVA ++   S  ++ E+ L + EL     ++ A  NF  RT +D +      L+Q+DR+
Sbjct: 192 MRVAGEMQLASPEVASELQLMLLELRSGFTKEKALRNFALRTGVDDIDTFASMLVQADRF 251

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           GTSIG SLRV+    R+ R M AE++AA +  KL  P+I    P L+ V++GPA + I
Sbjct: 252 GTSIGASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMTVLMGPAFIHI 309


>gi|301168390|emb|CBW27980.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 404

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 99/199 (49%), Gaps = 5/199 (2%)

Query: 126 IFLILGI-IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           IFLI+G  I  FG    LE  + L +  + +IG VGF  P +WI   ++ RQ  +  A P
Sbjct: 206 IFLIVGFPIVFFGIRVFLEEEWPLTL--IPIIGAVGFVYPDIWIKGRIEMRQKEVIMAMP 263

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+L + VE+G+    A+ +V E    +   LSEE    I E+    +R  A  N   
Sbjct: 264 FCVDMLALSVEAGLDFVAAMTKVVEK--AKKTALSEEFETMIKEIRIGASRAEALRNLAW 321

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  +  + +    LI +D  G SIG  L+ L  E R ++  E EK  A+   K+  PM+ 
Sbjct: 322 RIDLIQISSFCATLIAADSVGASIGPILKALSMEIRQKKSSEVEKAGATAATKILFPMLF 381

Query: 305 FFLPVLILVIIGPAILSII 323
             +P + +V+  P +L ++
Sbjct: 382 LIVPAVFIVVAAPIVLELV 400


>gi|325111219|ref|YP_004272287.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324971487|gb|ADY62265.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 461

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 143/279 (51%), Gaps = 20/279 (7%)

Query: 58  QQITSLQKD---SASSRLRTRDSKSLRNFVKKLNLKAILVD-----ENIVNKLRAAGFRS 109
           + I+  Q+D    A S +  RD+   +       L A+L +     + +  +L  AG+ +
Sbjct: 169 KPISGTQQDLPRVAPSEVPFRDTSDFQFGTATPALAAMLPESESRRDALKQELVEAGYYN 228

Query: 110 EYSLNILLVVR---LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV-GFCAPS 165
            ++   L  VR   L++P+  LI G++ +FG  +L   P  L    ++++G V G+  P 
Sbjct: 229 PHAYENLAAVRYLGLMLPL--LIFGVLLVFGPPQL--EPVML---VLMIVGAVLGWSIPR 281

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           + +     KR+  I++A PD +DLL +CV  G+++  AL RV+ +I      ++EE+ + 
Sbjct: 282 LLVRQRAAKRRREIEQALPDVIDLLNMCVSQGMTLRPALARVSWEISDTYPAMAEELRI- 340

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           +AE + L   + A  N   R  +  + + T  LIQ++R GT++ DSL       R+    
Sbjct: 341 VAEQANLGTLEHALNNMNERVDVPELHSLTTLLIQTERMGTNVSDSLTEYSDGMRATLQQ 400

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            A++KA +   KL  P ++  +P +   ++GPA++ + D
Sbjct: 401 RADQKANAATFKLLFPTVLCLMPAVYFFLLGPAVVELSD 439


>gi|283777928|ref|YP_003368683.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283436381|gb|ADB14823.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 326

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 141/280 (50%), Gaps = 15/280 (5%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILV---DENIVNKLRA----AGFR 108
           R + +T     +   R R +    ++  V ++   A ++   DE    +L+A    AG  
Sbjct: 40  RMESLTEGDSHAIDDRYRAKPRGMMQLLVPQIPRLAKVILPNDEATRTRLQAQLIQAGIY 99

Query: 109 SEYSLNILLVVRLVVPIIFLILGII--WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           +  ++ + L  +LV+  I  ++G++  W   +D           G   ++       PS+
Sbjct: 100 APSAMGLYLTAKLVLMTIPPVVGLVVAWFGWFDPAYAMLLGGAGGCAGML------MPSM 153

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++    KRQ  ++ +  D LDL++ C+E G+ +  A+ +VA+++      L+ E+L+ +
Sbjct: 154 WLAYYRAKRQRQLRTSLADFLDLMVTCLEGGVGMQAAISQVADELRTPHPILATELLVVL 213

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            E+    + +VA  +   RT ++ +R+    + Q+ R+G+++ D++R L    R++R   
Sbjct: 214 REVEVGRSIEVALAHLAERTGLEELRSLATFVQQAQRFGSTMADAMRELSDMLRTQRETR 273

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           AE++A     K+ +P ++F  P + +V+ GPA + I +++
Sbjct: 274 AEERAQKASVKILIPTLLFIFPTVFVVLAGPAAIQIQESL 313


>gi|84386792|ref|ZP_00989817.1| putative type IV pilus protein [Vibrio splendidus 12B01]
 gi|84378320|gb|EAP95178.1| putative type IV pilus protein [Vibrio splendidus 12B01]
          Length = 283

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 91/155 (58%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           V + +  I R  PDA+DL+++CV SG++++   R V E++   S  LS E LLT  E+S 
Sbjct: 126 VNQVRMQISRVIPDAVDLMVVCVASGLTLEAVFRCVGEEMRAISPALSREWLLTATEISV 185

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
           L + Q A  N   R Q+  + N    + Q+ +YGT + ++L+++ S++R    +E E+  
Sbjct: 186 LDSPQTALSNLDKRVQLPDINNIVTTMNQALQYGTPLAEALKLIASDSRQYHFLELEEWV 245

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             +  K++ P+++F +  ++ +I+ P +LS+  T+
Sbjct: 246 GKIPAKMSFPLVVFIMLPVVGIIVVPIMLSLKQTL 280


>gi|325109819|ref|YP_004270887.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970087|gb|ADY60865.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 333

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 94/168 (55%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G   P +W+   V++RQ++  +A PD  DLL+ C+ SG++I+ +++RVAE++      L
Sbjct: 149 IGVVLPGLWLDRAVRRRQATFMKAIPDLFDLLVTCLSSGLTIEASIKRVAEELRLAHPDL 208

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+     E+    +   A ++F  R  ++ +R+      Q+ +YGT   ++LRV  + 
Sbjct: 209 ANELARVQNEIHLGISVVDALKHFAERCNLNPIRSLAMMCEQTRQYGTRAIEALRVHANM 268

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R++R   AE++A     K+  P ++   P + +V+ GPA + I +TM
Sbjct: 269 MRTQREQRAEERARKAAVKILAPTVLLIFPSVFVVVAGPAAIQIAETM 316


>gi|307726380|ref|YP_003909593.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307586905|gb|ADN60302.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 318

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 109/185 (58%), Gaps = 5/185 (2%)

Query: 143 EYPF---QLRVGAVIL--IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
           + PF   Q  V A+IL  +  +G+  P+  ++    +RQ +I   +PDALDLL +CVE+G
Sbjct: 124 QMPFINGQFAVSALILAMLAAIGYYLPNAVLARCRARRQRAIVEGFPDALDLLTVCVEAG 183

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           + +D AL RVA +I   S  ++ E+ L + EL     ++ A  NF  RT ++ +      
Sbjct: 184 LGMDAALMRVAGEIELASPEVASELQLMLLELRSGFTKEKALRNFALRTGVEDIDTFASM 243

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L+Q+DR+GTSIG SLRV+    R+ R M AE++AA +  KL  P+I    P L+ V++GP
Sbjct: 244 LVQADRFGTSIGASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMTVLMGP 303

Query: 318 AILSI 322
           A + I
Sbjct: 304 AFIHI 308


>gi|313902406|ref|ZP_07835809.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
 gi|313467337|gb|EFR62848.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
          Length = 326

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
            G+  P   +     +R+  + RA PD +DLL + VE+G+ +D A+++V E       P+
Sbjct: 160 TGWILPDAALKARATRRKRQLARALPDVMDLLSVAVEAGLGLDGAVQKVTEKF---PAPV 216

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S E    + EL    +R+ A  +  +R ++  +R+   A+IQ+DR G S+   LRV   +
Sbjct: 217 STEFRQYLKELRLGVSREEALRSLADRAELPELRSFAAAVIQADRLGVSLARVLRVQAEQ 276

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            R +R   AE++A     K+ +P+++F  P L +V++GPA++ I+  
Sbjct: 277 LRFQRKQRAEEQAMKTPIKMLLPLVLFIFPTLFIVLLGPALIQILSA 323


>gi|220913395|ref|YP_002488704.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860273|gb|ACL40615.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 294

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 100/178 (56%), Gaps = 3/178 (1%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A + + ++G+  P + + +  Q+RQ +++    + LD +LI VE+G+  + A+ R  ++ 
Sbjct: 120 AGLFVLFLGYFIPDLLLYSKGQERQKTMQLELANTLDQMLISVEAGLGFEGAMARAGDNG 179

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   PL+EE++ T+ ++    +R+ ++     RT +  +R+  QA++Q+D YG +I   
Sbjct: 180 NG---PLAEELVRTLQDMQVGRSRRESYTALAARTSIPELRSFVQAVVQADTYGIAISRV 236

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           LRV     R +R   AE+KA  L   +  P++ F  PVL + I+GPA+++ + T    
Sbjct: 237 LRVQAKVMRVKRRQRAEEKAMKLPVMILFPLLFFIFPVLFIAILGPAVINTVVTFTGQ 294


>gi|284991838|ref|YP_003410392.1| Type II secretion system F domain-containing protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284065083|gb|ADB76021.1| Type II secretion system F domain protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 295

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 98/178 (55%), Gaps = 3/178 (1%)

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           P  L V   + +  V +  P + + +  Q+RQ +I     D LD + I VE+G+  + A+
Sbjct: 115 PGPLTVLMAVGVTGVAYVVPELLLYSRGQERQQAIALELADTLDQMTIAVEAGLGFEAAM 174

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            R   +  G   PL+EE++ T+ +++    R+ A+     RT +  +R   +A++Q+D Y
Sbjct: 175 ARAGRNGRG---PLAEELVRTLQDIAVGQPRREAYLALAERTAVPDLRRFIRAVVQADAY 231

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G SI D LR   +E R +R   AE+KA  +  K+  P+I+  LP L +V++GPA+L I
Sbjct: 232 GVSIADVLRTQAAEMRLKRRQRAEEKAMQIPVKVIFPLILCILPTLFIVLLGPAVLDI 289


>gi|309792339|ref|ZP_07686809.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225654|gb|EFO79412.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 309

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 4/172 (2%)

Query: 155 LIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +IG+V G+  P  W+   ++KR+ SI +A PDALDLL I VE+G++ D AL+RV +    
Sbjct: 138 MIGFVLGYMLPVTWLGQQIKKRKKSITKALPDALDLLCISVEAGLAFDLALQRVTQKWDD 197

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +   LS E    ++++     R+ A ++   RT +D V+  T A+IQ+D+ G S+   LR
Sbjct: 198 E---LSREFKKVLSDIRLGRTRREALKDLGVRTGVDDVQTFTAAVIQADQLGVSMSKILR 254

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           +   + R  R   AE+ A     K+  PM+    P L +VI+GPA+  I+++
Sbjct: 255 LQSDQMRQRRRQRAEEAAQQAPIKMLFPMVFLIFPALFVVILGPAVPRIMES 306


>gi|119962497|ref|YP_948623.1| type II secretion system protein F [Arthrobacter aurescens TC1]
 gi|119949356|gb|ABM08267.1| putative bacterial type II secretion system protein F domain
           [Arthrobacter aurescens TC1]
          Length = 296

 Score = 95.5 bits (236), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 92/163 (56%), Gaps = 3/163 (1%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + I     +RQ +I+   P+ LD +LI VE+G+  + A+ R  ++  G   PL+ EML
Sbjct: 133 PDLIIHGRAAERQKAIQTELPNTLDQMLISVEAGLGFEGAMARAGQNGSG---PLAMEML 189

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ ++    +R+ A+     R  +  +R    A++Q+D YG +I + LR    + R +R
Sbjct: 190 RTLQDMQAGRSRKEAYVALAERVDVHDLRAFVGAIVQADTYGIAIANVLRTQAKQMRIKR 249

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
              AE++A  L  K+  P++   LPVL +VI+GPA+L+++  +
Sbjct: 250 RQRAEEQAMKLPVKVLFPLMFCILPVLFIVIMGPAVLNVMTNL 292


>gi|325964118|ref|YP_004242024.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470205|gb|ADX73890.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 292

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 91/162 (56%), Gaps = 3/162 (1%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + I N   KRQ  I+   P+ LD LLI VE+G+  + A+ R     G     LS+E++
Sbjct: 132 PDLLIYNKGIKRQQEIELELPNTLDQLLISVEAGLGFEAAMARAG---GYGDGALSQELM 188

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ ++     RQ A++   +R+ +  +R+  +A+IQ+D+YG  I   LR    + R +R
Sbjct: 189 RTLQDIQVGRPRQDAYQALADRSSVQDLRSFVRAVIQADKYGIGIAKVLRTQAKQARVKR 248

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
              AE+KA  L  K+  P+++   PVL +V++GPA + I++ 
Sbjct: 249 RQRAEEKAMKLPVKVLFPLLLCIFPVLFIVLLGPAAIKIVEA 290


>gi|134299964|ref|YP_001113460.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052664|gb|ABO50635.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 310

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 95/170 (55%), Gaps = 3/170 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P +++++ ++ R++ ++++ PDALDLL + VE+G+  D AL +VAE   G    +
Sbjct: 144 LGWLLPDLYLNSRIRNRKTQVEKSLPDALDLLTVSVEAGLGFDGALMKVAEKTKGI---M 200

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E +L + E      R+ A  +   R  +D + +   ++I +D  G SIG+ LR    +
Sbjct: 201 ADEFILMLQECHMGKPRREALRDMATRLDVDDLSSFCGSIILADTLGISIGNVLRTQSQQ 260

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R +R  + E+ A     K+  PM+ F  P + ++++GPA L I+    +
Sbjct: 261 MRQKRRQKTEELAMKAPIKMLFPMVFFIFPAIFVILLGPAALQIMKAFAN 310


>gi|90411198|ref|ZP_01219211.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
 gi|90328044|gb|EAS44365.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
          Length = 224

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 89/161 (55%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P+  +    +KR   +  A+PDALDLL++  E+G+    AL RVA +I   S  LS E+ 
Sbjct: 59  PNFILQKKAKKRIRKLSNAFPDALDLLVVTTEAGLGFLAALNRVANEIDAISPELSNELQ 118

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           +   ++       +A   F  RT +  ++     + QS + G+S+GD+LR    E R  R
Sbjct: 119 IVCRKVRLGVPMPIALAQFIERTGLLELQGLVSIISQSVKLGSSMGDTLREYAIEFRDRR 178

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           + +AE++AA +G K+  P++    P   +V +GPAI+++++
Sbjct: 179 MQKAEEEAAKIGTKMIFPLVTCIWPGFFVVAVGPAIIAVLE 219


>gi|197106493|ref|YP_002131870.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
 gi|196479913|gb|ACG79441.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
          Length = 300

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 134/257 (52%), Gaps = 25/257 (9%)

Query: 84  VKKLNLKAILVDENIVNKLRA----AGFRSEYSLNILLVVRLVVPIIFLIL--GIIWIFG 137
           V++L  ++ + D   V+ LR+    AGF S  +           P+IFL +   +I    
Sbjct: 54  VRRLGQQSAVRDPAKVSLLRSRLMQAGFFSREA-----------PVIFLGIKAALIAAAT 102

Query: 138 YDKLLEYPFQLRVGAVILIGY---VGFCAPSVWISNLVQK-RQSSIKR----AWPDALDL 189
              L+  P  +      ++G    VG    +++  + V K R+++ +R     +PD LDL
Sbjct: 103 VGVLMTLPVMIGAKGGNMMGLAMAVGLSLAALYGPDQVLKSRKATREREYADGFPDLLDL 162

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L+  VE+G+S+D A+ RV +++  +   L+  +   + EL     R+ A+  F +R  ++
Sbjct: 163 LVASVEAGLSLDAAVTRVTDELERRYPNLTVHLRFLVLELRAGRARKDAWSAFADRLAIE 222

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
             R     L Q++  GTS+GD+L+V   + R +R++ AE+KA +L  KLTVP+I+F  P 
Sbjct: 223 DARALATMLRQAEEMGTSLGDTLQVFSQDMRQKRMLRAEEKALALSAKLTVPLILFIFPS 282

Query: 310 LILVIIGPAILSIIDTM 326
           L+  ++ PA + +I  +
Sbjct: 283 LLTALMLPAAVRMIKVL 299


>gi|147677788|ref|YP_001212003.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
 gi|146273885|dbj|BAF59634.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
          Length = 307

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 7/174 (4%)

Query: 153 VILIGYVGFC----APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +IL+G  G       P + ++  +  R+  I+++ PD +DLL + VE+G+S D AL +V 
Sbjct: 131 IILLGTAGLALGWFVPELLLNKKILDRKKEIEKSLPDVMDLLTVSVEAGLSFDGALMKVT 190

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           E   G    LSEE    + E+     R  A  +   R  +D +     A+I +D+ G SI
Sbjct: 191 EKKRGV---LSEEFTKMLQEIKIGRPRLEALRDLSRRLDVDDLSAFAGAVILADQLGISI 247

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G+ LRV   + R +R   AE+ A     K+ +PM++F  P + +V++GPA++ I
Sbjct: 248 GNILRVQSDQIRMKRRQAAEEMAMKAPVKMLIPMVLFIFPAIFVVLLGPAVIQI 301


>gi|323493498|ref|ZP_08098620.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
 gi|323312321|gb|EGA65463.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
          Length = 284

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 116/226 (51%), Gaps = 6/226 (2%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL   G+ S  + +I + +RLV     +  G+ W F     L+      + AV +I  + 
Sbjct: 62  KLTMLGYHSPQAESIFMTLRLVS---MVCGGVAWFFYQQLSLDATGIAEIIAVAVITGIA 118

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
                 W    V+     I +  PDALDL+++CV SG S++     V E++   S  LS 
Sbjct: 119 IDRAVDW---RVKAVIHDIAKNIPDALDLMVVCVSSGQSLETTFNTVGEEMKTISQSLSR 175

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E L T  E++ L + Q A  N   R ++  V N    + Q+ ++GT + ++L+++ S+ R
Sbjct: 176 EWLQTANEIAVLDSPQKALFNLDERLKLPEVNNMIVTMAQALKFGTPMAEALKLIASDNR 235

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             +++E E+    +  K++ P+++F +  ++++I+ P +LS+  T+
Sbjct: 236 QYQMLELEEWVGKIPAKMSFPLVVFIMMPVVVIIVAPMVLSLFQTI 281


>gi|261251593|ref|ZP_05944167.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
 gi|260938466|gb|EEX94454.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
          Length = 284

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 115/229 (50%), Gaps = 10/229 (4%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
            KL   G+ S  + +I +  R        I G++W   Y + L          V++   +
Sbjct: 61  QKLAMFGYVSSQAESIFMTARASA---MTIAGVVWF--YSQQLSVDVGGFAQCVVVALSI 115

Query: 160 GFCAPSV--WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           G        W  N+V++    I +  PDALDL+++CV SG S++     V +++   S  
Sbjct: 116 GIVIDRALDWRVNVVRQE---IAKNIPDALDLMVVCVSSGQSLEATFNTVGQEMKSISPS 172

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           LS E L+T  E++ L + QVA  N   R  +  V N    + Q+ ++GT + D+L+++ S
Sbjct: 173 LSREWLVTATEMAVLDSPQVALTNLDTRLALPEVNNMIVTMSQALKFGTPMADALKLIAS 232

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           + R   ++E E+    +  K++ P+++  +  ++++I+ P +LS+  T+
Sbjct: 233 DNRQYHMLELEEWVGKIPAKMSFPLVVLIMLPVVVIIVAPMVLSLFQTL 281


>gi|170725110|ref|YP_001759136.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810457|gb|ACA85041.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 287

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 2/165 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +IL G  G+  P + +++L +KRQ+ I ++ P  LD L + +E+G+++  A+ +  E   
Sbjct: 116 LILAGLFGYILPVITLNDLRKKRQALIVKSLPVYLDYLTMSIEAGLNMTGAISQAVER-- 173

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G S PL  E    I ++    +R  +F N   R Q+  + +   AL Q+++ G S+G +L
Sbjct: 174 GPSGPLRIEFEKVIRDMRAGMSRAQSFRNMAERVQITEINSLVSALAQAEKTGASLGQTL 233

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           RV   + R ER   AEKKA     KL  P+I+F  PV  +++  P
Sbjct: 234 RVQSDQRRIERFQRAEKKALEAPVKLVFPLIVFIFPVTFMILAFP 278


>gi|170692559|ref|ZP_02883721.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170142215|gb|EDT10381.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 318

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 98/163 (60%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P+  ++    +RQ  I  ++PDALDLL +CVE+G+ +D AL RVA+++   S  ++
Sbjct: 146 GYYVPNAVLARCRARRQRRIVESFPDALDLLTVCVEAGLGMDAALMRVADEMTLASPEVA 205

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E+ L + EL     ++ A  NF  RT  + +      L+Q++R+GTSIG SLRV+    
Sbjct: 206 NELQLMLLELRSGFTKEKALRNFALRTGAEDIDTFASMLVQAERFGTSIGASLRVMSDTL 265

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+ R M AE++AA +  KL  P+I    P L+ V+IGPA + I
Sbjct: 266 RTRRRMRAEERAAKIALKLLFPLIFCIFPALMTVLIGPAFIHI 308


>gi|296158517|ref|ZP_06841347.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891085|gb|EFG70873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 293

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +IL+  +G+  P +W  ++ ++R   I R  P  LD L + VE+G++I+ A+++  E   
Sbjct: 120 LILVAALGYIYPRIWTRDVRRRRVGQILRHLPIYLDFLTLAVEAGLNINGAIQKSVEK-- 177

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G   PL  E+   + +L    NR  A     +R ++  V N    ++Q++R G+ +  SL
Sbjct: 178 GPEGPLRRELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSL 237

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R    + RSER   AEK+A     KL  P+++F  P+  +V+  P ++  + 
Sbjct: 238 RFQSEQRRSERFQRAEKQAMEAPVKLVFPLLMFIFPITFIVLGFPIVMKFVQ 289


>gi|148655544|ref|YP_001275749.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567654|gb|ABQ89799.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 299

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 96/187 (51%), Gaps = 5/187 (2%)

Query: 144 YPFQLRVGAVILI--GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
           +   L +GA++L+     GF  P +W+   V++RQ +I  A PD LD+L +CV +G+  D
Sbjct: 111 FALGLPLGAILLVILPLGGFFYPLLWLRGRVKQRQHAITVALPDLLDMLAVCVSAGMGFD 170

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            AL  + E   G   PL EEM   + EL     R+ AF N   R   D +R    AL+Q+
Sbjct: 171 IALTLLVERGEG---PLYEEMGRMLHELQMGAPREQAFRNLAARNSSDALRGFIDALLQA 227

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           +  G+ I  +L     + R+ R   A ++ A    K+T+ +++   P ++ +II    +S
Sbjct: 228 EELGSPIATTLERQAEDIRTGRRYRAREEGAKAATKITLIVVVLVTPSVLCLIIAALGMS 287

Query: 322 IIDTMKD 328
           I+ + + 
Sbjct: 288 IMRSTRG 294


>gi|220922536|ref|YP_002497838.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947143|gb|ACL57535.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 303

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 135/272 (49%), Gaps = 11/272 (4%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL-VDENIVNKLR----AAGFRSEYS 112
           Q+ T  Q+  A+ R   R+        +K  L+AI  V+E+ + + R      GF +  +
Sbjct: 31  QRGTVRQRMRAARRTSEREHTPYLPAERKGRLEAIFGVNESTIQRQRLDLLRGGFFNPNA 90

Query: 113 LNILLVVRLVVPIIFLILGI-IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           +      +L +     I    ++ F  D      F L  G+++L  Y+    P  ++S  
Sbjct: 91  VEYFNFTKLTLVFALPICACAMFAFRSDLSSLTKFALVSGSLLLAYYI----PDAFVSRR 146

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            + ++ + + A+PD LDLL++CV++G+S++ A  RV  ++  +S  L   + +  +EL  
Sbjct: 147 QRLQKEAYRSAFPDMLDLLVVCVDAGLSLEAAFDRVGSEMD-ESGALRVNLAIMASELRN 205

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                   +    R  +D  R+    L QS   GT I  SLRV   E R++R+M AE+KA
Sbjct: 206 GRGFVDGLQGLAERLDIDEARSFAILLQQSLELGTDISQSLRVYSDEMRNKRMMRAEEKA 265

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            +L  K+ +P+  F  PV+++V++ P ++ II
Sbjct: 266 NALPVKIVLPLGAFIFPVILIVVMVPIVIRII 297


>gi|319941897|ref|ZP_08016218.1| hypothetical protein HMPREF9464_01437 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804550|gb|EFW01420.1| hypothetical protein HMPREF9464_01437 [Sutterella wadsworthensis
           3_1_45B]
          Length = 297

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 138/259 (53%), Gaps = 12/259 (4%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSL--RNFVKKLNLKAILVDENIVNKLRAAGFRS 109
           R +L +Q++  ++    S  +R  D  +L  R   +  +L A+         ++ AGF  
Sbjct: 29  RSLLVEQRLNQIKGSGDSRLVRWEDLLTLIARPLRRSRDLAAV------ERSMQQAGFIK 82

Query: 110 EYSLNILLVVRLVVPIIFLILGIIWI-FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWI 168
            +  ++ L+ R +V I   + G + I      L++ P  L   A + + +V   AP  ++
Sbjct: 83  PWQTDLFLLFRALVLIAAAVGGWLAIDIDPTHLVQKP--LPPLAYLFLLFVAGRAPGWFL 140

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE 228
           S L ++RQ+ I+   P A+DLL IC+  G+S+++A  RVA +I  ++  +++E  +T  E
Sbjct: 141 SELAERRQNRIRLFIPKAVDLLTICMSCGMSLEEAFDRVASEIARRAPEVAKEFRMTRYE 200

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAE 288
           +  + NR VA +    R+ +  ++    +L+QS +YGT + ++L+ + +E R+ +L E E
Sbjct: 201 M-LVVNRTVALKRLEARSGVREMKILANSLLQSIQYGTPLTEALQSIAAEARAGQLSELE 259

Query: 289 KKAASLGPKLTVPMIIFFL 307
           +KA  +   + VP+I+  L
Sbjct: 260 QKAGRISAVIGVPLIVLVL 278


>gi|91777214|ref|YP_552422.1| putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
 gi|91689874|gb|ABE33072.1| Putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
          Length = 293

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 89/172 (51%), Gaps = 2/172 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +IL+  +G+  P +W  ++ ++R + I R  P  LD L + VE+G++I+ A+++  E   
Sbjct: 120 LILVAALGYFYPRIWTRDVRRRRVAQILRHLPIYLDFLTLAVEAGLNINGAIQKAVEK-- 177

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G   PL  E+   + +L    NR  A     +R ++  V N    ++Q++R G+ +  SL
Sbjct: 178 GPEGPLRRELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSL 237

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R    + RSER   AEK+A     KL  P++ F  P+  +V+  P  +  + 
Sbjct: 238 RFQSEQRRSERFQRAEKQAMEAPVKLVFPLLFFIFPITFIVLGFPIAMKFVQ 289


>gi|312883759|ref|ZP_07743478.1| Flp pilus assembly protein TadC [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368508|gb|EFP96041.1| Flp pilus assembly protein TadC [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 284

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 93/160 (58%), Gaps = 3/160 (1%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W  N+V++    I +  PDALDL+++CV SG +++     V +++   S  LS E L+T 
Sbjct: 125 WRVNVVRQE---IAKHIPDALDLMVVCVSSGQNLEATFNTVGQEMKSISPSLSREWLVTS 181

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            E++ L + QVA  N   R  +  + N    + Q+ ++G  + ++L+++ S++R   ++E
Sbjct: 182 TEMAVLDSPQVALTNLDARLALPEINNMIATMSQALKFGAPMAEALKLIASDSRQYHMLE 241

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            E+    +  K++ P+++F +  ++++I+ P +LSI  T+
Sbjct: 242 LEEWVGKIPAKMSFPLVVFIMLPVVVIIVAPMVLSIFQTI 281


>gi|218677458|ref|ZP_03525355.1| putative component of pilus protein [Rhizobium etli CIAT 894]
          Length = 136

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 71/105 (67%), Gaps = 2/105 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR--LR 73
           +A+  A+++F+  Y + +P    G+L KRMK+V+ ERE +R ++   +  +  + +  LR
Sbjct: 16  IALLVAIAVFATFYTIAVPFFERGDLSKRMKAVSTEREQIRARERARMNTEPGAGKASLR 75

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
           +++++S+R  V++ NL+  LVD+N VNKLRAAG RSE +LN  LV
Sbjct: 76  SQNNRSVRQIVERFNLRKALVDDNTVNKLRAAGLRSENALNTFLV 120


>gi|127511576|ref|YP_001092773.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636871|gb|ABO22514.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 287

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 89/165 (53%), Gaps = 2/165 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++L    G+  P + +++L +KRQ  I ++ P  LD L + +E+G+++  AL +  E   
Sbjct: 116 LLLAAVFGYFLPVMTLNDLRKKRQGLIVKSLPVYLDYLTMSIEAGLNMTGALSQAVER-- 173

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G + PL  E    I ++    +R  AF N  +R Q+  V +   AL Q++R G S+G +L
Sbjct: 174 GPAGPLRIEFEKVIRDMRAGMSRAQAFRNMADRVQVTEVNSLVSALAQAERTGASLGQTL 233

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           R+   + R ER   AEKKA     KL  P+I+F  PV  +++  P
Sbjct: 234 RIQSDQRRIERFQRAEKKALEAPVKLVFPLIVFIFPVTFMILAFP 278


>gi|116626772|ref|YP_828928.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229934|gb|ABJ88643.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 312

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 98/169 (57%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   +  LV+  ++ ++ A PD +DLL I + +G+ +DQA+ RV+E++      L
Sbjct: 138 LGFILPKQILYRLVKSYRTKLQDALPDTVDLLGIVLGTGLGLDQAMMRVSEEMQFIYPEL 197

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E    + ++    +R  +F  F  RT ++ +++ +  +IQS+++GTS+  +L+V    
Sbjct: 198 ANEFATVVMQVRAGQDRGKSFNQFVRRTGIEDIKSLSAMIIQSEKFGTSLAQALKVYADA 257

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            R+ R + AE      G K+  P+++F LPVL ++ + P +LS++  +K
Sbjct: 258 LRTRRRLRAEAAVGKAGIKMLFPIVVFILPVLFVITLVPGMLSVMKDLK 306


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 90/169 (53%), Gaps = 3/169 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G   P  W+S  + +R+  I    PDALDLL I VE+G+  D A+  + +        ++
Sbjct: 475 GVYLPLFWLSREITQRRRRILLQMPDALDLLTISVEAGLGFDAAMLEIVQKWDND---IA 531

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E  L ++E+    +R+ A  +   R Q+D ++    +++Q+D  G SIG +L +   + 
Sbjct: 532 REFALVLSEMKLGKSRRDALRSMAERVQLDEMKLLVSSIVQADEIGASIGRTLSIQSEQM 591

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           R  R   AE+       K+ +PM++F  P + +V++GPAI +I++ + +
Sbjct: 592 RLRRRQRAEELGHKAVIKIIIPMVLFIFPAVFVVLLGPAIPTILNALGN 640


>gi|116671473|ref|YP_832406.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611582|gb|ABK04306.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 292

 Score = 89.7 bits (221), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 119/221 (53%), Gaps = 9/221 (4%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG  S   L  LLV +   P + L++ ++ +    +      Q+ + AV   G   F  P
Sbjct: 79  AGRPSSMPLPRLLVAK---PALALVVAVLMMLMLSR--NGSAQMILLAVFATGLAYFV-P 132

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            + I +  Q+RQ  I+   P+ LD +LI VE+G+  + A+ R  ++  G   PL+EE++ 
Sbjct: 133 DLLIYSRGQERQKKIQLELPNTLDQMLIAVEAGLGFESAMARAGQNGKG---PLAEELIR 189

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ ++     R+ +  +R   +A++Q+D YG +I   L+    E R +R 
Sbjct: 190 TLQDMQVGRSRRDSYLALAERSNVQDLRTFVRAVVQADTYGIAIAKVLKAQAKEMRVKRR 249

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             AE+KA  L   +  P+++F  PV+ +VI+GPA+++II+ 
Sbjct: 250 QRAEQKAMKLPVLVLFPLLLFIFPVIFIVILGPAVINIIEA 290


>gi|227819312|ref|YP_002823283.1| TadC pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338311|gb|ACP22530.1| TadC pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 313

 Score = 89.7 bits (221), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 119/227 (52%), Gaps = 8/227 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           N+L  AG+ S  ++     +R +V I  ++L  +W F  ++ L  P   R+  +++  +V
Sbjct: 82  NRLIRAGYFSANAVTTFHAIRAIVCIGMMVL-TVWAF--NRFL--PETSRLMTLVIAMFV 136

Query: 160 G---FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
               F   +++I      ++   +R +PD +D+L++C+++G+S++ A  RVA +   +  
Sbjct: 137 AGMTFILVNIYIDRRGSAKEREYRRLFPDFMDMLIVCLDAGMSLEAAANRVAREFVSKRK 196

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
                + + + E+      + A  N   R ++D  R+      QS+  GTS+  +LRV  
Sbjct: 197 DFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARSLAVLFRQSEELGTSVTQTLRVYS 256

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            E R  R++ AE+KA SL  K+ +P+  F  PV +++++ P ++ ++
Sbjct: 257 KEMRDLRIVRAEEKANSLPIKMLLPLGAFLFPVSLVIVLVPIVIRVV 303


>gi|116671481|ref|YP_832414.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611590|gb|ABK04314.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 294

 Score = 89.4 bits (220), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 93/169 (55%), Gaps = 3/169 (1%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P + + +   +RQ +++    + LD +LI VE+G+  + A+ R  E+  G   PL+E
Sbjct: 129 YFIPDLLLYSKGMERQKAMQLELANTLDQMLISVEAGLGFEGAMARAGENGKG---PLAE 185

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E++ T+ ++    +R+ ++     RT +  +R+  QA++Q+D YG +I   LR+     R
Sbjct: 186 EIIRTLQDMQVGRSRRESYLALAERTNIPELRSFVQAIVQADTYGIAISRVLRIQAKVMR 245

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            +R   AE+KA  L   +  P++ F  PVL + I+GPA+++ + T    
Sbjct: 246 VKRRQRAEEKAMKLPVMILFPLLFFIFPVLFIAILGPAVINTVVTFSGQ 294


>gi|323702118|ref|ZP_08113786.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
 gi|323533000|gb|EGB22871.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
          Length = 310

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 97/170 (57%), Gaps = 3/170 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+ +P ++++  +++R++ +++A PDALDLL + VE+G+  D AL +VAE     SV L
Sbjct: 144 LGWLSPDLFLNARIRQRKNQVEKALPDALDLLTVSVEAGLGFDCALMKVAEQ--SNSV-L 200

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E +L + E      R+ A  +  +R  +D +     ++I +D  G SIG+ LR    +
Sbjct: 201 ADEFVLMMQECHMGKPRREALRDMADRVDVDDLSTFCGSIILADTLGISIGNILRTQSQQ 260

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R +R    E+ A     K+  PM++F  P + ++++GPA L I+    +
Sbjct: 261 IRQKRRQRTEELAMKAPIKMLFPMVLFIFPAIFVILLGPAALQIMQAFNN 310


>gi|119773848|ref|YP_926588.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
 gi|119766348|gb|ABL98918.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
          Length = 287

 Score = 89.0 bits (219), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 89/171 (52%), Gaps = 2/171 (1%)

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
           +L    ++L    G+  P + +++L + RQ  I +  P  LD L + +E+G+++  A+ +
Sbjct: 110 ELSANYLLLAAIAGYFLPMLTLNDLRRTRQEQIVKVLPVYLDYLTMAIEAGLNMSAAIAQ 169

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
             E   G   PL  E    I ++    +R  AF N  +R Q+  + +   AL Q++R G 
Sbjct: 170 AVER--GPDGPLKIEFEKVIRDMRAGISRAQAFRNMADRVQISELNSLVSALAQAERTGA 227

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           S+G +LR+   + R ER   AEKKA     KL  P+I+F  PV  L+++ P
Sbjct: 228 SLGYTLRIQADQRRVERFQRAEKKAMEAPIKLMFPLIMFIFPVTFLILLFP 278


>gi|317122043|ref|YP_004102046.1| type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
 gi|315592023|gb|ADU51319.1| Type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
          Length = 331

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 82/145 (56%), Gaps = 3/145 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD +DLL + VE+G+  D A+++V+E       P+S E    + EL     R+ A  +  
Sbjct: 190 PDVMDLLSVSVEAGLGFDGAIQKVSEKF---PAPVSTEFRQYLKELRLGVEREEALRSLA 246

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           +R ++  +R+   A+IQ+DR G S+   LRV   + R +R   AE++A     K+ +P++
Sbjct: 247 DRCELPELRSFAAAVIQADRLGVSLARVLRVQAEQLRFQRKQRAEEQAMKTPIKMLLPLV 306

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
           +F  P L +V++GPA++ I+    D
Sbjct: 307 LFIFPTLFIVLLGPALIQILAAFND 331


>gi|332284566|ref|YP_004416477.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
 gi|330428519|gb|AEC19853.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
          Length = 291

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 87/167 (52%), Gaps = 2/167 (1%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G +G   P  W+  L ++RQ  + R +P  LD+  +CVE+G+++  AL++ A+   G   
Sbjct: 123 GLIGMLWPRYWLHGLARQRQFQMLREFPFLLDMTTLCVEAGLNLHGALQQAAQH--GPDG 180

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           PL  E+   +A++     R  A +   +R  +  V++   AL Q+D+ G S+G  LR   
Sbjct: 181 PLRGELRHALADMRAGVPRIQALQELADRCGLPAVQSLVTALAQADQLGMSLGPLLRSQS 240

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + R+ER + AEK A     K+  PM+    P   L+I  P ++ ++
Sbjct: 241 EQRRAERFLRAEKLALEAPVKMLFPMVFCIFPCTFLIIGFPIVIKLL 287


>gi|325518827|gb|EGC98402.1| type II secretion system protein [Burkholderia sp. TJI49]
          Length = 187

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 106/170 (62%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++++  +G   P+V ++  +  RQ +I   +PDALDLL +CVE+G+ +D AL +V++++ 
Sbjct: 5   LVVLAAIGNYVPNVMLARRIAARQRAIFEDFPDALDLLTVCVEAGLGLDAALMKVSDELH 64

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +S  ++ E+ L + E+     ++ A  N   RT ++ V +    LIQ+DR+GTS+ +SL
Sbjct: 65  FRSAVVASELALLLLEMRSGFTKETALRNLALRTGVEDVESFCTMLIQADRFGTSVAESL 124

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           RVL    R+ R M AE++AA +  KL  P+I    P L+ V++GPA++ +
Sbjct: 125 RVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCVFPALMGVLLGPALIHV 174


>gi|159901127|ref|YP_001547374.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894166|gb|ABX07246.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 301

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 91/163 (55%), Gaps = 3/163 (1%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G +GF  P++W+   ++KRQ  I +A PDALDLL I V +G+  D AL+RVAE    +  
Sbjct: 134 GALGFLLPAMWLGRQIKKRQKLILKALPDALDLLSISVTAGLGFDAALQRVAEKWDNE-- 191

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            L  E    ++++     R  AF +   RT ++ + +   A+IQ+D+ G S+G  L++  
Sbjct: 192 -LCREFRRALSDIRLGTQRHEAFRSMTVRTGVEDLTSFVSAVIQADQLGVSMGKMLKIQS 250

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            + R  R   AE++A     K+  P++    P + +VI+GPAI
Sbjct: 251 DQLRLRRRQRAEEEAQKAPIKMLFPLVFLIFPSMFVVILGPAI 293


>gi|90406745|ref|ZP_01214938.1| Flp pilus assembly protein TadC [Psychromonas sp. CNPT3]
 gi|90312198|gb|EAS40290.1| Flp pilus assembly protein TadC [Psychromonas sp. CNPT3]
          Length = 288

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 128/240 (53%), Gaps = 6/240 (2%)

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           L  + V++ +  +L  AGF ++   N  L  RL   ++F++L      GY         L
Sbjct: 54  LPTLKVNKKLNIQLLRAGFNND---NASLYFRLF-KLVFMLLCFGAYLGYKHFSLTSLVL 109

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
              A++ +     C    W+    ++  S+I  A PDALDL++ICVESG++++    RV 
Sbjct: 110 AEAAIVAMISGMVCER--WLIARAKRITSNIALATPDALDLMVICVESGLTLEAMFGRVG 167

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +++      LS + L+T  EL  L  R  A +N  NR  +  + N   +L Q+++YG SI
Sbjct: 168 QEMYQICPELSRQWLITEVELRLLEPRSRALKNLANRCAVVEIENLVISLSQAEKYGGSI 227

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             +LR++ +++R ++ +  E+K   +  K+ +P+++  +  ++++I+ P  +S++ T+ +
Sbjct: 228 AQTLRLIATDSRQKQYLSLEEKVGKIPAKMALPLVLLVMLPVVVLIVAPTFISLLSTLGE 287


>gi|86360589|ref|YP_472477.1| putative tadC pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284691|gb|ABC93750.1| putative tadC pilus assembly protein [Rhizobium etli CFN 42]
          Length = 314

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 119/227 (52%), Gaps = 8/227 (3%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           N+L  AG+ +  ++    VVR V+ I  L+   +W    +++   P   ++ A+I+  + 
Sbjct: 83  NRLIRAGYFAAGAVTTFQVVRAVICIGMLV-AAVW--AVNRI--APAMSQMAALIIAMFA 137

Query: 160 G---FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
               F   +++I      ++   +R +PD +D+L++C+++G+SI+ A  RVA +   +  
Sbjct: 138 AGATFILVNIYIDRRGAAKEREYRRLFPDFMDMLIVCLDAGMSIEAAANRVAREFVDKQQ 197

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
                + + + E+      + A  N   R ++D  R  +    QS+  GTS+  +LRV  
Sbjct: 198 DFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARALSVLFRQSEELGTSVTQTLRVYS 257

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +E R  R++ AE+KA +L  K+ +P+  F  PV +L+++ P I+ ++
Sbjct: 258 NEMRDLRVVRAEEKANALPVKMLLPLGAFLFPVSLLIVLVPIIMRVV 304


>gi|319782178|ref|YP_004141654.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168066|gb|ADV11604.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 316

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 120/237 (50%), Gaps = 3/237 (1%)

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY-DKLL--EYP 145
            K+I  +    N L A  FR+ +  +   ++  +  ++ + LG + ++    ++L    P
Sbjct: 75  FKSIEKEREEPNALEAKLFRAGFYQSTAPLIYTLSRLVAVCLGFLAMYALLSRVLPPHLP 134

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
             + +    L G      PS+ +      ++   +RA+PD +D+++ C ++G+S++ A+ 
Sbjct: 135 GFITLAGSALFGLACMVIPSILLDRFENSQKQIYRRAFPDFMDMMITCADAGMSLEGAVE 194

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           RV+ ++      L  ++ +   +L      + A     +R  +D  R       QS+  G
Sbjct: 195 RVSHEMAATHKWLGIQLSIMNLQLRAGKPLREALRELADRIGLDEARALAVLFRQSEELG 254

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           TS+ D+LRV  +E R +R++ AE++A SL  K+ +P+ +   PV+++VI+ P I+ +
Sbjct: 255 TSLTDALRVYSAEMRGQRILSAEERANSLPVKMMIPLGLCIFPVVMMVIMLPVIIRM 311


>gi|187251609|ref|YP_001876091.1| TadC subunit [Elusimicrobium minutum Pei191]
 gi|186971769|gb|ACC98754.1| TadC subunit [Elusimicrobium minutum Pei191]
          Length = 296

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (52%), Gaps = 1/167 (0%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P+  +++ +QKRQ  +   +   +DL  + +ESG+    A  R+   I  +   L
Sbjct: 126 LGFYIPTALVNSKIQKRQRDMLGNFSTTVDLAALIIESGLDYMTAFDRIIR-IAKEKTVL 184

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
            EE+   + E+    +R+ A E   NRT +  +R+    +IQSD  GTS+ D LR    +
Sbjct: 185 EEELDKMLNEVKLGYSRREALERLANRTGVQEIRSFVGLIIQSDELGTSLVDLLRNFSID 244

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            R  R+ +AEK AA    K+ VP+ +F  P + ++I+ P +  II +
Sbjct: 245 LRFRRMNKAEKLAAQASTKMLVPLFLFIFPTVFILILAPMLKDIISS 291


>gi|32471258|ref|NP_864251.1| integral membrane protein [Rhodopirellula baltica SH 1]
 gi|32396960|emb|CAD71930.1| probable integral membrane protein [Rhodopirellula baltica SH 1]
          Length = 313

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 87  LNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
           LNL++ L++  I +     G   + ++ +  ++ LV PI+F   G +   G     E P 
Sbjct: 84  LNLESQLINAGIHHH----GMHRKLTM-LRWLLFLVPPIVF---GSLCYRG-----EMPL 130

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
              V +   +  + +  P +W+   V+K    ++ A PD LDL+++C+++G+S+ +++++
Sbjct: 131 NWAVMSSSFLMLLAYSLPVMWLKRAVRKYHQMLRAALPDFLDLMVVCLDAGLSLQESIKQ 190

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V E++       + E+ L   ++        A   F +R+  D +R  +  + +  R+GT
Sbjct: 191 VGEELRWIHPAFTHEIDLVQHDIDLGSPVDKAIRRFADRSGYDALRTLSSLIREGQRFGT 250

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           ++ +SL       R +R   AE+ A     K+ +P ++F  P + +V++ PA   I
Sbjct: 251 NVSESLSGHADMLRFQREQAAEENAQKASVKIILPTMLFIFPAIFIVLVSPAAFKI 306


>gi|327539548|gb|EGF26158.1| Flp pilus assembly protein TadC [Rhodopirellula baltica WH47]
          Length = 311

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 87  LNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
           LNL++ L++  I +     G   + ++ +  ++ LV PI+F   G +   G     E P 
Sbjct: 82  LNLESQLINAGIHHH----GMHRKLTM-LRWLLFLVPPIVF---GSLCYRG-----EMPL 128

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
              V +   +  + +  P +W+   V+K    ++ A PD LDL+++C+++G+S+ +++++
Sbjct: 129 NWAVMSSSFLMLLAYSLPVMWLKRAVRKYHQMLRAALPDFLDLMVVCLDAGLSLQESIKQ 188

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V E++       + E+ L   ++        A   F +R+  D +R  +  + +  R+GT
Sbjct: 189 VGEELRWIHPAFTHEIDLVQHDIDLGSPVDKAIRRFADRSGYDALRTLSSLIREGQRFGT 248

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           ++ +SL       R +R   AE+ A     K+ +P ++F  P + +V++ PA   I
Sbjct: 249 NVSESLSGHADMLRFQREQAAEENAQKASVKIILPTMLFIFPAIFIVLVSPAAFKI 304


>gi|145299824|ref|YP_001142665.1| flp pilus assembly protein FlpH [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866591|gb|ABD57359.1| FlpH [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852596|gb|ABO90917.1| flp pilus assembly protein FlpH [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 294

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 98/176 (55%), Gaps = 3/176 (1%)

Query: 154 ILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +L+ YV G   P  W+    +K +S+ ++  PDA+DLL+I VE+G+++D+AL RV   +G
Sbjct: 120 VLVAYVVGAGVPERWLQWRARKVKSAQQKVVPDAIDLLVISVEAGLALDRALLRVGHYLG 179

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+ + L T AE+    ++         RT +  +      L  + +YG+ + +++
Sbjct: 180 ALEPGLARQFLRTHAEIQMRGDQASCLARLAWRTGLPELDRLANTLQMAQQYGSPLAETM 239

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R +  E R  R +  E++A SL  K+T + M +  LP+L+L II P +  +I++++
Sbjct: 240 RTISQEARQMRRLALEEQAGSLPGKITLIQMALIMLPMLVL-IIAPTLNLLINSLR 294


>gi|284048519|ref|YP_003398858.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952740|gb|ADB47543.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 309

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 106/205 (51%), Gaps = 6/205 (2%)

Query: 126 IFLILGIIWIF-GYDKLLEYPFQLRVGAVILIGYVGFCA--PSVWISNLVQKRQSSIKRA 182
           I+ +  I W F G+     +P     G V++ G + F A  P   ++++++ RQ+ I R 
Sbjct: 108 IWFVSMIFWGFQGFRYTTGHPMSTFGGLVLIWGCLLFGAMLPFGVLNHIIRNRQTKIIRQ 167

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
            PD LDLL I V++G+S+D A+R+V E + G   PL +E    + ++     R+ + +  
Sbjct: 168 LPDVLDLLSISVQAGLSLDGAMRKVVERMEG---PLIDEFRRMLRDVRMGMTRRRSMQLM 224

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  V     +++QS+R G S+ D+L +     R  R   A  +A     K+  P+
Sbjct: 225 ARRCDVQDVYLFVMSVVQSERLGASMSDTLVIQADNMRDLRRQRARTQAMKAPVKMIFPL 284

Query: 303 IIFFLPVLILVIIGPAILSIIDTMK 327
           +    P + +V++ P+++S++  MK
Sbjct: 285 VFCIFPAIFVVVLLPSLISLMQGMK 309


>gi|257791502|ref|YP_003182108.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257475399|gb|ACV55719.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 295

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 126/236 (53%), Gaps = 17/236 (7%)

Query: 95  DENIVNKLRAAGFRSE----YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
           + N+ N++ AAG   +    Y L+++L +   + +I L++   +I G D      F   V
Sbjct: 66  ERNLRNQIAAAGLNMKPSTFYGLSVILSL---LGMIALLVFSPYIVGSDTTSLLLFNAVV 122

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
            A  ++G  GF    +   N   +RQ +I R     +DLL I VE+G+++++A+R V+E 
Sbjct: 123 VAAGILGPRGFL---ILKRN---ERQEAINRELASVIDLLSISVEAGLTMERAMRHVSER 176

Query: 211 IGGQSVPLSEEMLLTIAELSFLP-NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           + G    L +E+ L   +++ L  +R+ A     +R Q + V     ++I S + G+SI 
Sbjct: 177 LDGT---LCKEIALCERDINLLGYSREDALRRLADRCQTEGVSMFVSSVIVSAKSGSSIS 233

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             L++  S  R+ +    E+K   L  K+  PM +F +P L+L+++ PA+L+++++
Sbjct: 234 RVLKMQASVARNRQFTALEEKVEKLPTKMIFPMSMFIMPSLMLIVMAPAVLTLVES 289


>gi|307726638|ref|YP_003909851.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307587163|gb|ADN60560.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 293

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 90/175 (51%), Gaps = 6/175 (3%)

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +GA +L    G+  P +W  ++ ++R + I +     LD L + VE+G++I+ A+++  E
Sbjct: 121 LGAALL----GYFYPRIWTRDVRRRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVE 176

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              G + PL  E+   + +L    NR  A     +R ++  V N   A++Q++R G  + 
Sbjct: 177 K--GPAGPLRWELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLA 234

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            SLR    + RSER   AEKKA     KL  P+++F  P+  +V+  P  +  + 
Sbjct: 235 KSLRFQSEQRRSERFQRAEKKAMEAPVKLVFPLLVFIFPITFIVLGFPIAMKFVQ 289


>gi|323341960|ref|ZP_08082193.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464385|gb|EFY09578.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 306

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 81/143 (56%), Gaps = 3/143 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P+ +D+L + V +G+S DQAL  V     G   PL EE  +   E+     R+ A     
Sbjct: 164 PEVMDILSVSVVAGLSFDQALGHVTTKAEG---PLIEEFRICQREIMLGKPRKEALNRLS 220

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT+++ V++ T A+IQ+D  G S+ + L       R+    + E++AA +  K+ +PM+
Sbjct: 221 ERTEIEEVKSFTNAIIQADELGISLQNVLMSQSQMIRTSHRQDVEERAAKIPVKILIPMV 280

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +F  PV+ ++++GPA+ +IID +
Sbjct: 281 LFIFPVIFIILLGPAVPTIIDAL 303


>gi|117617658|ref|YP_855996.1| Flp pilus assembly protein TadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559065|gb|ABK36013.1| Flp pilus assembly protein TadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 294

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 98/176 (55%), Gaps = 3/176 (1%)

Query: 154 ILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +L+ YV G   P  W+    +K +++ ++  PDA+DLL+I VE+G+++D+AL RV   +G
Sbjct: 120 VLVAYVVGAGVPERWLQWRARKVKAAQQKVVPDAIDLLVISVEAGLALDRALLRVGHYLG 179

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+ + L T AE+    ++         RT +  +      L  + +YG+ + +++
Sbjct: 180 ALEPGLARQFLRTHAEIQMRGDQAGCLARLAWRTGLPELDRLANTLQMAQQYGSPLAETM 239

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R +  E R  R +  E++A SL  K+T + M +  LP+L+L II P +  +I++++
Sbjct: 240 RTISQEARQMRRLALEEQAGSLPGKITLIQMALIMLPMLVL-IIAPTLNLLINSLR 294


>gi|84385699|ref|ZP_00988730.1| putative TadC [Vibrio splendidus 12B01]
 gi|84379679|gb|EAP96531.1| putative TadC [Vibrio splendidus 12B01]
          Length = 290

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 131/254 (51%), Gaps = 13/254 (5%)

Query: 74  TRDSKSLRN----FVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           T++  SL++    F  KL      V  N++     AG  +E+   +  +++ +VP+IF I
Sbjct: 45  TQEKVSLKDKFLVFTSKLAFNRDEVKANLIK----AGIHNEFFSQVYYLIK-IVPMIFCI 99

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           + I +++   +L      + VG  +LI  +   AP ++I++  +   S I    P  LDL
Sbjct: 100 VTIGYMYLNSRLDMLNSFMSVGISLLIFLI---APDMYIASRGKSNISHISSRLPFLLDL 156

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + +CV +G++++ +L  ++ ++      L+  ++ T +E + +     A   FY+     
Sbjct: 157 MNVCVHTGMTLEASLEYLSNELKMVDENLAF-VVQTTSERAKVVGLDKALSEFYDLVPTT 215

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
             ++    L QS +YG+S+G  L  L S+ R   ++E E+K   +G K++VPMI F +  
Sbjct: 216 EAQSFVMTLTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSVPMIAFIMIP 275

Query: 310 LILVIIGPAILSII 323
           ++++I  P I+ ++
Sbjct: 276 IVILIAAPGIMRML 289


>gi|197335643|ref|YP_002155274.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
 gi|197317133|gb|ACH66580.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
          Length = 290

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 125/235 (53%), Gaps = 17/235 (7%)

Query: 95  DENIVNKLRAAGF-RSEYSLNILLVVRLVVPIIF--LILGIIWIFG---YDKLLEYPFQL 148
           +E I  KLR AG+  ++Y       V L +PI +  L++G + IFG   Y   L     +
Sbjct: 64  EEEIKQKLRQAGWSNTQY-------VHLFMPIKYSVLLIGEV-IFGIAYYQSFLSSTAWV 115

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
              ++ ++  +   AP +++   ++ R   +    P  LDL+ +CV++G++++ +L  +A
Sbjct: 116 ITASLWMVFVI--IAPDMYLQAKIKARIHRVSTQMPYLLDLMAVCVQTGMTVEASLSYLA 173

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +++ G +  L++ +L  + E S +   + + E  Y     + +R+    L QS  YG+SI
Sbjct: 174 KEMKGFNKDLTQ-VLTKMNERSRMVGLEKSLEEMYVEIPSNEMRSFVMTLTQSMHYGSSI 232

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
              L  L S+ R  +++E E++   L  K++VP+I+F +  ++++I  P ++ ++
Sbjct: 233 YSVLTTLASDIREVQMLELEERIGKLAAKMSVPLIVFIMIPIVILIAAPGVMRLM 287


>gi|59711125|ref|YP_203901.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
 gi|59479226|gb|AAW85013.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
          Length = 290

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 142/274 (51%), Gaps = 16/274 (5%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           + LR++Q+  L  ++   +        L+N   +LN      +E I  KLR AG+ +   
Sbjct: 27  KFLREKQLHVLSGNNQKIK-ENELGGWLKNKASELNPD----EEEIKQKLRQAGWENTQY 81

Query: 113 LNILLVVRLVVPIIFLILGIIWIFG---YDKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
           +++ + ++  V    L++G + IFG   Y   L     + + A + + +V   AP +++ 
Sbjct: 82  VHLFMPIKYSV----LLIGEV-IFGIAYYQSFLSSTAWV-IAASLWMVFV-IIAPDMYLQ 134

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
             ++ R   +    P  LDL+ +CV++G++++ +L  + +++ G +  L++ +L  + E 
Sbjct: 135 AKIKARVHRVSTQMPYLLDLMAVCVQTGMTVEASLSYLVKEMKGFNKDLTQ-VLTKMNER 193

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           S +   + + E  Y     + +R+    L QS  YG+SI + L  L S+ R  +++E E+
Sbjct: 194 SRMVGLEKSLEEMYVEIPSNEMRSFVMTLTQSMHYGSSIYNVLTTLASDIREVQMLELEE 253

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +   L  K++VP+I+F +  ++++I  P ++ ++
Sbjct: 254 RIGKLAAKMSVPLIVFIMIPIVILIAAPGVMRLM 287


>gi|282865305|ref|ZP_06274357.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559778|gb|EFB65328.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 295

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 85/164 (51%), Gaps = 4/164 (2%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +L G  G+    V I + + +R+  I R  PD LD+L + V +G+   QAL RVAE   G
Sbjct: 120 VLFGVYGYFWTDVIIRSAISRRKDDIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKYSG 179

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
              P ++E+ +T+ ++    +R+ AF+    R + + V     AL Q +  G  I D+L 
Sbjct: 180 ---PWADELRITLRQMDMGVSRREAFDQLRKRNESEQVSMFVSALQQGEELGAPIVDTLI 236

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP-VLILVIIG 316
            + ++ R      A +KAA   PK T+ +  F LP  +IL+ +G
Sbjct: 237 QIANDMRRTDAQNARRKAAKAVPKATLIVTSFMLPGTMILIAVG 280


>gi|323529156|ref|YP_004231308.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386158|gb|ADX58248.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 293

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 90/174 (51%), Gaps = 4/174 (2%)

Query: 153 VILIG--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           ++LIG   +G+  P +W  ++ ++R + I +     LD L + VE+G++I+ A+++  E 
Sbjct: 118 LVLIGAALLGYFYPRIWTRDVRRRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVEK 177

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
             G + P   E+   + +L    NR  A     +R ++  V N   A++Q++R G  +  
Sbjct: 178 --GPAGPFRWELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLAK 235

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           SLR    + RSER   AEK+A     KL  P+++F  P+  +V+  P  +  + 
Sbjct: 236 SLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLVFIFPITFIVLGFPIAMKFVQ 289


>gi|86144313|ref|ZP_01062645.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
 gi|85837212|gb|EAQ55324.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
          Length = 288

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 122/247 (49%), Gaps = 5/247 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           TR+ K   +  K +  +          KL AAGF S++  ++  ++++V   + L L   
Sbjct: 43  TREEKKRADLFKAILSRISFNKHETKRKLVAAGFYSDFLADVYYLLKIVPFCVCLALIGF 102

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
             +  D    +     +GA +LI  +G   P  ++S   +     I    P  LDL+ +C
Sbjct: 103 DFYSGDTKTVFALLYLMGA-LLIFIIG---PDSYVSARGKSNIKHISSRLPFLLDLMNVC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G++I+ +L  +A+++      L+  + +T+ E S L   + A E FY        ++
Sbjct: 159 VHTGMTIESSLEYLAKELHSVDSNLAHVVRVTV-ERSRLVGLEKALEEFYELVPTSESQS 217

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               ++QS ++G+S+G  L  L S+ R   +M+ E++   +G K+++P+I F +  +I++
Sbjct: 218 FVMTMVQSLQFGSSVGPVLVTLASDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIIIL 277

Query: 314 IIGPAIL 320
           I  P I+
Sbjct: 278 IAAPGIM 284


>gi|186473167|ref|YP_001860509.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184195499|gb|ACC73463.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 292

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 85/166 (51%), Gaps = 2/166 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG+  P +W+ ++ ++  +++ R  P  LD L + VE+G++++ A+++  E   G   PL
Sbjct: 125 VGYFYPRIWMRDVRRRYVATVLRQLPIYLDFLTLAVEAGLNVNGAIQKAVEK--GPDGPL 182

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E    + +L     R  A   F  R Q+  V N  + + Q++R G+ +  +LR    +
Sbjct: 183 RREFEHVLRDLKSGLKRGDALRRFDERQQIGEVSNLVRTIAQAERMGSGLAKTLRFQSEQ 242

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            R+ER   AEK+A     KL  P+++F  PV  +V+  P  +  + 
Sbjct: 243 RRAERFQRAEKQAMEAPVKLLFPLLVFIFPVTFIVLGFPIAMKFMQ 288


>gi|121534350|ref|ZP_01666174.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307120|gb|EAX48038.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 308

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 92/177 (51%), Gaps = 7/177 (3%)

Query: 153 VILIGYVGFCA----PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           ++ + ++ F +    P   ++  +  R+ SI++  PD LDLL + VE+G+  D AL +++
Sbjct: 131 IVGLSFMAFASALLLPFFLLNRKIAMRKRSIQKDLPDVLDLLTVSVEAGLGFDGALAKLS 190

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           E + G    L +E    + E+     R+ A      R  +  +   T +LIQ+D+ G SI
Sbjct: 191 EKMKGA---LVDEFTRALQEMRMGVPRREALRAMGLRCDVPDLSLFTTSLIQADQLGVSI 247

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           G  LRV  +  R +R    ++ A     K+ +P++ F  P + +V++GPAI+ I  T
Sbjct: 248 GQVLRVQSASMREKRRQRTQELAMKAPVKMLLPLVFFIFPAIFVVVLGPAIIQIFLT 304


>gi|260462613|ref|ZP_05810819.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031519|gb|EEW32789.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 94/169 (55%), Gaps = 2/169 (1%)

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           LIG      PS+ +      ++   +R +PD +D+++ C ++G+S++ A+ RV  ++ G 
Sbjct: 149 LIGLGCLVIPSIALDRFENGQKRIYRRGFPDFMDMMITCADAGMSLEAAVERVGAELAGT 208

Query: 215 SVPLSEEM-LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
              L  ++ ++T+   +  P R+ A     +R  ++  R       QS+  GTS+ D+LR
Sbjct: 209 HKWLGIQLSIMTLQLRAGKPLRE-ALRELADRIGLEEARALAVLFRQSEELGTSLTDALR 267

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +   E R +R++ AE++A +L  K+ +P+ +   PV+++VI+ P I+ +
Sbjct: 268 IYSDEMRGQRILHAEERANALPVKMMIPLGLCIFPVVMMVIMLPLIIRM 316


>gi|291451546|ref|ZP_06590936.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291354495|gb|EFE81397.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 296

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 98/210 (46%), Gaps = 13/210 (6%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG     +L+     R V  +  L+LG++++     L            +L    G  A 
Sbjct: 82  AGNPGGLTLDRYAARRFVYGVFGLVLGLVFLTNDSTLF----------ALLTFAFGLTAA 131

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
              I   V+ R+  I R  PD LD+L + V SG+   QAL RVAE   G   P ++E+ +
Sbjct: 132 DALIWQAVRDRREVIDRTLPDFLDVLAVVVSSGLGFRQALDRVAERYEG---PWADELRI 188

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AF+    R   + V     AL Q +  G+ I D+L  + ++ R    
Sbjct: 189 TLRQMDMGVSRRQAFDELRRRNSSEQVAQFVSALQQGEELGSPIADTLIQIATDMRRTDA 248

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             + ++AA   PK T+  ++F LP  +++I
Sbjct: 249 QNSRRRAAKTIPKATMVTLVFLLPATMILI 278


>gi|113867007|ref|YP_725496.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525783|emb|CAJ92128.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 293

 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (50%), Gaps = 2/165 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P +W+ ++ ++    + R  P  LD L + VE+G++I+ AL +  E   G   PL 
Sbjct: 127 GFFYPRIWLRDVRKRNLLQVTRHLPVFLDFLTLSVEAGLNINGALLQAVEK--GPEGPLR 184

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E    + +L    +R  A     +R ++  V N   A+IQ++R G+ +  +LR    + 
Sbjct: 185 REFEHVLRDLKSGLSRADALRRMDDRLRVKEVTNFVGAVIQAERMGSGLAATLRFQSEQR 244

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R+ER   AEK+A     KL  P+++F  PV  +V+  P ++  + 
Sbjct: 245 RTERFQRAEKQAMEAPVKLIFPLVVFIFPVTFIVLGFPIVMKFMQ 289


>gi|239979681|ref|ZP_04702205.1| hypothetical protein SalbJ_09602 [Streptomyces albus J1074]
          Length = 309

 Score = 82.4 bits (202), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 98/210 (46%), Gaps = 13/210 (6%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG     +L+     R V  +  L+LG++++     L            +L    G  A 
Sbjct: 95  AGNPGGLTLDRYAARRFVYGVFGLVLGLVFLTNDSTLF----------ALLTFAFGLTAA 144

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
              I   V+ R+  I R  PD LD+L + V SG+   QAL RVAE   G   P ++E+ +
Sbjct: 145 DALIWQAVRDRREVIDRTLPDFLDVLAVVVSSGLGFRQALDRVAERYEG---PWADELRI 201

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AF+    R   + V     AL Q +  G+ I D+L  + ++ R    
Sbjct: 202 TLRQMDMGVSRRQAFDELRRRNSSEQVAQFVSALQQGEELGSPIADTLIQIATDMRRTDA 261

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             + ++AA   PK T+  ++F LP  +++I
Sbjct: 262 QNSRRRAAKTIPKATMVTLVFLLPATMILI 291


>gi|320158388|ref|YP_004190766.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
 gi|319933700|gb|ADV88563.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
          Length = 292

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 136/262 (51%), Gaps = 9/262 (3%)

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           S++K   S++ + +      +F K+ +      DE    KL AAG  S++      + + 
Sbjct: 37  SVRKIIGSTKEQQKRDDLFLSFFKRFSFNK---DET-KKKLVAAGIYSDFIAQTYYLFK- 91

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           +VP+ FL +G   +    +++++   + +GA  LI +V    P +++S+        +  
Sbjct: 92  IVPL-FLTIGGGLLAVSQEVIDFNEMILIGAFALIIFV--AGPDLYLSSRTNTITRHVSS 148

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  LDL+ +CV +G++I+  L  +A+++      L+  + +T+ + S +   + A E 
Sbjct: 149 RLPFLLDLMNVCVHTGMTIEATLEYLAKELQTVDKYLAFTVNVTV-QRSKVIGIEKALEE 207

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           FY        ++    L+QS ++G+S+G  L  L ++ R   +ME E+K   LG K+++P
Sbjct: 208 FYEMVPSSEAQSFVMTLVQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIP 267

Query: 302 MIIFFLPVLILVIIGPAILSII 323
           MI+F +  +I++II P I+ ++
Sbjct: 268 MIVFIMVPIIILIIAPGIMRML 289


>gi|148974880|ref|ZP_01811860.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
 gi|145965389|gb|EDK30638.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
          Length = 288

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 127/251 (50%), Gaps = 7/251 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV-VPIIFLILGI 132
           TR+ K   +  K +  +     +    KL AAGF S++  +   ++++V   I  +++G 
Sbjct: 43  TREEKKRTDLFKSILSRISFNKDETKRKLVAAGFYSDFLADAYYLLKIVPFSICLILIGF 102

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            +  G  ++L   F L      L+ +V   AP  ++S   +     I    P  LDL+ +
Sbjct: 103 DFYSGETEVL---FSLLYLLGALLAFV--IAPDAYVSARGKANIKHISSRLPFLLDLMNV 157

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CV +G++I+ +L  +A+++      L+  + +T+ E S L   + A E FY        +
Sbjct: 158 CVHTGMTIESSLEYLAKELHSIDSNLAHVVRVTV-ERSRLVGLEKALEEFYALVPTSESQ 216

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    ++QS ++G+S+G  L  L ++ R   +M+ E++   +G K+++P+I F +  +++
Sbjct: 217 SFVMTMVQSLQFGSSVGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVV 276

Query: 313 VIIGPAILSII 323
           +I  P IL ++
Sbjct: 277 LIAAPGILRML 287


>gi|42522078|ref|NP_967458.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
 gi|39574609|emb|CAE78451.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
          Length = 258

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 110/226 (48%), Gaps = 14/226 (6%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG----AVILIG 157
           ++ +G  SE + +  + ++ +  I+F I           LL   F L++G     V+ +G
Sbjct: 39  IKTSGLSSELNEDEFIGLQFLWGIMFPIF----------LLIMNFSLQLGLSPMVVVGMG 88

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            +GF  P +      ++R+ S++   P  +DLL + VE+G+    A++++ +   G    
Sbjct: 89  LIGFYLPQIHARGEKKRRELSVRADLPFFIDLLALSVEAGLDFFSAIQKIVDKANGTDSV 148

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L+EE  + + ++    ++  A +    R  M+ + +    L+ ++  G SI   L+    
Sbjct: 149 LAEEFSIVLKDIKIGSSKAQALKEMAERLDMNEITSFVAVLVDAESTGASISQVLKDQSV 208

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + R ER + AEK  A     + +P+++F LP + +++ GP  +S +
Sbjct: 209 QMRLERFVRAEKAGAQASQTMLIPLMLFILPAVFIIVFGPVAVSFM 254


>gi|238750902|ref|ZP_04612399.1| Type II secretion system protein [Yersinia rohdei ATCC 43380]
 gi|238710816|gb|EEQ03037.1| Type II secretion system protein [Yersinia rohdei ATCC 43380]
          Length = 265

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 112/213 (52%), Gaps = 10/213 (4%)

Query: 111 YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISN 170
           Y   +++VV LV+ +I L  G+I I            +  G + ++G   F  P + I N
Sbjct: 57  YFKTLIIVVNLVILVILLSTGLINI-------NITVFIVFGLITIVG--TFFLPKIIIKN 107

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           ++ KR  S+ ++ P  +D+   CV+SG++ID AL   A+     +  LS  +++ +++ +
Sbjct: 108 ILYKRTESVLKSLPFFIDITAACVQSGMTIDGALNYTAKKFKLINPDLSL-IMIKMSKRA 166

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
            +   ++A +  +  +    +R    AL  S  +G+SI D L  L  E R  +L+ +E+K
Sbjct: 167 EINGLELAIKELHQCSTAMEIRMFCSALQYSISFGSSIYDQLAKLSQEMREMQLLVSEEK 226

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + L  KLT P+ IF L   I+++I P++L ++
Sbjct: 227 VSKLSTKLTFPLFIFILIPFIVLVISPSVLELL 259


>gi|327189775|gb|EGE56919.1| putative tadC pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 314

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 112/218 (51%), Gaps = 10/218 (4%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           N+L  AG+ +  ++    VVR VV I  L+ G +W    +++     Q+   A +++G  
Sbjct: 83  NRLIRAGYFAAGAVTTFQVVRAVVCISVLV-GAVW--AANRIAPNMSQM---ATLILGMF 136

Query: 160 GFCAPSVWISNLVQKRQSS----IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
              A  + ++  + +R ++     +R +PD +D+L++C+++G+SI+ A  RVA +   + 
Sbjct: 137 AAGATFILVNIYIDRRGAAKEREYRRLFPDFMDMLIVCLDAGMSIEAAANRVAREFVDKQ 196

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
                 + + + E+      + A  N   R ++D  R  +    QS+  GTS+  +LRV 
Sbjct: 197 QDFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARALSVLFRQSEELGTSVTQTLRVY 256

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             E R  R++ AE+KA +L  K+ +P+  F  PV + +
Sbjct: 257 SKEMRDIRVVRAEEKANALPVKMLLPLGAFLFPVSLFI 294


>gi|29829793|ref|NP_824427.1| hypothetical protein SAV_3251 [Streptomyces avermitilis MA-4680]
 gi|29606902|dbj|BAC70962.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 301

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 100/210 (47%), Gaps = 13/210 (6%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG     +LN     R V  I  ++LG+I++     L        +G +      G  A 
Sbjct: 87  AGNPGGLTLNRYAARRAVYGIFGVVLGLIFLTNGHPLFA------LGTLAF----GLLAA 136

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
              I   V++R+  I R  PD LD+L + V +G+   QAL RVAE   G   P ++E+ +
Sbjct: 137 DALIWQAVRERKDVIDRTLPDFLDVLAVVVSAGLGFRQALDRVAEKYEG---PWADELRI 193

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AF+    R   + V     AL Q +  G+ I ++L  L ++ R    
Sbjct: 194 TLRQMDMGVSRRQAFDELRKRNSSEQVAQFVSALQQGEELGSPIAETLIQLATDMRRTDA 253

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A ++AA   PK T+  ++F LP  +++I
Sbjct: 254 QNARRRAAKTIPKATMVTLVFMLPATMILI 283


>gi|260778157|ref|ZP_05887050.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606170|gb|EEX32455.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 284

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 93/155 (60%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           V + +  I +  PDALDL+++CV SG++++   R V E++   S  L+ E  LT  E+S 
Sbjct: 127 VNQIRQEISKVAPDALDLMVVCVASGLTLENTFRVVGEEMTSVSPALAREWALTATEMSV 186

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
           L + Q A +N   R ++  + N    + Q+ ++GT +  +L ++ S++R  +L++ E+  
Sbjct: 187 LDSPQQALQNLDQRLELPDINNMVVTMSQALQFGTPLSQALSLIASDSRQYQLLDLEEWV 246

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             +  K++ P+++F +  ++++I+ P +LS+ +T+
Sbjct: 247 GKIPAKMSFPLVVFIMLPVVVMIVAPVVLSLFNTL 281


>gi|320008843|gb|ADW03693.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 295

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 5/174 (2%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A+ +I + G     V I   V+KR+  I R  PD LD+L + V +G+   QAL RVAE  
Sbjct: 119 ALFMIAF-GLFWGEVGIWAAVRKRRDDIDRTLPDFLDVLAVVVSAGLGFRQALDRVAEKY 177

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   P S+E+ +T+ ++    +R+ AF+    R   + V     AL Q +  G  I D+
Sbjct: 178 QG---PWSDELRITLRQMDMGVSRRQAFDELRRRNDSEQVAMFVTALQQGEELGAPIVDT 234

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           L  + ++ R      A +KAA   PK T+ +  F +P   ++++G A+L   DT
Sbjct: 235 LIAIANDMRRTDAQNARRKAAKAVPKATLMVTTFMIPA-TMILMGAAMLLGSDT 287


>gi|51891530|ref|YP_074221.1| hypothetical protein STH392 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855219|dbj|BAD39377.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 289

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 108/223 (48%), Gaps = 24/223 (10%)

Query: 103 RAAGFRSE--YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           R AG  +E  Y L ++L   L +P++ L        G+             A  L   +G
Sbjct: 83  RPAGIGAEEFYFLQLVLAFSLALPLLGL-------HGWT------------AAALGFLLG 123

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P  W+   V +R   ++R  P  + LL  C+E+G+ + +A+RRVA +  G    L+ 
Sbjct: 124 LWLPRAWLRRRVSERTRILRRELPRFVHLLATCLEAGLGLTEAVRRVAAESPGL---LAG 180

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           EML  + E++     Q A+ +   R +   ++    AL QS R+G SI + LR  +   R
Sbjct: 181 EMLRAVHEMAAGKPAQRAWRDLTERHESPELKEVVSALQQSHRWGVSIAEQLRFTLRTMR 240

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             +  +A++KA     ++ VPM+   L   I++I+GPA+L ++
Sbjct: 241 ERKQQQAQQKAHEASVRMRVPMVALILMPTIVIILGPAVLRLL 283


>gi|283769336|ref|ZP_06342235.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
 gi|283103993|gb|EFC05377.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
          Length = 313

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 158/318 (49%), Gaps = 19/318 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVA-VEREILRKQQITSLQKDSASSRL 72
           L ++++T + ++S+I    +       L  ++K +A  E  + R       +  S  SR+
Sbjct: 8   LLISVSTGLFVYSMILVKFVNE--RTHLRLQLKDIAETENSLRRNSDDMDFENKSFYSRV 65

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVN-KLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                + L  F+ ++       D++ +N +L  AG R +      L +R++V  + +I  
Sbjct: 66  IFPGIERLSLFIGRV-FPIAQKDQDKLNLQLLQAGLRIK--AQTYLTIRILVIAVCMIFT 122

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            I+I  Y     +   +     IL GY+        +++ V +RQ+ +++  P  LDLL 
Sbjct: 123 YIYIGPYHLYFGFSVMMSALGGILSGYI---ISRFVLASRVTRRQNLLEKQLPGFLDLLS 179

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CVE+G+  DQA++ V  +  G+   LS+E  +   ++S    R+ A  +   R     +
Sbjct: 180 VCVEAGLGFDQAIQYVCHEYKGE---LSDEFKVVQRDISLGSTRKQALMSLCQRVTSSQM 236

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLM---EAEKKAASLGPKLTVPMIIFFLP 308
              T A++Q+D  G S+ +   +L +++R+ RL    + E+KA  L  K+ +PM+IF  P
Sbjct: 237 TTFTAAVLQADEMGISLKN---ILNAQSRNVRLAYKNKIEEKAQKLSTKILIPMLIFIFP 293

Query: 309 VLILVIIGPAILSIIDTM 326
           V+ ++++GPA+  I+  +
Sbjct: 294 VIFIILLGPAVPGIMKAL 311


>gi|187921509|ref|YP_001890541.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719947|gb|ACD21170.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 293

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 91/175 (52%), Gaps = 4/175 (2%)

Query: 152 AVILIGY--VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           A++L+G   +G+  P +W  ++ ++R + I +  P  LD L + VE+G++I+ A+++  E
Sbjct: 117 ALVLLGVAVLGYFYPRIWTRDVRRRRVARILKHLPIYLDFLTLAVEAGLNINGAIQKAVE 176

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              G   PL  E    + +L    NR  A     +R ++  V N    ++Q++R G+ + 
Sbjct: 177 K--GPEGPLRWEFEHVLRDLKSGLNRMEALYRMDDRLRIKEVTNLVGTVVQAERMGSGLS 234

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            SLR    + RSER   AEK+A     KL  P+++F  P+  +V+  P  +  + 
Sbjct: 235 KSLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLVFIFPITFIVLGFPIAMKFVQ 289


>gi|330830427|ref|YP_004393379.1| Flp pilus assembly protein TadC [Aeromonas veronii B565]
 gi|328805563|gb|AEB50762.1| Flp pilus assembly protein TadC [Aeromonas veronii B565]
          Length = 294

 Score = 80.5 bits (197), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 97/176 (55%), Gaps = 3/176 (1%)

Query: 154 ILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +L+ YV G   P  W+    +K +++ ++  PDA+DLL+I VE+G+++D+AL RV   + 
Sbjct: 120 VLMAYVVGAGLPERWLQWRARKVKAAQQKVVPDAIDLLVISVEAGLALDRALLRVGHYLE 179

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+ + L T AE+    ++         RT +  +      L  + +YG+ + +++
Sbjct: 180 ALEPGLARQFLRTHAEIQMRGDQASCLARLAWRTGLPELDRLANTLQMAQQYGSPLAETM 239

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLT-VPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R +  E R  R +  E++A SL  K+T + M +  LP+L+L II P +  +I++++
Sbjct: 240 RTISQEARQMRRLALEEQAGSLPGKITLIQMALIMLPMLVL-IIAPTLNLLINSLR 294


>gi|302521640|ref|ZP_07273982.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|318057612|ref|ZP_07976335.1| hypothetical protein SSA3_06724 [Streptomyces sp. SA3_actG]
 gi|318080452|ref|ZP_07987784.1| hypothetical protein SSA3_28136 [Streptomyces sp. SA3_actF]
 gi|302430535|gb|EFL02351.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 300

 Score = 80.5 bits (197), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 86/163 (52%), Gaps = 4/163 (2%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A + +G+ G  A    I   V++R+  I R  PD LD+L + V +G+   QAL RVAE  
Sbjct: 124 AFLALGF-GLVAADATIWQAVRERRDVIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKY 182

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   P ++E+ +T+ ++    +R+ AF+    R   + V     AL Q +  G+ I ++
Sbjct: 183 EG---PWADELRITLRQMDMGVSRRQAFDELRRRNNSEQVAQFVSALQQGEELGSPIAET 239

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           L  + ++ R     +A ++AA   PK T+  ++F LP  +++I
Sbjct: 240 LIQIANDMRRTDAQQARRRAAKTIPKATMVTLVFMLPATMILI 282


>gi|293604635|ref|ZP_06687037.1| type II secretion system protein F domain protein [Achromobacter
           piechaudii ATCC 43553]
 gi|292816966|gb|EFF76045.1| type II secretion system protein F domain protein [Achromobacter
           piechaudii ATCC 43553]
          Length = 236

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 89/176 (50%), Gaps = 2/176 (1%)

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
           L+ P Q  +   + IG V   AP   +  L +KR+ SI+R  P   D++ +CVE+G+S+ 
Sbjct: 53  LDVPIQRGLLWSMAIGLVASMAPRASLHGLSEKRRRSIERDLPFVFDMMTLCVEAGLSVQ 112

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            AL++ A+   G    L + +   +AE+     R  A +   +R+     +    AL Q+
Sbjct: 113 GALQQAAQS--GPKGALRDALAQALAEMRAGVTRMDAIKALADRSNSPVAKTWAGALAQA 170

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +  G S+G  LR   ++ RS+R + AE++A     K+ +P+I    P   +V+  P
Sbjct: 171 EALGISLGPVLRAQAAQCRSDRHVRAEQQAMQAPVKMLLPLIGCIFPCTFIVLAFP 226


>gi|264680614|ref|YP_003280524.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262211130|gb|ACY35228.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 317

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 114/237 (48%), Gaps = 9/237 (3%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           KA++  E+ +  L   G+ S  +    L+ R ++ ++F +L      G  + L Y F   
Sbjct: 85  KALVAQEDRI-LLSKCGWGSTRAQLQYLIARCLISVLFSLLAAFVFLGSKQFLLYLFAAF 143

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
                    +GF  P   + ++ ++R++ + R  P  +DLL +   +G+S+DQ L+ +  
Sbjct: 144 T--------IGFLLPKWVLRSVARRRRACVARELPLFVDLLGLLQGTGMSLDQTLQVIGS 195

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           D G     LS E+ L   + S    R+ +F       Q D + N T  +IQ DRYG ++ 
Sbjct: 196 DFGNVMPVLSREIQLANQQYSRGSTRERSFGRMSEVYQNDNLANLTSLMIQIDRYGGAVQ 255

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           + LR+     R +R  + ++    +  K+T  M++  LP LI++  GP  L++I  +
Sbjct: 256 EPLRIFGERLREQRKAKMKELIGKISVKMTAVMVVTLLPALIIITAGPGFLAVIRAL 312


>gi|332970974|gb|EGK09948.1| hypothetical protein HMPREF9374_2751 [Desmospora sp. 8437]
          Length = 306

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 113/238 (47%), Gaps = 10/238 (4%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           N++ +   E + + L  AG     +++ L   ++V  I   I G+++      L   PF 
Sbjct: 70  NIELLSDPEELKDDLIKAGHPYGLTVDRLQGAKVVFAIGGTIFGLLYFL--IGLPLAPFA 127

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           +  G ++     G+  P   +    QKRQ  I+   PD +D++ I +++G+++D AL   
Sbjct: 128 VAFGPLL-----GYLFPIYMVKFKAQKRQEEIQYELPDFMDMMSITLQAGMALDTALDYY 182

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
                G   PLSEE+     E+SF   R+ A+    +RT    +    Q++IQ+   GT 
Sbjct: 183 VSTNNG---PLSEEIARMNQEISFGVQRETAYRALIDRTDSTELETLVQSMIQAHNLGTP 239

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           I ++  +   E R+ R  +A+++A    PK++    +   P ++L++ G  IL    T
Sbjct: 240 ISETFALQAMEMRNMRAEKAKEQAGKSEPKISAVAGLVITPSIMLLVFGAFILKFFFT 297


>gi|329943876|ref|ZP_08292147.1| bacterial type II secretion system protein F domain protein
           [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328531582|gb|EGF58418.1| bacterial type II secretion system protein F domain protein
           [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 292

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 100/197 (50%), Gaps = 15/197 (7%)

Query: 127 FLILGII---WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           F++LGII   + F  D+L+     + VG  +L+ +       VW++N   +R   I R  
Sbjct: 101 FVVLGIIVLLFCFLIDELI-----IGVGLGLLLAFW----MQVWLTNTGLRRSQQIDRDL 151

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD LD+L + V SG+S   A+ RV+    G   PL+EEM   I  +     R+ AF    
Sbjct: 152 PDFLDVLSVTVRSGMSFRPAVERVSSFHEG---PLAEEMRGAIYSMRLGVTRRDAFIAAR 208

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           + ++ + V     A +Q++  GT + D+L  + SE R ER  +  + AA   PK+ + + 
Sbjct: 209 DNSRSENVAIFVSAFLQAEELGTPLADALVDISSEIRRERAQQVRRAAARAQPKIAIVVT 268

Query: 304 IFFLPVLILVIIGPAIL 320
              LP  +++I+G  IL
Sbjct: 269 TMILPATLILILGSMIL 285


>gi|329935278|ref|ZP_08285244.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
 gi|329305101|gb|EGG48960.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
          Length = 296

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 79/155 (50%), Gaps = 3/155 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G  A    I   ++ R+  I R  PD LD+L + V +G+   QAL RVAE   G   P +
Sbjct: 127 GLLAADALIWQAIRDRKDVIDRTLPDFLDVLAVVVSAGLGFRQALDRVAERYEG---PWA 183

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+ +T+ ++    +R+ AF+    R   + V     AL Q +  G+ I D+L  L ++ 
Sbjct: 184 DELRITLRQMDMGVSRRQAFDELRRRNTSEQVAQFVSALQQGEELGSPIADTLIQLATDM 243

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           R      A ++AA   PK T+  ++F LP  +++I
Sbjct: 244 RRTDAQNARRRAAKTIPKATMVTLVFMLPATMILI 278


>gi|297192377|ref|ZP_06909775.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197723022|gb|EDY66930.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 296

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 33/206 (16%)

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           +  +L+   +V+ ++FL+ G+ W                               V +   
Sbjct: 108 AFGMLMNGHVVLAVLFLLYGLFWT-----------------------------DVLLRAA 138

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           + +R+  I+R  PD LD+L + V +G+   QAL RVAE   G   P S+E+ +T+ ++  
Sbjct: 139 IARRRDDIERTLPDFLDVLAVVVSAGLGFRQALERVAEKYAG---PWSDELRITLRQMDM 195

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
              R+ AFE    R + + V     AL Q +  G  I D+L  + ++ R      A +KA
Sbjct: 196 GMGRREAFEQLRRRNESEQVSMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARRKA 255

Query: 292 ASLGPKLTVPMIIFFLP-VLILVIIG 316
           A   PK T+ +  F LP  +IL++ G
Sbjct: 256 AKAVPKATLIVTSFMLPGTMILIVAG 281


>gi|149175458|ref|ZP_01854079.1| hypothetical protein PM8797T_18379 [Planctomyces maris DSM 8797]
 gi|148845726|gb|EDL60068.1| hypothetical protein PM8797T_18379 [Planctomyces maris DSM 8797]
          Length = 370

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 113/225 (50%), Gaps = 4/225 (1%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
            +L+AAG+   ++L+    +R +  +  L+     +    +  E P  +   A++++  +
Sbjct: 127 KELQAAGYYQPHALHNFSAIRFISILGTLLFFGGVLLLAPERFEIPILV---AMLIVPIL 183

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
            +  P + +++    R+S I++  PD LD+L +CV  G+++  AL+++  ++      L+
Sbjct: 184 VWAVPFLIVTSKASDRRSEIEQGIPDMLDMLNMCVSQGMTVPHALKKIISELAKVYPALA 243

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E+ + I + S     Q A  NF  R  +  V +    LIQ+D+ GT++  +L+      
Sbjct: 244 HELKIVIEQSSIGTFSQ-ALSNFSKRIDVPEVHSFAALLIQTDQMGTNVTSALQEYSDNM 302

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R      A++KA     KL  P ++  +P + + ++GPAI+ + D
Sbjct: 303 RESLSQRADEKANKATFKLLFPTVLCLMPAIYIFLLGPAIVELSD 347


>gi|295836764|ref|ZP_06823697.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|295826195|gb|EFG64730.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 300

 Score = 79.0 bits (193), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 82/150 (54%), Gaps = 5/150 (3%)

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           ++W    V++R++ I R  PD LD+L + V +G+   QAL RVAE   G   P ++E+ +
Sbjct: 138 TIW--QAVRERRAVIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKYEG---PWADELRI 192

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AF+    R   + V     AL Q +  G+ I ++L  + ++ R    
Sbjct: 193 TLRQMDMGVSRRQAFDELRRRNNSEQVAQFVSALQQGEELGSPIAETLIQIANDMRRTDA 252

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            +A ++AA   PK T+  ++F LP  +++I
Sbjct: 253 QQARRRAAKTIPKATMATLVFMLPATMILI 282


>gi|222111305|ref|YP_002553569.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221730749|gb|ACM33569.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 288

 Score = 79.0 bits (193), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 87/166 (52%), Gaps = 4/166 (2%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR-VAEDI 211
           +++I  + F  P +W+    ++R  +I +A P  +DLL + +E+G+++  A+++ VA+  
Sbjct: 116 IVVIAMLAFFYPDLWLKETTKQRNLAILKALPFFIDLLTLSIEAGLNLSGAMQQAVAKSA 175

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           GG   PL  E+   + ++     R  A  +F  R     + +   AL+Q ++ G+S+G  
Sbjct: 176 GG---PLMVEINRVLRDVRAGKARIDALRDFSARLDFTPITSFVSALVQGEKTGSSLGPI 232

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LR    + R+ER + AEK A     K+  P+I F  P   +VI  P
Sbjct: 233 LRAQAEQRRTERFLRAEKLAMEAPVKMLGPLIFFIFPCTFIVIGFP 278


>gi|218676254|ref|YP_002395073.1| putative Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
 gi|218324522|emb|CAV26000.1| putative Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
          Length = 288

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 126/250 (50%), Gaps = 5/250 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           TR+ K  ++ +K +  +          KL AAGF S++  +   +++++   + L+L  I
Sbjct: 43  TREEKKRKDLLKAVLSQISFNKIETKRKLVAAGFYSDFLADAYYLLKIIPFSVCLVL--I 100

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
               Y+   E  F L      L+ ++   AP  ++S   +     I    P  LDL+ +C
Sbjct: 101 GFDFYNGETEVIFALLYLLGALLAFI--IAPDSYVSARGKANIKHISSRLPFLLDLMNVC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G++I+ +L  +A+++      L+  + +T+ E S L   + A E FY        ++
Sbjct: 159 VHTGMTIESSLEYLAKELHSVDSNLAHVVRVTV-ERSRLVGLEKALEEFYELVPTSESQS 217

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               ++QS ++G+S+G  L  L ++ R   +M+ E++   +G K+++P+I F +  ++++
Sbjct: 218 FVMTMVQSLQFGSSVGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVVL 277

Query: 314 IIGPAILSII 323
           I  P IL ++
Sbjct: 278 IAAPGILRML 287


>gi|89100216|ref|ZP_01173083.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
 gi|89085066|gb|EAR64200.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
          Length = 312

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 110/222 (49%), Gaps = 10/222 (4%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           LR AG   E ++      ++V  II  I G+  +     LL  P  L   A + +   GF
Sbjct: 89  LRKAGNPFEMTVGRFQGFKIVCVIIGFIAGLFAV-----LLGLP--LSNIAFVTLPIFGF 141

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P + + +  +KRQ  ++   PD LD + + +++G ++D AL+ V +   G   P+ EE
Sbjct: 142 FVPILLVRSKAKKRQQQLRSDLPDFLDTVSVSLQAGSNMDSALKEVIKYFSG---PIKEE 198

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
             + + E+     R+ A+     R   +  ++  ++LIQ+ R G  +  +L+    + R 
Sbjct: 199 FSIFLQEIDLGVPREKAYGGLLERNDNEEFQSFIKSLIQATRLGVPMASTLKSQAEDIRK 258

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             L + ++KAA   PK+T+       P+++L+IIG  +L++I
Sbjct: 259 ISLEQVKEKAAKASPKVTMITSFIIAPLIMLLIIGLVLLNMI 300


>gi|323493929|ref|ZP_08099046.1| putative Flp pilus assembly protein TadC [Vibrio brasiliensis LMG
           20546]
 gi|323311870|gb|EGA65017.1| putative Flp pilus assembly protein TadC [Vibrio brasiliensis LMG
           20546]
          Length = 288

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 125/250 (50%), Gaps = 5/250 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           TR+ +   + VK    +     E    KL AAGF S+Y  ++  +++ ++P   L L +I
Sbjct: 43  TREERKRVDLVKTALSQFSFNKEETRKKLVAAGFYSDYLADVYYLMK-IIPFT-LCLALI 100

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
               +    E  F L      L  ++    P  ++++  +     I    P  LDL+ +C
Sbjct: 101 GFDYFKGETEIAFSLLYLLGALGLFI--IGPDAFVASRGKANTKHISSRLPFLLDLMNVC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G++I+ +L  +++++      L+  + +T+ + S L   + A E FY+       ++
Sbjct: 159 VHTGMTIESSLDYLSKELVTVDRNLAYVVRVTV-DRSRLVGLEKALEEFYDLVPTSESQS 217

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               ++QS ++G+SIG  L  L ++ R   +M+ E++   +G K+++P+I F +  ++++
Sbjct: 218 FVMTMVQSLQFGSSIGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVVL 277

Query: 314 IIGPAILSII 323
           I  P IL ++
Sbjct: 278 IAAPGILRML 287


>gi|312883313|ref|ZP_07743039.1| putative Flp pilus assembly protein TadC [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368929|gb|EFP96455.1| putative Flp pilus assembly protein TadC [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 288

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 134/271 (49%), Gaps = 28/271 (10%)

Query: 69  SSRLRTRDSK-SLRNFVKKLNLKAILV--------DENIVNKLRAAGFRSEYSLNILLVV 119
           S +L+ + SK +L NF ++ N   I           +++  +L +AGF     L +   +
Sbjct: 29  SMKLKVKISKLTLNNFHEEKNKNKIFYIISRINYDKDDLEKRLFSAGFYHPMILKLYYPL 88

Query: 120 RLVVPIIF-------LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           + ++  +F        I+GII +  YD      F   V +V +I    F  P   I   +
Sbjct: 89  KYIIMFLFSVCILISFIVGIISL--YDL-----FLYNVISVFMI----FFIPDKIIGLRI 137

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           +    +I    P  LDL+ +CV +G++I+ +L  +A+++      L+  + LT+ E + +
Sbjct: 138 KSNIKNISSRLPFLLDLMNVCVHTGMTIESSLEYLAKELQMVDRQLARVVTLTV-ERAKI 196

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
                A + FY+       ++    L+QS ++G+S+G  L  L  + R   +M+ E+K  
Sbjct: 197 VGLDKALQEFYDLVPTSESQSMVMTLVQSLQFGSSVGAVLSTLSKDIRELNMMDIEEKIG 256

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            +G K+T+P+++F +  ++++I+ P ++ ++
Sbjct: 257 KMGAKMTMPLVVFIMIPMLVLIVAPKVMRVM 287


>gi|261251276|ref|ZP_05943850.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
 gi|260938149|gb|EEX94137.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
          Length = 288

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 124/250 (49%), Gaps = 5/250 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           TR+ +   + VK    +     E    KL AAGF S+Y  ++  +++ ++P   L L +I
Sbjct: 43  TREERKRIDLVKTALSQFSFNKEETRKKLVAAGFYSDYLADVYYLMK-IIPFT-LCLALI 100

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
               +    E  F L      L  ++    P  +I++        I    P  LDL+ +C
Sbjct: 101 GFDYFKGETEVAFSLLYLLGALGLFI--IGPDAFIASRGNANTKHISSRLPFLLDLMNVC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G++I+ +L  +++++      L+  + +T+ + S L   + A E FY+       ++
Sbjct: 159 VHTGMTIESSLDYLSKELVTVDRNLAYVVRVTV-DRSRLVGLEKALEEFYDLVPTSESQS 217

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               ++QS ++G+SIG  L  L ++ R   +M+ E++   +G K+++P+I F +  ++++
Sbjct: 218 FVMTMVQSLQFGSSIGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVVL 277

Query: 314 IIGPAILSII 323
           I  P IL ++
Sbjct: 278 IAAPGILRML 287


>gi|148657456|ref|YP_001277661.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148569566|gb|ABQ91711.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 309

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 96/177 (54%), Gaps = 8/177 (4%)

Query: 153 VILIGYVGFCA---PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           ++L+G +GFCA   P VW+S  +++RQ+ +  A PDALDLL I   +G+S + A++ +  
Sbjct: 133 LLLLGGIGFCAFFLPDVWLSRRIRQRQTELLNALPDALDLLAIASAAGLSFESAMQEITS 192

Query: 210 DIGGQSVPLSEEMLLTIAELSF-LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
               +   L+ E    + ++S  +P RQ A  +   RT +  + +   A+ Q++  G SI
Sbjct: 193 KWTNE---LAREFSRVLRDMSMGVPRRQ-ALTDMAERTGVSDIASFVSAVKQAEALGISI 248

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           G  L V   E R+ R   A+++A     K+  P++    P +  V++GPA+  +++ 
Sbjct: 249 GRVLTVQADEMRTRRRQRAQERANQAPVKMMFPLVFLIFPAIFAVLLGPAVPQLLEA 305


>gi|37676258|ref|NP_936654.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37200799|dbj|BAC96624.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 292

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 117/244 (47%), Gaps = 9/244 (3%)

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           S++K   S++ + +      +F K+ +      DE    KL AAG  S++      + + 
Sbjct: 37  SVRKIIGSTKEQQKRDDLFLSFFKRFSFNK---DET-KKKLVAAGVYSDFIAQTYYLFK- 91

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++P+   IL  +++   + L      L +   ++I  VG   P ++IS+        I  
Sbjct: 92  IIPLFLTILISVYLMSIEVLDTNELILTIALGMVIFVVG---PDMYISSRANSITRHISS 148

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  LDL+ +CV +G++I+  L  +A ++      L+  + +T+     +   + A E 
Sbjct: 149 RLPFLLDLMNVCVHTGMTIEATLEYLANELQTVDKYLAFTVNVTVQRSKVIGINK-ALEE 207

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           FY        ++    LIQS ++G+S+G  L  L ++ R   +ME E+K   LG K+++P
Sbjct: 208 FYEMVPSSEAQSFVMTLIQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIP 267

Query: 302 MIIF 305
           MI+F
Sbjct: 268 MIVF 271


>gi|13475422|ref|NP_106986.1| hypothetical protein mlr6486 [Mesorhizobium loti MAFF303099]
 gi|14026174|dbj|BAB52772.1| mlr6486 [Mesorhizobium loti MAFF303099]
          Length = 305

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 79/148 (53%)

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           LIG      PS+ +     +++   +R +PD +D+++ C ++G+S++ A+ RV  ++ G 
Sbjct: 133 LIGLGCLVIPSIALDRFESRQKQVYRRGFPDFMDMMITCADAGMSLEAAVERVGAELAGT 192

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              L  ++ +   +L      + A     +R  +D  R       QS+  GTS+ D+LR+
Sbjct: 193 HKWLGIQLSIVTLQLRAGKPLREALRELADRIGLDEARALAVLFRQSEELGTSLTDALRI 252

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPM 302
              E R++R+M AE++A +L  K+ +P+
Sbjct: 253 YSDEMRTQRIMNAEERANALPVKMMIPL 280


>gi|330819179|ref|YP_004348041.1| type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327371174|gb|AEA62529.1| type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 293

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 2/165 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P +W+ ++ + R  +I++  P  LD L + VE+G++I+ A+++  E   G    L 
Sbjct: 127 GYSYPRIWVRDVRRARVVAIRKQLPVYLDFLTLAVEAGLNINGAIQKAVEK--GPDGALR 184

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E    + +L    NR  A   F  R  +  + N   A+IQ++R G+ +  +LR    + 
Sbjct: 185 SEFEHVLRDLKSGLNRADALRRFDERQDIKEITNFVGAVIQAERMGSGLAGTLRFQSEQR 244

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           R+ER   AEK A     KL  P+++F  PV  +V+  P  +  + 
Sbjct: 245 RAERFQRAEKLAMEAPVKLVFPLMMFIFPVTFVVLGFPIAMRFVQ 289


>gi|326424177|ref|NP_762076.2| type II/IV secretion system protein TadC [Vibrio vulnificus CMCP6]
 gi|319999560|gb|AAO07066.2| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus CMCP6]
          Length = 292

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 117/244 (47%), Gaps = 9/244 (3%)

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           S++K   S++ + +      +F K+ +      DE    KL AAG  S++      + + 
Sbjct: 37  SVRKIIGSTKEQKKRDDLFLSFFKRFSFNK---DET-KKKLVAAGVYSDFIAQTYYLFK- 91

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++P+   IL  +++     L      L +   ++I  VG   P ++IS+        I  
Sbjct: 92  IIPLFLTILISVYLMSIKVLDTNELILTIALGMVIFVVG---PDMYISSRANSITRHISS 148

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  LDL+ +CV +G++I+  L  +A+++      L+  + +T+     +   + A E 
Sbjct: 149 RLPFLLDLMNVCVHTGMTIEATLEYLAKELQTVDKYLAFTVNVTVQRSKVIGINK-ALEE 207

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           FY        ++    LIQS ++G+S+G  L  L ++ R   +ME E+K   LG K+++P
Sbjct: 208 FYEMVPSSEAQSFVMTLIQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIP 267

Query: 302 MIIF 305
           MI+F
Sbjct: 268 MIVF 271


>gi|281356958|ref|ZP_06243448.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281316516|gb|EFB00540.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 292

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 82/165 (49%), Gaps = 6/165 (3%)

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV--PLSEEM 222
           S+W+S  ++ R  SI +A P+ LDLL++ VESG  I  ALR    DI  +    PL EE+
Sbjct: 130 SMWLSMRIKARHLSIMKALPNVLDLLMLSVESGRDIVSALR----DILARRRMDPLGEEL 185

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
                ++     R  A  +   R +   +     A++Q++  G SI   LRV     R++
Sbjct: 186 TRAFRQMQLGRKRADALRDMAQRVRQPDLTTTVNAIVQAEELGVSIVQLLRVQGDMQRNK 245

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R   AEK A     K+  P++   LP +++VI GP  L ++   +
Sbjct: 246 RFSLAEKLANEAAVKIIFPVVFCILPSVLIVIFGPLALQVLQMFR 290


>gi|319795559|ref|YP_004157199.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598022|gb|ADU39088.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 295

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 90/179 (50%), Gaps = 2/179 (1%)

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +V   ++   +G+  P +W+ +  +KR+ +I R  P  LD++ +C ++G+S+  A+ +  
Sbjct: 119 KVWVTLMSCAMGWYYPVMWMRDRRKKREKNILRTLPGYLDMITLCCQAGLSLTGAIAQAV 178

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +   G ++ +  + ++   E+    +R  A      R     +++    L Q++  G S+
Sbjct: 179 QKGPGGALGIEFDRMMR--EMRTGVSRMDALNAMAERLDNKHIKSLVSNLTQAESLGASL 236

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            D+L  +  + R+ER   AEK A     K+  P++IF  PV  ++I  P ++  + T +
Sbjct: 237 ADTLSAISDQRRTERFQHAEKLAMEAPVKMIGPLVIFIFPVTFIIIFFPLVMQFLQTQR 295


>gi|299532823|ref|ZP_07046210.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719047|gb|EFI60017.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 311

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 87/168 (51%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   + ++  +R++S+ R  P  +DLL +   +G+S+DQ L+ +  D G     L
Sbjct: 139 IGFLLPKWVLRSVAGRRRASVARELPLLVDLLGLLQGTGMSLDQTLQVIGSDFGNVMPVL 198

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S E+ L   + S    R+ +F       Q D + N T  +IQ DRYG ++ + LR+    
Sbjct: 199 SREIKLANQQYSRGSTRERSFGRMSEVYQNDNLANLTSLMIQIDRYGGAVQEPLRIFGER 258

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R +R  + ++    +  K+T  M++  LP LI++  GP  L++I  +
Sbjct: 259 LREQRKAKMKELIGKISVKMTAVMVVTLLPALIIITAGPGFLAVIRAL 306


>gi|255020083|ref|ZP_05292154.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970445|gb|EET27936.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 337

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%), Gaps = 4/152 (2%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P +W+    ++RQ  I +  P  LD + + VE G+++  A++ +A D G +  PL  E  
Sbjct: 175 PDLWLVEQAKRRQKRILKDLPVYLDFITLMVEGGLNLTGAIQ-IAVDKGPEG-PLRNEFR 232

Query: 224 LTIAEL-SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
           + + +L S +P  +V F  F +R  M  +R+   A+IQ++  G S+   L+    + R E
Sbjct: 233 IILRDLRSGMPRVEV-FRRFGDRVAMQELRSLVTAIIQAEERGGSLAPVLKAQAEQRREE 291

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           R + AEK A     KL  P+I+F  P++ +V+
Sbjct: 292 RFLRAEKAALEAPVKLLAPLIMFIFPIVFIVL 323


>gi|218708112|ref|YP_002415733.1| putative bacterial type II secretion system protein [Vibrio
           splendidus LGP32]
 gi|218321131|emb|CAV17081.1| putative bacterial type II secretion system protein, TadC-like
           protein [Vibrio splendidus LGP32]
          Length = 301

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 89/160 (55%), Gaps = 1/160 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + +S++ + RQ  I R  P  +DL+ ICV++G++I+ +++ ++ ++      LS  +L
Sbjct: 140 PDLVLSSMAKNRQRRISRQMPYLIDLMAICVQTGMTIEASMKYLSIEMKSFDKELSS-LL 198

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
               + + L   + A E  Y +     VR+    L QS ++G+SI + L  L  + R  +
Sbjct: 199 EVTNQRARLVGMENALEELYRKVPSPEVRSFVMTLTQSIQHGSSIYNVLTTLAGDIREVQ 258

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           ++E E++   L  K+++P+I+F L  ++ VI  P ++ ++
Sbjct: 259 MLELEEEIGKLAAKMSIPLIVFILIPIVFVIAAPGVMRMM 298


>gi|86147189|ref|ZP_01065505.1| bipartite nuclear localization signal containing protein, TadC-like
           protein [Vibrio sp. MED222]
 gi|85835073|gb|EAQ53215.1| bipartite nuclear localization signal containing protein, TadC-like
           protein [Vibrio sp. MED222]
          Length = 301

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 89/160 (55%), Gaps = 1/160 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + +S++ + RQ  I R  P  +DL+ ICV++G++I+ +++ ++ ++      LS  +L
Sbjct: 140 PDLVLSSMAKNRQRRISRQMPYLIDLMAICVQTGMTIEASMKYLSIEMKSFDKELSS-LL 198

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
               + + L   + A E  Y +     VR+    L QS ++G+SI + L  L  + R  +
Sbjct: 199 EVTNQRARLVGMENALEELYRKVPSPEVRSFVMTLTQSIQHGSSIYNVLTTLAGDIREVQ 258

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           ++E E++   L  K+++P+I+F L  ++ VI  P ++ ++
Sbjct: 259 MLELEEEIGKLAAKMSIPLIVFILIPIVFVIAAPGVMRMM 298


>gi|258620798|ref|ZP_05715833.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|258624768|ref|ZP_05719699.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|262173889|ref|ZP_06041566.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
 gi|258582930|gb|EEW07748.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|258586996|gb|EEW11710.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|261891247|gb|EEY37234.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
          Length = 291

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 120/251 (47%), Gaps = 13/251 (5%)

Query: 74  TRDSKSLRNFVKKL-NLKAILVDENIVNKLRAAGFRSEY---SLNILLVVRLVVPIIFLI 129
           TR+ K+   FV  L N+ +   DE    KL  AG  +++   S  +  ++   +   F I
Sbjct: 44  TREEKNRFEFVYSLLNMVSFNQDET-KKKLVKAGIYNQFIARSYYLFKIIPFGLCAFFSI 102

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           L   ++ G          L +GA++ +       P ++I+   +K    I    P  LDL
Sbjct: 103 LA--FLSGKTDETMLVVSLAIGAIVFL-----LGPDMYIAARGKKITKKISSRLPFLLDL 155

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + +CV +G++I+  L  +A ++      L+  +  T+ E S L   + A   FY+     
Sbjct: 156 MNVCVHTGMTIEACLEYLAFELRTVDHHLAYVVKKTV-ERSKLVGLEKALNEFYDLVPTA 214

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
             ++    + QS +YG+SIG  L  L S+ R   +M+ E+K   +G K+++P+I F +  
Sbjct: 215 EAQSFVMTMTQSLKYGSSIGPVLATLASDIREMNMMDLEEKIGKMGAKMSIPLIAFIMVP 274

Query: 310 LILVIIGPAIL 320
           +I++I  P I+
Sbjct: 275 IIILIAAPGIM 285


>gi|226310159|ref|YP_002770053.1| hypothetical protein BBR47_05720 [Brevibacillus brevis NBRC 100599]
 gi|226093107|dbj|BAH41549.1| conserved hypothetical membrane protein [Brevibacillus brevis NBRC
           100599]
          Length = 311

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 145/313 (46%), Gaps = 18/313 (5%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           I T V +F L++A+ +       +EK+ K +A   E+   +     +++++S RL  R  
Sbjct: 5   IITCVFLFLLLFAICLKEWYRYSIEKQ-KLLAHVHEMSGHKNYGVRKQETSSERLVKRLL 63

Query: 78  KSLRNFV---KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           +   ++    +++N  +      + + L  AG   + ++     V++ + ++ +I G ++
Sbjct: 64  RYGDDYAVMGQRINFFS--ESHEVEDWLLRAGRPLDLTVAQFQGVKIFMALLGIIAGTLF 121

Query: 135 IFGYDKLLEYPF-QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                 +L +PF  L + A  LIGY     P + +    + RQ  ++   P+ LD + + 
Sbjct: 122 F-----ILRFPFSHLGLIAWPLIGYF---LPILLLKKKARDRQHQLRYDLPEFLDTVSVT 173

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           +++G+S+DQALR V +   G   P+ EE      EL     R+ A+E    R      + 
Sbjct: 174 LQAGVSLDQALREVIKFFDG---PIREEFSRFNQELDLGVQREKAYEQLLRRNDNPEFQM 230

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             +ALIQ  R G  I  + +      R  R    ++KAA   PK+T+       P  I++
Sbjct: 231 LIKALIQGMRLGVPIAVTFKAQAENMRRIRKELIKEKAAKASPKVTLITTFIVTPTAIIL 290

Query: 314 IIGPAILSIIDTM 326
           I G  +L+I+D  
Sbjct: 291 IGGLMVLNILDNF 303


>gi|261856881|ref|YP_003264164.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837350|gb|ACX97117.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 298

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 80/152 (52%), Gaps = 2/152 (1%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++L   +G+  PS+W++   + RQ  + +  P  LD +++ VE+G++I   + +    + 
Sbjct: 125 LVLGAVLGWLYPSLWLTERRKHRQRLVIKDLPVFLDFIVMAVEAGLNITGGIEQAT--LK 182

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G   PL++E    + ++     R  A +    R  M  + + T  LIQ+DR G S+G SL
Sbjct: 183 GPKGPLAQEFRRLLRDMRSGLARAEALKRMAERMDMPQISSFTGTLIQADRVGASLGASL 242

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RV   + R ER + AEK A     K+ +P+++
Sbjct: 243 RVQADQRREERFLRAEKLALEAPVKMMLPLVM 274


>gi|28900581|ref|NP_800236.1| putative TadC protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365461|ref|ZP_05777998.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|260877526|ref|ZP_05889881.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|260897533|ref|ZP_05906029.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|260901735|ref|ZP_05910130.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|28808961|dbj|BAC62069.1| putative TadC [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087116|gb|EFO36811.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|308090674|gb|EFO40369.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|308108821|gb|EFO46361.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|308114358|gb|EFO51898.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|328470523|gb|EGF41434.1| putative TadC protein [Vibrio parahaemolyticus 10329]
          Length = 288

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 119/246 (48%), Gaps = 12/246 (4%)

Query: 83  FVKKLNL---KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI--LGIIWIFG 137
           FV KL+L   +     E   N L  AG  SE+      +++ ++P++F +  +G  +I G
Sbjct: 49  FVDKLSLHLSRLSFNKEETKNNLVRAGIHSEFIAQAYYLLK-IIPLVFCLAFIGYSYIQG 107

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
                E  F     +  L   V   AP ++IS+        +    P  LDL+ +CV +G
Sbjct: 108 -----EMEFSSAFISFSLSMLVCLIAPDMYISSRGNANVRHVSSRLPFLLDLMNVCVHTG 162

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++++ +L  ++ ++      L+  +  T +E + +     A   FY+       ++    
Sbjct: 163 MTLEASLDYLSNELKTVDENLAYVVKKT-SERAKIVGLDRALTEFYDLVPTTEAQSFVMT 221

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L QS +YG+S+G  L  L S+ R   ++E E+K   +G K+++PMI F +  ++++I  P
Sbjct: 222 LTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSIPMIAFIMIPIVVLIAAP 281

Query: 318 AILSII 323
            I+ ++
Sbjct: 282 GIMRML 287


>gi|255658710|ref|ZP_05404119.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
 gi|260849099|gb|EEX69106.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
          Length = 307

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 85/163 (52%), Gaps = 3/163 (1%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P V+++  +Q+RQ  I+   P+ LDLL + V++G+S D AL ++   + G   P  +E  
Sbjct: 148 PVVFLNTTIQRRQKQIEHQLPEVLDLLCVSVQAGLSFDAALSKITARMKG---PFIDECR 204

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
               ++     R+ A  +  +R  ++ V     ++IQ++R GTS+G +L+      R  R
Sbjct: 205 RMQDDIRMGVVRRTAMRSMADRCGLEDVSLFMTSIIQAERLGTSMGKTLKNQADNIRERR 264

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               + +A     K+  P+++F  P + +V + P++L ++  +
Sbjct: 265 RQYVKAQAMKAPVKIVFPLVLFIFPAIFVVTLVPSLLYLLKNL 307


>gi|262164953|ref|ZP_06032691.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
 gi|262027333|gb|EEY46000.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
          Length = 291

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 89/174 (51%), Gaps = 6/174 (3%)

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
            L +GA++ +       P ++I+   +K    I    P  LDL+ +CV +G++I+  L  
Sbjct: 118 SLAIGAIVFL-----LGPDMYIAARGKKITKKISSRLPFLLDLMNVCVHTGMTIEACLEY 172

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           +A ++      L+  +  T+ E S L   + A   FY+       ++    + QS +YG+
Sbjct: 173 LAFELRTVDHHLAYVVKKTV-ERSKLVGLEKALNEFYDLVPTAEAQSFVMTMTQSLKYGS 231

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           SIG  L  L S+ R   +M+ E+K   +G K+++P+I F +  +I++I  P I+
Sbjct: 232 SIGPVLATLASDIREMNMMDLEEKIGKMGAKMSIPLIAFIMVPIIILIAAPGIM 285


>gi|121607251|ref|YP_995058.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121551891|gb|ABM56040.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 313

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P++W+ + +  R+  + R  P  LD++ +CVE+G+++  A+ +      G    +
Sbjct: 147 LGWFYPAIWLKDRIALRRRELLRMMPFFLDIITLCVEAGLNMHGAIAQAVAK--GPQGTV 204

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
            EE    + ++     R  +  +   R     V     A+IQ++R G ++G  LR    +
Sbjct: 205 REEFQRVLRDVRAGKARTESLRDMAERLNEPGVTQFVMAVIQAERMGMNLGPVLRAQADQ 264

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            RSER + AEK A     K+ +P+I F  P   +V++ P  +  I+T
Sbjct: 265 QRSERFLRAEKLAMEAPVKMLLPLIAFIFPCTFIVLLFPIAMKFINT 311


>gi|238790284|ref|ZP_04634058.1| Flp pilus assembly protein TadC [Yersinia frederiksenii ATCC 33641]
 gi|238721634|gb|EEQ13300.1| Flp pilus assembly protein TadC [Yersinia frederiksenii ATCC 33641]
          Length = 282

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 92/166 (55%), Gaps = 27/166 (16%)

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG---QSVPLSEEMLLTI- 226
           +V  R   I+R  P  +DLL ICV+SG++I+ +L+ +AE++G      VP  + ++  I 
Sbjct: 128 IVNARIEKIERDMPLFVDLLAICVQSGLTIESSLKFLAENVGDINDNFVPFLDRLVKKIE 187

Query: 227 -----AELSFL----PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
                A L+ L    P+R+V+         M CV      L QS RYG+SI + L  L S
Sbjct: 188 VNGLEAGLTHLQKELPSREVS---------MLCV-----TLQQSLRYGSSIYEYLMELSS 233

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           E R  +L++ E+    L  K+++P+++FF+  ++++I  P I+ ++
Sbjct: 234 EMRELQLLKTEEIIGKLSAKMSIPLVLFFMFPVVIIIAAPGIMRVM 279


>gi|260775648|ref|ZP_05884544.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608064|gb|EEX34233.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 292

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 93/177 (52%), Gaps = 3/177 (1%)

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
           QL + A+ LI  +    P +++ +  +  Q  I    P  LDL+ +CV++G++++ +++ 
Sbjct: 115 QLAIIALWLIAVI--VVPDLYLEHRRKVLQDKISNQLPYLLDLMAMCVQTGMTVEASIQY 172

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           ++ ++      L   M + + E S L     A +  Y R     VR+    L QS RYG+
Sbjct: 173 LSSELSALDKDLGHTMNI-VNERSRLVGLDQALDELYQRFPATEVRSFVMTLKQSLRYGS 231

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +I   L  L S+ R  R++  E+K   L  K++VP+I+F L  ++++I  P I+ ++
Sbjct: 232 AIYSVLNNLASDIREVRVLALEEKIGKLSAKMSVPLILFILIPIVILIAAPGIMRLM 288


>gi|153836407|ref|ZP_01989074.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|149750309|gb|EDM61054.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
          Length = 288

 Score = 75.9 bits (185), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 119/246 (48%), Gaps = 12/246 (4%)

Query: 83  FVKKLNL---KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI--LGIIWIFG 137
           F+ KL+L   +     E   N L  AG  SE+      +++ ++P++F +  +G  +I G
Sbjct: 49  FIDKLSLHLSRLSFNKEETKNNLVRAGIHSEFIAQAYYLLK-IIPLVFCLAFIGYSYIQG 107

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
                E  F     +  L   V   AP ++IS+        +    P  LDL+ +CV +G
Sbjct: 108 -----EMEFSSAFISFSLSMLVCLIAPDMYISSRGNANVRHVSSRLPFLLDLMNVCVHTG 162

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++++ +L  ++ ++      L+  +  T +E + +     A   FY+       ++    
Sbjct: 163 MTLEASLDYLSNELKTVDENLAYVVKKT-SERAKIVGLDRALTEFYDLVPTTEAQSFVMT 221

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L QS +YG+S+G  L  L S+ R   ++E E+K   +G K+++PMI F +  ++++I  P
Sbjct: 222 LTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSIPMIAFIMIPIVVLIAAP 281

Query: 318 AILSII 323
            I+ ++
Sbjct: 282 GIMRML 287


>gi|209546474|ref|YP_002278392.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537718|gb|ACI57652.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 314

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 140/294 (47%), Gaps = 17/294 (5%)

Query: 27  LIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK----DSASSRLRTRDSKSLRN 82
           + +AV+I +  + EL  R + V+V    + K   T+ ++    D+  + L   +++ +R 
Sbjct: 11  VFFAVLIFTAAASELFFRQREVSVR---VSKSSATAREEFHLGDTTIADLGEAENRLIRR 67

Query: 83  FVKKLNLKAILVDENI---VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           +      +    D N+    N+L  AG+ +  ++     VR  V  I +++ ++W   + 
Sbjct: 68  Y-----FEITRRDTNVNSTQNRLIRAGYFAAGAVTTFQAVRAAV-CIGVMVSMVWTLNWV 121

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                     + A+   G   F   +++I      ++   +R +PD +D+L++C+++G+S
Sbjct: 122 VPDMSGVATLIAAMFAAGST-FILVNIYIDRRGAAKEREYRRLFPDFMDMLIVCLDAGMS 180

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           I+ A  RVA +   +       + + + E+      + A  N   R ++D  R  +    
Sbjct: 181 IEAAANRVAREFVDKRQDFGLHLSIMMLEVRGGRRLREALANLAIRLRIDEARALSVLFR 240

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
           QS+  GTS+  +LRV   E R  R++ AE+KA +L  K+ +P+  F  PV +++
Sbjct: 241 QSEELGTSVTQTLRVYCKEMRDIRIVRAEEKANALPVKMLLPLGAFLFPVSLII 294


>gi|59713408|ref|YP_206183.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
 gi|59481656|gb|AAW87295.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
          Length = 303

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 120/234 (51%), Gaps = 18/234 (7%)

Query: 96  ENIVNKLRAAG-FRSEYSLNILLVVRLVVPIIFLIL----GIIWIF-GYDKLLEYPFQLR 149
           ++I  K  +AG + S+Y+        L +P+ +L      GII++  G D  +    Q+ 
Sbjct: 78  DSIERKFYSAGLYESKYA-------HLYMPVKYLTAAIGSGIIYLLLGKDSSMTT--QVA 128

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +  + L+  V    P   +S+  +  +  +    P  LDLL +CV +G++I+ +L  +A+
Sbjct: 129 LMCIWLV--VCISIPDAILSSRKKALEEKLSGQLPYLLDLLAMCVHTGMTIESSLSYLAK 186

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++ G    L+  M+    + + +   + A +  Y R   + +R+    L QS  YG+SI 
Sbjct: 187 EMQGFDKDLAH-MIARTNDRANIVGLEPALDELYVRVPTNEMRSFVMTLKQSLHYGSSIY 245

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L ++ RS RL+  E+K   L  K++VP+I+F +  ++++I  P ++ ++
Sbjct: 246 EILNTLAADIRSVRLLSLEEKVGKLAAKMSVPLILFIMIPVVILIAAPGVMRMM 299


>gi|197337342|ref|YP_002157817.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
 gi|197314594|gb|ACH64043.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
          Length = 293

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 120/234 (51%), Gaps = 18/234 (7%)

Query: 96  ENIVNKLRAAG-FRSEYSLNILLVVRLVVPIIFLIL----GIIWIF-GYDKLLEYPFQLR 149
           ++I  K  +AG + S+Y+        L +P+ +L      GII++  G D  +    Q+ 
Sbjct: 68  DSIERKFYSAGLYESKYA-------HLYMPVKYLSAAIGSGIIYLLLGKDSSMTT--QVA 118

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +  + L+  V    P   +S+  +  +  +    P  LDLL +CV +G++I+ +L  +A+
Sbjct: 119 LMCIWLV--VCISIPDAILSSRKKALEEKLSGQLPYLLDLLAMCVHTGMTIESSLSYLAK 176

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++ G    L+  M+    + + +   + A +  Y R   + +R+    L QS  YG+SI 
Sbjct: 177 EMQGFDKDLAH-MIARTNDRANIVGLEPALDELYVRVPTNEMRSFVMTLKQSLHYGSSIY 235

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L ++ RS RL+  E+K   L  K++VP+I+F +  ++++I  P ++ ++
Sbjct: 236 EILNTLAADIRSVRLLSLEEKVGKLAAKMSVPLILFIMIPVVILIAAPGVMRMM 289


>gi|260892665|ref|YP_003238762.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260864806|gb|ACX51912.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 269

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 96/202 (47%), Gaps = 13/202 (6%)

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           L +  +F +L + ++FG D             V  +  + F AP +W+++ V +R++ I+
Sbjct: 74  LCLGFVFSVLPLCFLFGVDFFW---------VVFFLPLLWF-APVLWLNSRVARRKALIR 123

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           R  PD    L   + +G  +  ALR     +GG   P+ EE+   + E     N   A E
Sbjct: 124 RQLPDFSVFLATALTAGADLPTALREAGTHVGG---PIGEEVERVLLEFGLGRNLVSALE 180

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           +  +R  MD +R    +  ++  YGTS+ + +R      RS R  E  + A  L   L  
Sbjct: 181 DMADRCDMDELRLLLWSAGRAYAYGTSVAEEVRAQADRQRSMRRFEVMEAAGKLAIYLIF 240

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           P++ F L  L++V++ PA +++
Sbjct: 241 PILFFMLLPLMVVVMYPAAVAL 262


>gi|318604217|emb|CBY25715.1| type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia enterocolitica subsp. palearctica
           Y11]
          Length = 274

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 94/174 (54%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            +ILI  + F  P V + N+V KR  S+ R+ P  +D+   CV+SG++ID +L   A+  
Sbjct: 103 TIILIMTLYF--PKVIVKNIVAKRTKSLLRSLPFFIDITAACVQSGMTIDNSLSYSAKKF 160

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  LS  ML     AE++ L N    F    + T+++ +R    AL  S  +G ++ 
Sbjct: 161 ELINADLSLIMLKVTRRAEINGLENAIKEFNQ--SSTELE-IRMFCSALQYSISFGATVY 217

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L  + R  +L+  E+K + L  KLT+P+ +F L   I+++I P++L +I
Sbjct: 218 EQLIKLSKDMREMQLLVTEEKISKLTAKLTIPLFLFILIPFIVLVISPSVLELI 271


>gi|332162959|ref|YP_004299536.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667189|gb|ADZ43833.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 274

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 94/174 (54%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            +ILI  + F  P V + N+V KR  S+ R+ P  +D+   CV+SG++ID +L   A+  
Sbjct: 103 TIILIMTLYF--PKVIVKNIVAKRTKSLLRSLPFFIDITAACVQSGMTIDNSLSYSAKKF 160

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  LS  ML     AE++ L N    F    + T+++ +R    AL  S  +G ++ 
Sbjct: 161 ELINADLSLIMLKVTRRAEINGLENAIKEFNQ--SSTELE-IRMFCSALQYSISFGATVY 217

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L  + R  +L+  E+K + L  KLT+P+ +F L   I+++I P++L +I
Sbjct: 218 EQLIKLSKDMREMQLLVTEEKISKLTAKLTIPLFLFILIPFIVLVISPSVLELI 271


>gi|154250530|ref|YP_001411354.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154480|gb|ABS61697.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 315

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 94/170 (55%), Gaps = 2/170 (1%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +  GY+ +    + +     +R ++I+R  P  LD++L+ +++G+S+DQ +R VA  +  
Sbjct: 129 VFFGYLFYRYVLIALGVYADRRANTIRRELPPVLDIMLMALDAGVSVDQCMRYVAGVVR- 187

Query: 214 QSVPLSEEMLL-TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           ++ P++ ++L   IA++        A +    R  +D  ++    + Q+   G  +  +L
Sbjct: 188 RTAPVTGKVLRRHIADIDAGMPYDAALDRLGQRLGLDEGQDLAATIKQALFQGGELSTTL 247

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R    +   +R+  A ++     P+LT+ MI+FF+PVL++V+ GPA++++
Sbjct: 248 RRFSVDLSDKRMGMAREQVGRKAPQLTLVMILFFMPVLLIVLAGPAVVTL 297


>gi|258515694|ref|YP_003191916.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779399|gb|ACV63293.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 294

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 100/217 (46%), Gaps = 16/217 (7%)

Query: 111 YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISN 170
           Y+L + L V   V     + GI +    DK+L Y      GA    G + F  P+ +I+ 
Sbjct: 93  YTLRLTLSVGAAV-----LTGIFYFPAIDKILLYG-----GAT---GGLFFLLPTKYINM 139

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
            ++ RQ   +    D +DLL   +++G+ +  ++ RV + + G    L+EE      E+ 
Sbjct: 140 KIRARQKRAQLEILDFIDLLTNGIDAGLDLSTSIDRVTKHMPG---ILAEEFQYAFVEIE 196

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
               R  A +N   R  +  V     A+IQ++R G  I   L+   +  + +    A K 
Sbjct: 197 LGRRRSEALKNMAQRLDIKDVNLLVDAIIQAERTGVPIAKVLKDQANRIKQDFRTNALKM 256

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           A +   K+  PMI+F LP L +V++GP  + I   MK
Sbjct: 257 AQAASIKMLAPMILFILPALFIVVLGPPFIGIGQLMK 293


>gi|329905442|ref|ZP_08274132.1| Flp pilus assembly protein TadC [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547599|gb|EGF32397.1| Flp pilus assembly protein TadC [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 312

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 107/236 (45%), Gaps = 8/236 (3%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF---GYDKLLEYPFQLRV- 150
           D+    ++R AG     + +  L  RL+   +   L   W+     + ++   PF +   
Sbjct: 78  DDKSWLRIRRAGLDYMLTPSQFLAARLLCMCLAAAL-CCWLLNTLAHVRVGAEPFSMAAY 136

Query: 151 GAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           G   L G + G+  P +W+ + +  RQ  I ++ P  LD++ +CVE+G+++  AL +  +
Sbjct: 137 GQAALFGMLSGWFVPRLWLHDRIALRQREILKSLPFFLDIVTLCVEAGLNLQGALSQAVD 196

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              G      +E    + ++     R  A      R +   + +   ++IQ++  G ++G
Sbjct: 197 K--GPPGAFRDECQRVLRDVRAGKARAEALRAMAERLREPGITSFVTSVIQAESMGMNLG 254

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             LR    + RSER   AEKKA     KL +P+I F  P   +V+  P ++  +  
Sbjct: 255 PVLRAQADQRRSERFQRAEKKALEAPVKLLLPLIAFIFPCTFIVLFFPIVMQFLHA 310


>gi|330862289|emb|CBX72450.1| hypothetical protein YEW_HH31820 [Yersinia enterocolitica W22703]
          Length = 203

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 94/174 (54%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            +ILI  + F  P V + N+V KR  S+ R+ P  +D+   CV+SG++ID +L   A+  
Sbjct: 32  TIILIMTLYF--PKVIVKNIVAKRTKSLLRSLPFFIDITAACVQSGMTIDNSLSYSAKKF 89

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  LS  ML     AE++ L N    F    + T+++ +R    AL  S  +G ++ 
Sbjct: 90  ELINADLSLIMLKVTRRAEINGLENAIKEFNQ--SSTELE-IRMFCSALQYSISFGATVY 146

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L  + R  +L+  E+K + L  KLT+P+ +F L   I+++I P++L +I
Sbjct: 147 EQLIKLSKDMREMQLLVTEEKISKLTAKLTIPLFLFILIPFIVLVISPSVLELI 200


>gi|319791197|ref|YP_004152837.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315593660|gb|ADU34726.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 296

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 108/229 (47%), Gaps = 7/229 (3%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +L+ AG          + V+ V  +I   LG+ W  G   LL+     ++   +     G
Sbjct: 75  QLQLAGLEFVLKAEEFIAVQCVSMLIVAALGL-WTAG---LLDATAGTKIWVTLASCVTG 130

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P +W+ +  ++R+  I R  P  LD++ +C ++G+S+  A+ +  +   G    L +
Sbjct: 131 WLYPVMWMRDRRKRREKDILRTLPGYLDMITLCCQAGLSLTGAIAQAVQK--GPGGALGQ 188

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E    + E+    +R  A     +R     +++    L Q++  G S+ D+L  +  + R
Sbjct: 189 EFDRMMREMRTGASRMDALNALADRLDNKHIKSLVSNLTQAESLGASLADTLSAISDQRR 248

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           +ER   AEK A     K+  P++IF  PV  ++I  P ++  ++T ++H
Sbjct: 249 TERFQMAEKLAMEAPVKMIGPLVIFIFPVTFIIIFFPLVMQFLET-QNH 296


>gi|163856391|ref|YP_001630689.1| hypothetical protein Bpet2080 [Bordetella petrii DSM 12804]
 gi|163260119|emb|CAP42420.1| putative membrane protein [Bordetella petrii]
          Length = 290

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 90/186 (48%), Gaps = 9/186 (4%)

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           + W  G    + +P     GA+ + G+     P  W S  + +R+  I R  P  LD++ 
Sbjct: 104 LAWWLG--TAVAWPAAGLAGALFMGGW-----PVAWASRRIGRRRQRIGRELPFVLDMMT 156

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +C+ESG+ +  AL++ A+   G   PL +E+   +A++     R  A +   +R     V
Sbjct: 157 LCIESGLGLHGALQQAAQH--GPPGPLRQELHHALADMRAGMPRAAALKALADRADSPAV 214

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R+   AL Q+D  G S+G  LR   ++ R++R   AEK A     K+ +P+I    P   
Sbjct: 215 RSWIAALTQADSLGMSLGAVLRGHAAQCRTDRFQRAEKLAMEAPVKMLLPLIGCIFPCTF 274

Query: 312 LVIIGP 317
           +V+  P
Sbjct: 275 IVLAFP 280


>gi|319943385|ref|ZP_08017667.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
 gi|319743200|gb|EFV95605.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
          Length = 298

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 84/166 (50%), Gaps = 2/166 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VG   P  W+ +L  +R   I +A P  LD++ + +E+G ++  AL+   +   G + P+
Sbjct: 131 VGAFLPVSWLRDLGARRTRQIAKALPFYLDIITLAIEAGSNMTGALQHAVDK--GPTGPM 188

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           SEE+   + ++     R  +      R ++  + N   A++ +++ G+S+G  LR    +
Sbjct: 189 SEELRRVLRDIRAGRTRAESLRALAERLRIPAISNWVAAILTAEKQGSSLGPILRAQADQ 248

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            R+ER M+AE  A     K+  P++I   P   +++  P  + I++
Sbjct: 249 RRNERFMQAEAMALKAPVKMLFPLMICIFPCTFIIVFFPIAIRIME 294


>gi|52425830|ref|YP_088967.1| hypothetical protein MS1775 [Mannheimia succiniciproducens MBEL55E]
 gi|52307882|gb|AAU38382.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 292

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I  ++ GI  +F  D   E       GAVI +  +    P    + +++++  ++    P
Sbjct: 96  ITLILTGIYALFNLDA--ERKSLAIAGAVIFVLVI--LIPGSLANMILKRKIKNMMTDLP 151

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFENF 242
             +DL+ ICV++G++I+ AL RVAED    +  LS  ML  I  AE+  LP+   A +  
Sbjct: 152 GFVDLVAICVQTGMTINAALLRVAEDFKILNPDLSYVMLRIIRKAEIIGLPS---ALDTL 208

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
                   +R  T  L QS  +G+SI   L  L S+ R  +L+  E++  +L  K++VP+
Sbjct: 209 AVSLPTREIRMFTTVLQQSLNFGSSIYSHLLQLSSDMRELQLLTIEEQLGTLSAKMSVPL 268

Query: 303 IIFFLPVLILVIIGPAILSI 322
           I+F +  +I++I+ P ++ +
Sbjct: 269 ILFIMFPIIILIVAPGVMRV 288


>gi|254506088|ref|ZP_05118232.1| bipartite nuclear localization signal containing protein [Vibrio
           parahaemolyticus 16]
 gi|219550906|gb|EED27887.1| bipartite nuclear localization signal containing protein [Vibrio
           parahaemolyticus 16]
          Length = 248

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 114/235 (48%), Gaps = 12/235 (5%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF--LILGI--IWIFGYDKLLEYPFQLRV 150
           ++ I +K + AG  S+        V L +P+ +  L+LG   I+I+     +  P  +  
Sbjct: 21  NQEINDKFKRAGISSKSKW-----VALYMPLKYGALMLGCAAIYIYSIKSAISTPTLIAF 75

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
            A  LI  +    P   +    + R S +    P  LDLL +CV++G++I+ A+  ++++
Sbjct: 76  MATWLI--ICIVVPDALLDGRGKARVSRVSGQLPYLLDLLAVCVQTGMTIESAMNYLSKE 133

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           + G    L+  +L    + + L   Q A +  Y       +R+    L QS +YG+SI  
Sbjct: 134 MVGFDKELAG-LLKKTNDRARLVGMQKALDELYEDIPSSEMRSFVMTLKQSLQYGSSIYG 192

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            L  L  + R  +++  E+K   L  K++VP+I+F +  ++++I  P IL ++  
Sbjct: 193 VLTTLAGDIRDVQMLTLEEKIGKLAAKMSVPLILFIMMPIVILIAAPGILRMMSN 247


>gi|311105395|ref|YP_003978248.1| type II secretion system protein F domain-containing protein 2
           [Achromobacter xylosoxidans A8]
 gi|310760084|gb|ADP15533.1| bacterial type II secretion system protein F domain protein 2
           [Achromobacter xylosoxidans A8]
          Length = 290

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 89/165 (53%), Gaps = 2/165 (1%)

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           AP +W+ +L  KR+ SI+R  P   D++ +CVE+G+S+  AL+  A+   G +  L + +
Sbjct: 128 APGLWLRSLSVKRRRSIERDLPFVFDMMTLCVEAGLSVHGALQMAAQS--GPAGILRDAL 185

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
              +AE+    +R  A +    R+     RN   AL Q++  G S+G  LR   +++RS+
Sbjct: 186 ADALAEMRAGVSRTAAIKALAERSNSPLARNWAAALAQAEALGISLGPVLRAQAAQSRSD 245

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R + AE+ A     K+ +P+I    P   +V+  P ++ ++ + +
Sbjct: 246 RHVRAEQLAMQAPVKMLLPLIGCIFPCTFIVLAFPVMVQLLQSAQ 290


>gi|237653361|ref|YP_002889675.1| type II secretion system protein [Thauera sp. MZ1T]
 gi|237624608|gb|ACR01298.1| type II secretion system protein [Thauera sp. MZ1T]
          Length = 301

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 77/151 (50%), Gaps = 2/151 (1%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W+ + ++ R+  + +  P  LDL+ +CVE+G+++  AL++ A    G + PL EE+   +
Sbjct: 143 WLDDRIRCRRRLMLKQLPFVLDLITLCVEAGLNLTGALQQAAAK--GPAGPLGEELHRVL 200

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            ++    +R  A   F +R     + N    +IQ++  G S+G  LR    + R+ER   
Sbjct: 201 RDVRAGKSRADALRGFADRIGEPAIANLVSTVIQAENMGMSLGPMLRAQGEQRRAERFAR 260

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           AEK A     K+ +P+I    P   +V+  P
Sbjct: 261 AEKAAMEAPVKMLLPLIACIFPCTFIVLGFP 291


>gi|156744077|ref|YP_001434206.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235405|gb|ABU60188.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 309

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 91/176 (51%), Gaps = 6/176 (3%)

Query: 153 VILIGYVGFCA---PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           ++L+G +  CA   P VW+S  + +RQ+ +  A PDALDLL I   +G+S + A++ +  
Sbjct: 133 ILLLGGIALCAFFLPDVWLSRRIGQRQTELLNALPDALDLLAIATAAGLSFENAIQEITS 192

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
               +   L+ E    + ++S    R+ A  +   RT +  + +   A+ Q++  G SIG
Sbjct: 193 KWTNE---LAREFSRVLRDMSMGVPRRQALTDMAERTGVPDIASFVSAIKQAEALGVSIG 249

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             L V   E R+ R   A+++A     K+  P++    P +  V++GPA+  +++ 
Sbjct: 250 RVLTVQAEEMRTRRRQRAQERANQAPVKMMFPLVFLIFPAIFAVLLGPAVPQLLEA 305


>gi|297581613|ref|ZP_06943535.1| flp pilus assembly protein TadC [Vibrio cholerae RC385]
 gi|297534020|gb|EFH72859.1| flp pilus assembly protein TadC [Vibrio cholerae RC385]
          Length = 305

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 95/177 (53%), Gaps = 7/177 (3%)

Query: 155 LIGYV-GFCAPSVWI---SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           L+GYV G   P   +   S   ++RQ  I     DA+DL++I +E+G+S+D+AL RV   
Sbjct: 132 LVGYVLGSNLPEYGLRRQSKQAKQRQQQIV---ADAMDLMVISIEAGLSLDRALERVGHY 188

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +      L+++ L T AE+  L +  +  +    RT +  +      L  + RYG+ + +
Sbjct: 189 LLDVEPMLAKQFLRTHAEIQVLGDTALCMKKLAWRTGLQELERCAATLAMAQRYGSPLAE 248

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           ++R +  + R  R M  +++A  L  ++T+  + F +  L+++II P +  ++++++
Sbjct: 249 TMRNISQDARQMRKMALQEQAGKLPGRITLIQMAFIMLPLLVLIIAPTLNVLLESLR 305


>gi|319788658|ref|YP_004148133.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467170|gb|ADV28902.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 296

 Score = 72.8 bits (177), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 109/231 (47%), Gaps = 22/231 (9%)

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI-----LLVVRLVVPIIFLILGIIWI 135
           R    +LN+  +   E    +L+AAG   +Y+L       L     +V I+F +L ++ +
Sbjct: 57  RRLAPRLNVSQL---EQTHRQLQAAG--QDYTLTPEEFYGLRAASAIVVILFFLLCVLML 111

Query: 136 --FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
              G   +L          V+  G +G+  P++W+    + R  ++ R  P  LD + + 
Sbjct: 112 GKLGPSSVL--------ACVMFGGVLGWLYPALWLGERRKLRHKAVVRDLPVYLDFITMS 163

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+++   + +      G +  LS+E    + ++     R  A +    R  +  + N
Sbjct: 164 VEAGLNVTGGIEQAVAK--GPAGALSQEFSRMLRDIRAGLPRAEALKRMSERMDISQITN 221

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
            T ALIQ+D+ G ++ D+LR   ++ R ER + AEK A     K+ +P+++
Sbjct: 222 FTSALIQADKVGANLSDTLRAQANQRREERFLRAEKLALEAPVKMMLPLVM 272


>gi|123443825|ref|YP_001007796.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090786|emb|CAL13668.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 274

 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 93/174 (53%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            +ILI  + F  P V + N+V +R  S+ R+ P  +D+   CV+SG++ID +L   A+  
Sbjct: 103 TIILIMTLYF--PKVIVKNIVARRTQSLLRSLPFFIDITAACVQSGMTIDNSLSYSAKKF 160

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  LS  ML     AE++ L N    F    + T+++ +R    AL  S  +G ++ 
Sbjct: 161 ELINADLSLIMLKVTKRAEINGLENAIKEFNQ--SSTELE-IRMFCSALQYSISFGATVY 217

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L  + R  +L+  E+K + L  KLT+P+ +F L   +++++ P IL +I
Sbjct: 218 EQLIKLSKDMREMQLLVTEEKISKLTAKLTIPLFLFILIPFVVLVVSPGILELI 271


>gi|328884729|emb|CCA57968.1| putative integral membrane protein [Streptomyces venezuelae ATCC
           10712]
          Length = 295

 Score = 72.4 bits (176), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 83/163 (50%), Gaps = 4/163 (2%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           AV+L  +  F    V I + V+ R+  I+R  PD LD+L + V +G+   QAL RVAE  
Sbjct: 119 AVLLFAFGAFWT-EVGIWSAVRIRKDQIERTLPDFLDVLAVVVSAGLGFRQALERVAEKY 177

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   P ++E+ +T+ ++    +R+ AF+    R   + V     AL Q +  G  I ++
Sbjct: 178 EG---PWADELRITLRQMDMGVSRRQAFDELRRRNDSEQVAQFVTALQQGEELGAPIVET 234

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           L  + ++ R      A +KAA   PK T+ +    +P  ++++
Sbjct: 235 LIQIANDMRRTDAQNARRKAAKAVPKATMVITTLMVPATMILL 277


>gi|149178503|ref|ZP_01857091.1| type II secretion system protein [Planctomyces maris DSM 8797]
 gi|148842618|gb|EDL56993.1| type II secretion system protein [Planctomyces maris DSM 8797]
          Length = 334

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 106/222 (47%), Gaps = 7/222 (3%)

Query: 103 RAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
           RA  +RS   +  L    ++V ++ +  G+  +   D     P ++ + A +LI   G+ 
Sbjct: 79  RAGYYRSTALVEYLATRNMLVVLVLIGTGVGCVLA-DPGSNLP-EIILIAGLLIAGAGYG 136

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI--GGQSVPLSE 220
            P + + N   +R   I+R  PDALDL+++C+  G+ +  AL RV +++      + +  
Sbjct: 137 LPRIVLQNQANRRVHRIQRGLPDALDLVMMCLTGGVPLRTALERVTDEVRFSHPDIAVEF 196

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E++   A+ + + +   A + F  R     V   +  + Q++R GT++  +L       R
Sbjct: 197 EIIRRHADANSMAD---ALKQFAKRIDAPDVNALSLMISQTERLGTNVSTALIDFADGVR 253

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            +    AE+ ++    KL  P+I    P + ++  GPA+L +
Sbjct: 254 RKYRQRAEENSSKTSIKLLFPIIFCMAPPIYILFFGPAVLEL 295


>gi|87308908|ref|ZP_01091046.1| bacterial type II secretion system protein [Blastopirellula marina
           DSM 3645]
 gi|87288251|gb|EAQ80147.1| bacterial type II secretion system protein [Blastopirellula marina
           DSM 3645]
          Length = 321

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 5/168 (2%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           F  P V IS+    R S I+ A PDALD++ +   +G+ + ++++RV++++      L+ 
Sbjct: 132 FAIPRVIISSQAAARVSRIQHALPDALDMITMTTTAGLPLQKSIKRVSDEMVRSHEDLAC 191

Query: 221 EMLL--TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           E+++    AE   L     A +NF  R ++  V      + Q+ R G S+  + R     
Sbjct: 192 ELMILDRQAETGSLGQ---AIQNFAKRLEVPEVNALASLVTQAQRIGGSVAGAFRDFADS 248

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R  R   AE++      KL +P+I    P + ++++GP++L + D M
Sbjct: 249 IRRSRRQLAEERGNQNSIKLLIPVIFLLAPPVYILLLGPSVLRLQDFM 296


>gi|72162675|ref|YP_290332.1| integral membrane protein [Thermobifida fusca YX]
 gi|71916407|gb|AAZ56309.1| putative integral membrane protein [Thermobifida fusca YX]
          Length = 273

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 75/149 (50%), Gaps = 3/149 (2%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           +KRQ  I++  PD LD+L + V +G+S  QAL RVA+ + G    L+ E  L + ++   
Sbjct: 118 RKRQEEIQKQLPDFLDVLAVTVSAGLSFRQALARVADAMPG---VLASEFQLALRQMELG 174

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +R+ AF     R   + +     AL Q++  G  +  +L  L ++ R E      +KA 
Sbjct: 175 TSRRDAFAALRERNSNEALGRFITALQQAEELGAPLSQTLHALSTDMRREDAQFLRRKAQ 234

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            L P++T       LP L+L+I G  +L 
Sbjct: 235 HLNPRVTAVTAATMLPGLLLIIGGGMLLG 263


>gi|238759125|ref|ZP_04620294.1| Type II secretion system protein [Yersinia aldovae ATCC 35236]
 gi|238702673|gb|EEP95221.1| Type II secretion system protein [Yersinia aldovae ATCC 35236]
          Length = 273

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 93/173 (53%), Gaps = 7/173 (4%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           ++LI  + F  P V I N+V K+  ++ ++ P  +D+   CV+SG++ID +L   A+   
Sbjct: 100 IMLIVVIYF--PRVIIRNIVSKKIRTLLQSLPFFIDITAACVQSGMTIDSSLSYTAKKFK 157

Query: 213 GQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
             +  LS  ML     AE++ L N    F+ +   T+   ++    AL  S  +G+++ D
Sbjct: 158 LINADLSLIMLKITKRAEINGLENAIKEFQQYSTETE---IKMFCSALQYSIIFGSTVYD 214

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            L  L  + R  +L+  E+K + L  KLT+P+ +F L   + ++I P++L ++
Sbjct: 215 QLIKLSQDMREMQLLVTEEKNSKLSSKLTLPLFVFILIPFVALVISPSVLELL 267


>gi|300856045|ref|YP_003781029.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
 gi|300436160|gb|ADK15927.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 306

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 85/157 (54%), Gaps = 3/157 (1%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           ++S  +Q R++ I +  P  LDL+ + VE+G+S D A+ RV  +I G+   L +E   ++
Sbjct: 147 YLSRRIQNRKNKILKDLPYTLDLITVSVEAGLSFDGAIARVISNIRGE---LCDEFAKSL 203

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            E++    R+ A +N   R  +  +     +LIQ+D  G S+   LR+  +  R  R   
Sbjct: 204 KEITMGIERKAALKNMSERCDVKELSMFISSLIQADELGVSLSKVLRIESANLREHRRQV 263

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + +KA     K+  P+I F  P + ++I+GPA++ +I
Sbjct: 264 SREKAMKAPIKMLFPLIFFIFPTIFIIILGPAVIRMI 300


>gi|209809175|ref|YP_002264713.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
 gi|208010737|emb|CAQ81128.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
          Length = 292

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 87/160 (54%), Gaps = 1/160 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P + +++ ++  +  +    P  LDLL +CV +G++I+ ++  +A+++ G    L+  M+
Sbjct: 130 PDLILNSRIKTLRDKLSSQLPYLLDLLAMCVHTGMTIESSMAYLAKEMRGFDKDLAH-MV 188

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
               + + +    VA +  Y +   + +R+    L QS  YG+SI   L  L  + R+ R
Sbjct: 189 SRTNDRARIVGLSVALDELYIKVPTNEMRSFVMTLKQSLHYGSSIYGILNTLAEDIRNVR 248

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L+  E+K   L  K++VP+I+F +  ++++I  P I+ ++
Sbjct: 249 LLSLEEKVGKLAAKMSVPLILFIMIPVVILIAAPGIMRMM 288


>gi|226325183|ref|ZP_03800701.1| hypothetical protein COPCOM_02975 [Coprococcus comes ATCC 27758]
 gi|225206531|gb|EEG88885.1| hypothetical protein COPCOM_02975 [Coprococcus comes ATCC 27758]
          Length = 303

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 101/218 (46%), Gaps = 13/218 (5%)

Query: 100 NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV 159
           +KL  AG +   S    + + + +    ++ G   + GY         L VG +  +G  
Sbjct: 81  DKLDLAGLKITPSTWRAISLGITIFTAIMLAGAALVGGYG----IAMALLVGIIGAVGGW 136

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED--IGGQSVP 217
             C   VW+S+  + R   I R  P AL+LL I V +G+ +++  R++AE+  +G    P
Sbjct: 137 AVC--GVWLSHAGKTRGEEIDRYLPPALELLTISVSAGVLVERGFRQLAENKALG----P 190

Query: 218 LSEEMLLTIAELSFLPNRQV-AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           L++E   T  E+S L   +V A ++   R     +     ALI++ R GTSI   L    
Sbjct: 191 LADEFARTDMEISHLGVSRVDALDHMRRRCDSPLMGYFCAALIEATRKGTSISGVLESQA 250

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              R  R      +   L  K+ VP++ F + VL+L++
Sbjct: 251 KLARKARYDALTAQINKLSTKMAVPLVFFLIAVLVLIL 288


>gi|290957844|ref|YP_003489026.1| type II secretion system F protein [Streptomyces scabiei 87.22]
 gi|260647370|emb|CBG70475.1| putative type II secretion system F protein [Streptomyces scabiei
           87.22]
          Length = 300

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 80/155 (51%), Gaps = 3/155 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G  A    I   V++R+  I R  PD LD+L + V +G+   QAL RVAE   G   P +
Sbjct: 131 GLLAADAAIWQAVRERKDVIDRTLPDFLDVLAVVVSAGLGFRQALDRVAEKYEG---PWA 187

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+ +T+ ++    +R+ AF+    R   + V     AL Q +  G+ I ++L  L ++ 
Sbjct: 188 DELRITLRQMDMGVSRRQAFDELRRRNTSEQVAQFVSALQQGEELGSPIAETLIQLAADM 247

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           R      A ++AA   PK T+  ++F LP  +++I
Sbjct: 248 RRTDAQNARRRAARTIPKATLVTLVFMLPATMILI 282


>gi|269105136|ref|ZP_06157830.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268160586|gb|EEZ39085.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 293

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 118/235 (50%), Gaps = 20/235 (8%)

Query: 96  ENIVNKLRAAGFRS-EYSLNILLVVRLVVPIIFLIL----GIIWIFGYDKLLEYPFQLRV 150
           + I  K  +AGF   +Y+        L +PI +L++    G I+ F    + + P  + +
Sbjct: 69  KEIDKKFYSAGFYDFKYA-------YLYMPIKYLLVLIGSGSIYWFS-KGIFDNPTMMAI 120

Query: 151 GAVILIGYVGFC--APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
             V    +V  C   P + ++   +  +  I    P  LDLL +CV++G++I+ ++  ++
Sbjct: 121 ICV----WVVLCISMPDIVLAQKSKTLRHKISGQLPYLLDLLAMCVQTGMTIESSMSYLS 176

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            ++ G    LS  +L    + + +   + A +  Y R   + +R+    + QS +YG+SI
Sbjct: 177 REMKGFDRDLSH-LLTRTNDRARIIGLEQALDELYIRVPTNEMRSFVMTIKQSLQYGSSI 235

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + L  L ++ R  R++  E+K   L  K+++P+I+F L  ++++I  P +L ++
Sbjct: 236 YNILTTLAADIRDMRMLTLEEKIGKLAAKMSIPLILFILIPIVILIAAPGVLRML 290


>gi|312621086|ref|YP_003993814.1| type ii/iv secretion system protein tadc,associated with flp pilus
           assembly [Photobacterium damselae subsp. damselae]
 gi|311872807|emb|CBX86898.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae]
          Length = 303

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 118/235 (50%), Gaps = 20/235 (8%)

Query: 96  ENIVNKLRAAGFRS-EYSLNILLVVRLVVPIIFLIL----GIIWIFGYDKLLEYPFQLRV 150
           + I  K  +AGF   +Y+        L +PI +L++    G I+ F    + + P  + +
Sbjct: 79  KEIDKKFYSAGFYDFKYA-------YLYMPIKYLLVLIGSGSIYWFS-KGIFDNPTMMAI 130

Query: 151 GAVILIGYVGFC--APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
             V    +V  C   P + ++   +  +  I    P  LDLL +CV++G++I+ ++  ++
Sbjct: 131 ICV----WVVLCISMPDIVLAQKSKTLRHKISGQLPYLLDLLAMCVQTGMTIESSMSYLS 186

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            ++ G    LS  +L    + + +   + A +  Y R   + +R+    + QS +YG+SI
Sbjct: 187 REMKGFDRDLSH-LLTRTNDRARIIGLEQALDELYIRVPTNEMRSFVMTIKQSLQYGSSI 245

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + L  L ++ R  R++  E+K   L  K+++P+I+F L  ++++I  P +L ++
Sbjct: 246 YNILTTLAADIRDMRMLTLEEKIGKLAAKMSIPLILFILIPIVILIAAPGVLRML 300


>gi|317491688|ref|ZP_07950123.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920122|gb|EFV41446.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 279

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 103/204 (50%), Gaps = 15/204 (7%)

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVIL--IGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           + L+L I+ IF           ++  A+I+  I  +    P++ ++  +  R   +  A 
Sbjct: 84  VLLVLNIVGIFS--------ISMKALAMIMLFIFMIVLVLPAMMLNPAINTRIKLMLDAL 135

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFEN 241
           P  +DL+ +CV++G++++ +++ +AE        L++ ML  +  AE+S L        +
Sbjct: 136 PYFVDLIAVCVQAGMTVESSVKFIAERSADLDKNLADLMLHLVKRAEVSGLEE---GLMD 192

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
            Y    M  +R     L QS  YGTS+ ++L  L  + R  +L+ +E+K   L  K++VP
Sbjct: 193 LYRSMDMTEMRMFCATLQQSVHYGTSLYENLMELSKDIRDMQLLNSEEKIGKLSAKMSVP 252

Query: 302 MIIFFLPVLILVIIGPAILSIIDT 325
           +I+F +  + ++I  P IL I+  
Sbjct: 253 LILFIMFPITILIAAPGILRIMQN 276


>gi|323495642|ref|ZP_08100713.1| type II secretion system protein F [Vibrio sinaloensis DSM 21326]
 gi|323319277|gb|EGA72217.1| type II secretion system protein F [Vibrio sinaloensis DSM 21326]
          Length = 296

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 84/162 (51%), Gaps = 1/162 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   + +  + R + I    P  LDLL +CV++G++I+ A+  +++++ G    L+  +L
Sbjct: 135 PDAILDSRGKARIARISAQLPYLLDLLAVCVQTGMTIESAMNYLSKEMIGFDKELAG-LL 193

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
               E S L   Q A +  Y       +R+    L QS +YG+SI   L  L  + R  +
Sbjct: 194 KKTNERSRLVGMQKALDELYEDIPSSEMRSFVMTLKQSLQYGSSIYGVLTTLAGDIRDVQ 253

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           ++  E+K   L  K++VP+I+F +  ++++I  P IL ++  
Sbjct: 254 MLGLEEKIGKLAAKMSVPLILFIMIPIVILIAAPGILRMMSN 295


>gi|254252516|ref|ZP_04945834.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
 gi|124895125|gb|EAY69005.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
          Length = 333

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 119/277 (42%), Gaps = 35/277 (12%)

Query: 73  RTRDSKSLRNFVKKLNLKAI----------LVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           RTR  + +  F+++L+   +          +V +     L   G+    +  + L  R+V
Sbjct: 71  RTRGGQRVARFLERLSAAGMRWLDTGFGQYVVAQEDRRLLEQCGYIDARTRGLFLSARIV 130

Query: 123 ----VPIIFLIL------GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
               +P++F I+      G +W+ G    L   F L           GF  P  ++    
Sbjct: 131 CGIALPLLFAIVASGRMKGSLWLIG----LFAAFGL-----------GFMLPKFYVKRRA 175

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
             R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G    LS E+ +   + +  
Sbjct: 176 AARRQSVVDELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGMLPVLSSEVGIAQRQFAAG 235

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
             R+ + +        + +R   + +IQ D++G ++ + L+      R  R     ++  
Sbjct: 236 RTREQSLQRLSGGFDNEDLRAVVRLMIQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIG 295

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 296 RLTVKMTGVMVLTLLPALLIVTAGPGMLAVMHALSAH 332


>gi|294631144|ref|ZP_06709704.1| integral membrane protein [Streptomyces sp. e14]
 gi|292834477|gb|EFF92826.1| integral membrane protein [Streptomyces sp. e14]
          Length = 295

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 83/169 (49%), Gaps = 8/169 (4%)

Query: 161 FCAPSVW----ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           F   ++W    I + ++ R+  I+R  PD LD+L + V +G+   QAL RVA    G   
Sbjct: 123 FAFGALWTEVGIWSAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVAARYEG--- 179

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           P ++E+ +T+ ++    +R+ AF     R   + V     AL Q +  G  I D+L  L 
Sbjct: 180 PWADELRITLRQMDLGMSRRQAFAELRRRNDSEQVAMFVTALQQGEELGAPIVDTLVSLA 239

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLP-VLILVIIGPAILSIID 324
            + R      A +KAA   PK T+ +  F +P  +IL+  G  + S +D
Sbjct: 240 KDMRRTDAQNARRKAARAVPKATMMITTFMVPATMILLATGLLLGSGVD 288


>gi|238782877|ref|ZP_04626906.1| Type II secretion system protein [Yersinia bercovieri ATCC 43970]
 gi|238716300|gb|EEQ08283.1| Type II secretion system protein [Yersinia bercovieri ATCC 43970]
          Length = 264

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 95/180 (52%), Gaps = 5/180 (2%)

Query: 148 LRVGAVILIGYVGFCA----PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
           + + ++I IG++   A    P V I  ++ +R  SI ++ P  +D+   CV+SG++ID +
Sbjct: 80  INLNSLIGIGFITILATLYLPKVMIKKIIARRVESILKSLPFFIDITAACVQSGMTIDSS 139

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           L   A      +  LS  ++L +A+ + +   + A +  +  +    ++     L  S  
Sbjct: 140 LSYAARKFELINPDLSL-IILKMAKRAEINGLESAIKELHQCSTATEIKMFCSTLQYSIS 198

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           +G+++ D L  L  + R  +L+  E+K + L  KLT+P+ IF L   ++++I P++L +I
Sbjct: 199 FGSTVYDQLIKLSQDIREMQLLVTEEKISKLSTKLTLPLFIFILIPFVVLVISPSVLELI 258


>gi|238762413|ref|ZP_04623384.1| Type II secretion system protein [Yersinia kristensenii ATCC 33638]
 gi|238699398|gb|EEP92144.1| Type II secretion system protein [Yersinia kristensenii ATCC 33638]
          Length = 272

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 93/178 (52%), Gaps = 7/178 (3%)

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           L VG ++LI  +    P   + N++  R  S+ ++ P  +D+   CV+SG++ID +L   
Sbjct: 97  LIVGVIMLIMMLYL--PKYIVKNIITSRNKSLLKSLPFFIDITAACVQSGMTIDSSLSYT 154

Query: 208 AEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           A+     +  LS  ML     AE++ L   + A + F+  +    +R    AL  S  +G
Sbjct: 155 AKKFELINADLSLIMLKVTRRAEINGL---ESAIKEFHQSSTELEIRMFCSALQYSISFG 211

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            ++ + L  L  + R  +L+  E+K + L  KLT+P+ +F L   I+++I P++L ++
Sbjct: 212 ATVYEQLIKLSQDMREMQLLVTEEKISKLTAKLTIPLFLFILIPFIILVISPSVLELL 269


>gi|307332439|ref|ZP_07611503.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306881908|gb|EFN13030.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 295

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 86/161 (53%), Gaps = 6/161 (3%)

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            +W +  V++R+ +I+R  PD LD+L + V +G+S  QAL RVAE   G   P ++E+ +
Sbjct: 133 GIWAA--VRERKDAIERTLPDFLDVLAVVVSAGLSFRQALDRVAEKYEG---PWADELRI 187

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AFE    R   + V     AL Q +  G  I ++L  + ++ R    
Sbjct: 188 TLRQMDMGVSRRHAFEELRKRNDSEQVAQFVTALQQGEELGAPIVETLIAIANDMRRTDA 247

Query: 285 MEAEKKAASLGPKLTVPMIIFFLP-VLILVIIGPAILSIID 324
             A ++AA   PK T+ +  F +P  ++L++ G  I S  D
Sbjct: 248 QNARRRAARAVPKATMVITTFMVPGTMVLLVAGFFIGSGTD 288


>gi|171321820|ref|ZP_02910723.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171092891|gb|EDT38141.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 330

 Score = 69.3 bits (168), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 113/252 (44%), Gaps = 30/252 (11%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVR----LVVPIIFLIL------GIIWIFGYD 139
           K I+ DE+    L   G+    +  + L  R    LV+P++F +       G  W+    
Sbjct: 96  KHIVADED-RRLLEQCGYVDARTRGLFLSARIACGLVLPLLFALFASGRLKGSHWV---- 150

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                     +G  ++ G +GF  P +++      R+ S+    P  +D+L +    G+S
Sbjct: 151 ----------IGMFVVFG-LGFMLPKLYVKRRAAARRQSVVDELPLFVDMLRLLQGVGLS 199

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQA 257
           +DQ+L+ V  D  G    LS E  + IA+  F+  R  + + +        + +R   + 
Sbjct: 200 LDQSLQVVTNDFRGMMPVLSSE--VGIAQRHFVAGRTREQSMQRLSGGFDNEDLRAIVRL 257

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           ++Q D++G ++ + L+      R  R     ++   L  K+T  M++  LP L++V  GP
Sbjct: 258 MVQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTAGP 317

Query: 318 AILSIIDTMKDH 329
            +L+++  +  H
Sbjct: 318 GMLAVMRALSHH 329


>gi|317403410|gb|EFV83923.1| type II secretion system protein [Achromobacter xylosoxidans C54]
          Length = 246

 Score = 68.9 bits (167), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 77/164 (46%), Gaps = 5/164 (3%)

Query: 157 GYVGFCA---PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           G V F A   P  W+    + R+  I+R  P  LD++ +CVE+G+    AL+  A +  G
Sbjct: 75  GAVAFTAALLPFAWLRAQGEARRRGIERGLPFMLDMMTLCVEAGLGAHAALQAAAAN--G 132

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
            S PL + +   +A++     R  A +   +R     V     AL  +D  G S+G  LR
Sbjct: 133 PSGPLRDALAGALAQVRAGVPRVAAIQAMADRCGSPLVHRWATALAHADALGISLGPLLR 192

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
              +  RSER M AE+ A     K+ +P+I    P   LV+  P
Sbjct: 193 AQAAHCRSERHMRAERLAMQAPVKMLLPLIGCIFPCTFLVLAFP 236


>gi|25029119|ref|NP_739173.1| hypothetical protein CE2563 [Corynebacterium efficiens YS-314]
 gi|259505885|ref|ZP_05748787.1| bacterial type II secretion system protein F domain protein
           [Corynebacterium efficiens YS-314]
 gi|23494406|dbj|BAC19373.1| hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259166559|gb|EEW51113.1| bacterial type II secretion system protein F domain protein
           [Corynebacterium efficiens YS-314]
          Length = 94

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (59%)

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            +    RT +  +R   +A++Q+D YG SI D LR    E R +R   AE+KA  L  K+
Sbjct: 4   LDGLATRTTVPDLRRFVRAVVQADAYGISIADVLRTQADEMRLKRRQRAEEKAQKLPVKV 63

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDT 325
             P+++  LPVL +V++GPA +SI+D 
Sbjct: 64  LAPVMLCILPVLFIVVMGPAAMSIVDA 90


>gi|256785513|ref|ZP_05523944.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 300

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 83/170 (48%), Gaps = 4/170 (2%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A++L+ +  F    V I + ++ R+  I+R  PD LD+L + V +G+   QAL RV+   
Sbjct: 124 ALLLLAFGAFWT-EVGIWSAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVSTRY 182

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   P ++E+ +T+ ++     R+ AF     R   + V     AL Q +  G  I D+
Sbjct: 183 EG---PWADELRITLRQMDLGMGRREAFTELRRRNDSEQVAMFVTALQQGEELGAPIVDT 239

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           L  L  + R      A +KAA   PK T+ +  F +P  ++++    IL 
Sbjct: 240 LVSLAKDMRRTDAQNARRKAARAVPKATLMITTFMVPATMILLGAGLILG 289


>gi|239929198|ref|ZP_04686151.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291437532|ref|ZP_06576922.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340427|gb|EFE67383.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 295

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 3/156 (1%)

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           V I + ++ R+  I+R  PD LD+L + V +G+   QAL RVA    G   P ++E+ +T
Sbjct: 132 VGIWSAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVASKYEG---PWADELRIT 188

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + ++    +R+ AF     R   + V     AL Q +  G  I D+L  L  + R     
Sbjct: 189 LRQMDLGMSRRQAFAELRRRNDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQ 248

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            A +KAA   PK T+ +  F +P  ++++    IL 
Sbjct: 249 NARRKAARAVPKATMMITTFMVPATMILLGAGLILG 284


>gi|325518470|gb|EGC98169.1| pilus assembly protein [Burkholderia sp. TJI49]
          Length = 211

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 5/182 (2%)

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +G  +  G +GF  P +++      R+ S++   P  +D+L +    G+S+DQ+L+ V  
Sbjct: 32  IGMFVAFG-LGFMLPKLYVQRRASSRRQSVEDELPLFVDMLRLLQGVGLSLDQSLQVVTN 90

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           D  G    LS E  + IA+  F+  R  + + +      + + +R   + ++Q D++G +
Sbjct: 91  DFRGMMPVLSSE--VGIAQRQFVAGRTREQSMQRLSGGFENEDLRAIVRLMVQVDKHGGA 148

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + + L+      R  R     ++   L  K+T  M++  LP L++V  GP  L++   + 
Sbjct: 149 VQEPLKQFGDRLRETRRSMLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGFLAVTRALA 208

Query: 328 DH 329
            H
Sbjct: 209 TH 210


>gi|289769409|ref|ZP_06528787.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289699608|gb|EFD67037.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 291

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 83/170 (48%), Gaps = 4/170 (2%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A++L+ +  F    V I + ++ R+  I+R  PD LD+L + V +G+   QAL RV+   
Sbjct: 115 ALLLLAFGAFWT-EVGIWSAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVSTRY 173

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G   P ++E+ +T+ ++     R+ AF     R   + V     AL Q +  G  I D+
Sbjct: 174 EG---PWADELRITLRQMDLGMGRREAFTELRRRNDSEQVAMFVTALQQGEELGAPIVDT 230

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           L  L  + R      A +KAA   PK T+ +  F +P  ++++    IL 
Sbjct: 231 LVSLAKDMRRTDAQNARRKAARAVPKATLMITTFMVPATMILLGAGLILG 280


>gi|319795783|ref|YP_004157423.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598246|gb|ADU39312.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 316

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 146/320 (45%), Gaps = 17/320 (5%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           + +LAVA   ++ + +L   +   +L + EL +     A+ R I R  +       +A  
Sbjct: 5   SAQLAVA---SLVLLALGLTIAAGALIATELRRARSGHAIGRAIRRGVETQIEPASTAEP 61

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDEN--IVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            +   D +   +++     +A++ DE+  ++++    G  S+ +  I LV R+ + ++  
Sbjct: 62  EVPRSDIELPFHWLDTRMGRALVADEDRQLIDQ---CGLPSQRAQLIFLVTRIALAVLLP 118

Query: 129 ILG-IIWIFGYDKLLEYPFQLRVGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDA 186
           +L   +W  G+        Q  V AV+++ +V GF  P   +      R+  + +  P  
Sbjct: 119 LLVYALWSTGHS-------QRTVIAVLVVAFVFGFMVPKWVLGQFAAARRERVAQELPLF 171

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +DLL +    G+S+DQ+L+ +A D       L  E+     + S    R+ + +      
Sbjct: 172 IDLLRLLQGVGLSLDQSLQIMANDFSHVLRVLGYELAFANRQYSQGRTREHSLQRLATLH 231

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
           + + +      L+Q DR+G +I + LR+     R  R  E + +   +  K+T  M+   
Sbjct: 232 KNENLGGLVSLLVQVDRHGGAIQEPLRIFSDRLREHRRSEMKDRIGKITVKMTGVMVTTL 291

Query: 307 LPVLILVIIGPAILSIIDTM 326
           LP LI+V  GP  ++II ++
Sbjct: 292 LPALIIVTAGPGFIAIIRSL 311


>gi|302558695|ref|ZP_07311037.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302476313|gb|EFL39406.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 295

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 4/160 (2%)

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           V I + ++ R+  I+R  PD LD+L + V +G+   QAL RV+    G   P ++E+ +T
Sbjct: 132 VGIWSAIRVRRDVIERTLPDFLDVLAVVVSAGLGFRQALDRVSSKYEG---PWADELRIT 188

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + ++    +R+ AF     R   + V     AL Q +  G  I D+L  L  + R     
Sbjct: 189 LRQMDLGMSRRQAFAELRRRNDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQ 248

Query: 286 EAEKKAASLGPKLTVPMIIFFLP-VLILVIIGPAILSIID 324
            A +KAA   PK T+ +  F +P  +IL+  G  + S ID
Sbjct: 249 NARRKAARAVPKATMMITTFMVPATMILLGAGLILGSGID 288


>gi|239817416|ref|YP_002946326.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239803993|gb|ACS21060.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 319

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 114/252 (45%), Gaps = 17/252 (6%)

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG-IIW 134
           DSK  R FV   + +  L+D+         GF S+ +  I LV RL++  +  I+  I+W
Sbjct: 79  DSKIGRAFVADEDRR--LIDQ--------CGFASKQAQLIFLVTRLLLAFLLPIISYIVW 128

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                 L E    + + A  +   VGF  P   +  +   R+  I R  P  +DLL +  
Sbjct: 129 ---KSHLTERTVLVVLAAAFV---VGFMTPKWALGRIAAGRRERIARELPLFVDLLKLLQ 182

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
             G+S+DQ+L+ +A+D       L  E+     + S    R+ +          + +R  
Sbjct: 183 GVGLSLDQSLQIMADDFSHVLHVLGHELTFANRQYSQGRTREHSLHRLATLHGNEDLRGL 242

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L+Q DR+G ++ + LR+     R  R  E +++   +  K+T  M+   LP L++V 
Sbjct: 243 VSLLVQVDRHGGAVQEPLRIFGERLRERRRSEMKERIGKITVKMTGVMVSTLLPALVIVT 302

Query: 315 IGPAILSIIDTM 326
            GP  ++I  ++
Sbjct: 303 AGPGFIAIFRSL 314


>gi|297157606|gb|ADI07318.1| integral membrane protein [Streptomyces bingchenggensis BCW-1]
          Length = 297

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 6/161 (3%)

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            +W +  V++R+ +I+R  PD LD+L + V +G+S  QAL RVAE   G   P ++E+ +
Sbjct: 135 GIWAA--VRERRHAIERTLPDFLDVLAVVVSAGLSFRQALDRVAEKYEG---PWADELRI 189

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AFE    R   + V      L Q +  G  I ++L  + ++ R    
Sbjct: 190 TLRQMDMGVSRRQAFEELRKRNDSEQVAQFVTTLQQGEELGAPIVETLIAIANDMRRTDA 249

Query: 285 MEAEKKAASLGPKLTVPMIIFFLP-VLILVIIGPAILSIID 324
             A ++AA   PK T+ +  F +P  +IL+I G  I S  D
Sbjct: 250 QNARRRAARAVPKATMVVTTFMVPGTMILLIAGFFIGSGTD 290


>gi|254393103|ref|ZP_05008263.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294814750|ref|ZP_06773393.1| Integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326443129|ref|ZP_08217863.1| putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
 gi|197706750|gb|EDY52562.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294327349|gb|EFG08992.1| Integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 295

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 3/137 (2%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+R  PD LD+L + V +G+   QAL RVAE   G   P S+E+ +T+ ++    +R+ A
Sbjct: 145 IERTLPDFLDVLAVVVSAGLGFRQALERVAEKYEG---PWSDELRITLRQMDMGVSRRDA 201

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           F+    R   + V     AL Q +  G  I D+L  + ++ R      A ++AA   PK 
Sbjct: 202 FDQLRRRNDSEQVSMFVTALQQGEELGAPIVDTLIQIATDMRRTDAQNARREAARAVPKS 261

Query: 299 TVPMIIFFLPVLILVII 315
           T+ + +  LP  +++I+
Sbjct: 262 TLVVTLVMLPATMILIV 278


>gi|218679577|ref|ZP_03527474.1| type II secretion system protein [Rhizobium etli CIAT 894]
          Length = 51

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 39/48 (81%)

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            E R ER+ EAEKKAA+L PKLTVPMI+FFLPVLI VI+GPA + + D
Sbjct: 2   QEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVSD 49


>gi|297202077|ref|ZP_06919474.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297148030|gb|EDY58317.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 296

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 3/146 (2%)

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           V I + ++ R+  I+R  PD LD+L + V +G+   QAL RVA    G   P ++E+ +T
Sbjct: 133 VGIWSAIRVRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVASKYEG---PWADELRIT 189

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + ++    +R+ AF     R   + V     AL Q +  G  I D+L  L  + R     
Sbjct: 190 LRQMDLGMSRRQAFAELRRRNDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQ 249

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLI 311
            A +KAA   PK T+ +  F +P  +
Sbjct: 250 NARRKAARAVPKATMMITTFMVPATM 275


>gi|221070078|ref|ZP_03546183.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220715101|gb|EED70469.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 317

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%)

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+S+DQ L+ +  D G     LS E+ L   + S    R+ +F       Q D + N T
Sbjct: 182 TGMSLDQTLQVIGSDFGNVMPVLSREIQLANQQYSRGGTRERSFARMSEVYQSDNLANLT 241

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             + Q DRYG ++ + LR+     R +R  + ++    +  K+T  M++  LP LI+V  
Sbjct: 242 SLMTQIDRYGGAVQEPLRIFGERLREQRKAKMKEMIGKISVKMTGVMVLTLLPALIIVTA 301

Query: 316 GPAILSIIDTM 326
           GP  L+++  +
Sbjct: 302 GPGFLAVMKAL 312


>gi|238789152|ref|ZP_04632940.1| Type II secretion system protein [Yersinia frederiksenii ATCC
           33641]
 gi|238722684|gb|EEQ14336.1| Type II secretion system protein [Yersinia frederiksenii ATCC
           33641]
          Length = 264

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 97/189 (51%), Gaps = 9/189 (4%)

Query: 141 LLEYPFQLRVGAVILIGYVGFCA----PSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           LL    +  +   I+IG +        P V I+ ++ +R  S+ ++ P  +D+   CV+S
Sbjct: 73  LLTNIIETNIDTFIIIGLITLMTTLYLPKVLINKVIIRRTESVLKSLPFFIDITAACVQS 132

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNA 254
           G++ID +L   A+     +  LS  M+  I  AE++ L   + A +  ++ +    ++  
Sbjct: 133 GMTIDNSLSYAAKKFELINHDLSLIMIRMIKRAEINGL---ESAIKELHHSSNALEIKMF 189

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             AL  S  +G+S+ D L  L  + R  +L+  E++ + L  KLT P+ +F L   ++++
Sbjct: 190 CSALQYSISFGSSVYDQLINLSQDMREMQLLVTEERISKLSAKLTFPLFLFILIPFVVLV 249

Query: 315 IGPAILSII 323
           I P++L I+
Sbjct: 250 ISPSVLEIL 258


>gi|21223384|ref|NP_629163.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|8218173|emb|CAB92604.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 300

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 85/171 (49%), Gaps = 6/171 (3%)

Query: 152 AVILIGYVGFCAPS-VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A++L+ +  F   + +W  + ++ R+  I+R  PD LD+L + V +G+   QAL RV+  
Sbjct: 124 ALLLLAFGAFWTEAGIW--SAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVSTR 181

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
             G   P ++E+ +T+ ++    +R+ AF     R   + V     AL Q +  G  I D
Sbjct: 182 YEG---PWADELRITLRQMDLGMSRREAFTELRRRNDSEQVAMFVTALQQGEELGAPIVD 238

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           +L  L  + R      A +KAA   PK T+ +  F +P  ++++    IL 
Sbjct: 239 TLVSLAKDMRRTDAQNARRKAARAVPKATLMITTFMVPATMILLGAGLILG 289


>gi|163801322|ref|ZP_02195221.1| hypothetical protein 1103602000598_AND4_10654 [Vibrio sp. AND4]
 gi|159174811|gb|EDP59611.1| hypothetical protein AND4_10654 [Vibrio sp. AND4]
          Length = 298

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 76/144 (52%), Gaps = 1/144 (0%)

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           K  +   LDLL    +SG++++ AL  V+E IG  S  LS  + +   ++S      +A 
Sbjct: 153 KTNFTYFLDLLATATKSGMTVELALVAVSEYIGNMSSSLSNYIKIYSNDIS-NNGFSIAG 211

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN      +  VR+ T  L  +   G  + D+LRVL  E R+   +E E+K   +  K+ 
Sbjct: 212 ENLRKSLDLPEVRDFTAVLENALESGAPVTDALRVLSKEIRNFHFIETEEKIGKVNAKMG 271

Query: 300 VPMIIFFLPVLILVIIGPAILSII 323
           +P+I+F +  +I+ II P +L+++
Sbjct: 272 IPLILFIMFPIIVEIIAPGVLNLL 295


>gi|33152381|ref|NP_873734.1| tight adherence protein C [Haemophilus ducreyi 35000HP]
 gi|33148604|gb|AAP96123.1| tight adherence protein C [Haemophilus ducreyi 35000HP]
          Length = 290

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 98/183 (53%), Gaps = 8/183 (4%)

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
           E  F L    V++   V    PS+ ++ +++ +   I    P  +DL+ + V++GISI+ 
Sbjct: 110 ELEFMLGEAVVVV---VAIMLPSMIVNMIIKSKIKRIMSDLPGFIDLVAVNVQTGISIEA 166

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           A ++V+ D    +  L+  +L  I  AEL+ L    VA ++         +R     + Q
Sbjct: 167 AFKQVSMDFERLNPDLTYVLLRIIRRAELTSL---NVALQDLAISLPTKEIRMFCTVMQQ 223

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           S  +G+S+ D+L +L ++ R  +L+  E+K  +L  K++VP+I+F +  +I++I+ P  +
Sbjct: 224 SLNFGSSVYDNLTMLSADIRDMQLLVMEEKLGTLAAKMSVPLILFVMFPIIILIVAPGAM 283

Query: 321 SII 323
            ++
Sbjct: 284 RVL 286


>gi|21326712|gb|AAL92472.1| TadC [Haemophilus ducreyi]
          Length = 281

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 98/183 (53%), Gaps = 8/183 (4%)

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
           E  F L    V++   V    PS+ ++ +++ +   I    P  +DL+ + V++GISI+ 
Sbjct: 101 ELEFMLGEAVVVV---VAIMLPSMIVNMIIKSKIKRIMSDLPGFIDLVAVNVQTGISIEA 157

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           A ++V+ D    +  L+  +L  I  AEL+ L    VA ++         +R     + Q
Sbjct: 158 AFKQVSMDFERLNPDLTYVLLRIIRRAELTSL---NVALQDLAISLPTKEIRMFCTVMQQ 214

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           S  +G+S+ D+L +L ++ R  +L+  E+K  +L  K++VP+I+F +  +I++I+ P  +
Sbjct: 215 SLNFGSSVYDNLTMLSADIRDMQLLVMEEKLGTLAAKMSVPLILFVMFPIIILIVAPGAM 274

Query: 321 SII 323
            ++
Sbjct: 275 RVL 277


>gi|330816719|ref|YP_004360424.1| Type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327369112|gb|AEA60468.1| Type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 329

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 111/241 (46%), Gaps = 14/241 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRL----VVPIIFLILGIIWIFGYDKLLEYP 145
           K ++ DE+    L   G+    +  + L  R+    V+P+  L++ ++   G   L+   
Sbjct: 94  KQLVADED-RQFLEQCGYVEARARGLFLFSRVLCASVLPLAVLMISLVRGSGGKSLIYIA 152

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           F +          +GF  P ++I      R+ S+    P  +D+L +    G+S+DQ+++
Sbjct: 153 FAI---------AIGFMLPKLYIRRKAAARRESVAEEMPLFVDMLRLLQGVGLSLDQSMQ 203

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
            ++ D       LS E+ +   + +    R+ +     +    + +R+  + LIQ D++G
Sbjct: 204 VISHDFTTMLPVLSWELGVAQRQFAAGRTREQSLARLTSSFDNEDLRSIVRLLIQVDKHG 263

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            ++ + LR+     R  R     ++   L  K+T  MI+  LP L++V  GP I++++  
Sbjct: 264 GAVQEPLRMFGDRLRDGRRALLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVVSA 323

Query: 326 M 326
           +
Sbjct: 324 L 324


>gi|153950588|ref|YP_001399590.1| type II secretion system protein [Yersinia pseudotuberculosis IP
           31758]
 gi|152962083|gb|ABS49544.1| type II secretion system protein [Yersinia pseudotuberculosis IP
           31758]
          Length = 277

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 112/219 (51%), Gaps = 12/219 (5%)

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
           NIL +  L+V  I  IL I+ IF    + +    L +G + +I  +    P + I N + 
Sbjct: 66  NILYLKVLIVIFILSILAILAIFNVVNINQKTL-LTIGLLSIISTLYL--PRMIIKNALT 122

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM--LLTIAELSF 231
           KR +++ ++ P  +D+   CV+SG++I+ +L    +     +  L   M  +   AE++ 
Sbjct: 123 KRTNTLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEING 182

Query: 232 LPN--RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           L N  +++ + +     +M C       L  S  +G+++ + L  L  + R  +L+  E+
Sbjct: 183 LENAIKELQYYSPAIEMKMFC-----STLQYSLSFGSTVYEQLTHLSQDMREMQLLMTEE 237

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             + L  KLT+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 238 SISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKN 276


>gi|304311188|ref|YP_003810786.1| type II secretion system protein [gamma proteobacterium HdN1]
 gi|301796921|emb|CBL45134.1| type II secretion system protein [gamma proteobacterium HdN1]
          Length = 319

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 83/175 (47%), Gaps = 12/175 (6%)

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
           KLL YP  L          VGF  P +W+S+ + +R+    + +P  LDLL++ + +G++
Sbjct: 134 KLLLYPLAL----------VGFFYPDIWLSDQINRRRRITLKEFPFMLDLLVLGMRAGLN 183

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
              AL    E +    +   +E    + E+    +R+ A     +R  ++ + N   A+ 
Sbjct: 184 YAAALGHAIEAMPNGVI--RDEFSKVLREIRAGKSRREALLTLADRMNLEAISNFVAAVN 241

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           Q +  G  I   L V   + R+ER   AE  A     ++ +PM++F  P++ +++
Sbjct: 242 QVEETGGEIVSVLMVQAEQRRNERFTAAEIAANKAPIRMLIPMMLFLFPIIFMLL 296


>gi|302553855|ref|ZP_07306197.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471473|gb|EFL34566.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 295

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 3/146 (2%)

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           V I + ++ R+  I+R  PD LD+L + V +G+   QAL RVA    G   P ++E+ +T
Sbjct: 132 VGIWSAIRIRKDVIERTLPDFLDVLAVVVSAGLGFRQALDRVASRYEG---PWADELRIT 188

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + ++    +R+ AF     R   + V     AL Q +  G  I D+L  L  + R     
Sbjct: 189 LRQMDLGMSRRQAFAELRRRNDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQ 248

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLI 311
            A +KAA   PK T+ +  F +P  +
Sbjct: 249 NARRKAARAVPKATMMITTFMVPATM 274


>gi|134295599|ref|YP_001119334.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134138756|gb|ABO54499.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 330

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 96/223 (43%), Gaps = 21/223 (9%)

Query: 113 LNILLVVRLVVPIIFLIL------GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           L+  LV  + VP++F IL      G  W  G                     VGF  P +
Sbjct: 122 LSARLVCGITVPLLFAILASGRMKGGYWTIGMFAAFS---------------VGFMLPKL 166

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           ++      R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G    LS E+ +  
Sbjct: 167 YVQRRAAARRQSVIDELPLFVDMLRLLQGVGLSLDQSLQVVTNDFRGMMPVLSSEVGIAQ 226

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            + +    R  + +   +    + +R   + ++Q D++G ++ + L+      R  R   
Sbjct: 227 RQFAAGRTRDQSMQRLSSGFDNEDLRAIARLMVQVDKHGGAVQEPLKQFGDRLRETRRAM 286

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
              +   L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 287 LRDRIGRLTVKMTGVMVVTLLPALLIVTAGPGLLAVMRALAVH 329


>gi|51597675|ref|YP_071866.1| hypothetical protein YPTB3377 [Yersinia pseudotuberculosis IP
           32953]
 gi|51590957|emb|CAH22615.1| Putative exported protein [Yersinia pseudotuberculosis IP 32953]
          Length = 277

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 112/219 (51%), Gaps = 12/219 (5%)

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
           NIL +  L+V  I  IL I+ IF    + +    L +G + +I  +    P + I N + 
Sbjct: 66  NILYLKVLIVIFILSILTILAIFNVVNINQKTL-LTIGLLSIISTLYL--PKMIIKNALT 122

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM--LLTIAELSF 231
           KR +++ ++ P  +D+   CV+SG++I+ +L    +     +  L   M  +   AE++ 
Sbjct: 123 KRTNNLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEING 182

Query: 232 LPN--RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           L N  +++ + +     +M C       L  S  +G+++ + L  L  + R  +L+  E+
Sbjct: 183 LENAIKELQYYSPAIEMKMFC-----STLQYSISFGSTVYEQLTHLSQDMREMQLLMTEE 237

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             + L  KLT+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 238 SISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKN 276


>gi|238796992|ref|ZP_04640496.1| Type II secretion system protein [Yersinia mollaretii ATCC 43969]
 gi|238719252|gb|EEQ11064.1| Type II secretion system protein [Yersinia mollaretii ATCC 43969]
          Length = 267

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 97/180 (53%), Gaps = 3/180 (1%)

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           VG ++LI  + +  P + I  ++ KR  SI ++ P  +D+   CV+SG++ID +L   A+
Sbjct: 91  VGLIVLIA-ISYL-PKMIIKKIITKRTESILKSLPFFIDITAACVQSGMTIDNSLSYSAK 148

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
                +  +S  ++L + +   +   + A +  +  T    +R    AL  S  +G+++ 
Sbjct: 149 KFKLINADISF-IMLKMTKRGEINGLESAIKELHQCTTAKEIRMFCSALQYSISFGSTVY 207

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           D L  L  + R  +L+  E++ + L  KLT+P+ +F L   I+++I P+IL II  ++++
Sbjct: 208 DQLTKLSQDIREMQLLVTEERISKLSAKLTIPLFLFILIPFIVLVISPSILEIITYVQNN 267


>gi|260914307|ref|ZP_05920776.1| Flp pilus assembly protein TadC [Pasteurella dagmatis ATCC 43325]
 gi|260631408|gb|EEX49590.1| Flp pilus assembly protein TadC [Pasteurella dagmatis ATCC 43325]
          Length = 285

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 89/171 (52%), Gaps = 1/171 (0%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A  LI  +    P +  +++++ +   I    P  +DL+ + V++GISID AL++VA D 
Sbjct: 111 ATALILVLTILIPGILTNSILKSKIKKIMVDLPGFIDLVAVNVQTGISIDAALKQVAIDF 170

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
              +  L+  ML  I + S +     A ++         VR     L QS  +G+SI   
Sbjct: 171 KKLNPDLTYVMLRIIRK-SEITGLSSALQDLSISLPTTEVRMFCSVLQQSLNFGSSIYSH 229

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L  L ++ R  +L+  E+K  +L  K+++P+I+F +  +I++I+ P I+ +
Sbjct: 230 LIQLSADIRELQLLTIEEKLGTLAAKMSIPLILFIMFPIIILILAPGIMRV 280


>gi|22127363|ref|NP_670786.1| hypothetical protein y3489 [Yersinia pestis KIM 10]
 gi|45442765|ref|NP_994304.1| hypothetical protein YP_3003 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809095|ref|YP_653011.1| hypothetical protein YPA_3104 [Yersinia pestis Antiqua]
 gi|108810710|ref|YP_646477.1| hypothetical protein YPN_0545 [Yersinia pestis Nepal516]
 gi|145597782|ref|YP_001161858.1| hypothetical protein YPDSF_0472 [Yersinia pestis Pestoides F]
 gi|150260282|ref|ZP_01917010.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162421097|ref|YP_001604880.1| hypothetical protein YpAngola_A0262 [Yersinia pestis Angola]
 gi|165925128|ref|ZP_02220960.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939890|ref|ZP_02228429.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009023|ref|ZP_02229921.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166212095|ref|ZP_02238130.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167419193|ref|ZP_02310946.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425195|ref|ZP_02316948.1| type II secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167466380|ref|ZP_02331084.1| type II secretion system protein [Yersinia pestis FV-1]
 gi|186896813|ref|YP_001873925.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927879|ref|YP_002345754.1| hypothetical protein YPO0688 [Yersinia pestis CO92]
 gi|229837370|ref|ZP_04457533.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Pestoides A]
 gi|229840582|ref|ZP_04460741.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842868|ref|ZP_04463020.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229900907|ref|ZP_04516031.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Nepal516]
 gi|270487717|ref|ZP_06204791.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|294502754|ref|YP_003566816.1| hypothetical protein YPZ3_0644 [Yersinia pestis Z176003]
 gi|21960448|gb|AAM87037.1|AE013952_4 hypothetical [Yersinia pestis KIM 10]
 gi|45437631|gb|AAS63181.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774358|gb|ABG16877.1| hypothetical protein YPN_0545 [Yersinia pestis Nepal516]
 gi|108781008|gb|ABG15066.1| hypothetical protein YPA_3104 [Yersinia pestis Antiqua]
 gi|115346490|emb|CAL19364.1| putative exported protein [Yersinia pestis CO92]
 gi|145209478|gb|ABP38885.1| hypothetical protein YPDSF_0472 [Yersinia pestis Pestoides F]
 gi|149289690|gb|EDM39767.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162353912|gb|ABX87860.1| type II secretion system protein [Yersinia pestis Angola]
 gi|165912201|gb|EDR30839.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923328|gb|EDR40479.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992362|gb|EDR44663.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166206841|gb|EDR51321.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166963187|gb|EDR59208.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167055958|gb|EDR65739.1| type II secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186699839|gb|ACC90468.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682246|gb|EEO78338.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Nepal516]
 gi|229690135|gb|EEO82192.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696948|gb|EEO86995.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229705493|gb|EEO91503.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Pestoides A]
 gi|262364731|gb|ACY61288.1| hypothetical protein YPD8_0598 [Yersinia pestis D182038]
 gi|270336221|gb|EFA46998.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|294353213|gb|ADE63554.1| hypothetical protein YPZ3_0644 [Yersinia pestis Z176003]
 gi|320016749|gb|ADW00321.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 277

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 112/219 (51%), Gaps = 12/219 (5%)

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
           NIL +  L+V  I  IL I+ IF    + +    L +G + +I  +    P + I N + 
Sbjct: 66  NILYLKVLIVIFILSILTILAIFNVVNINQKTL-LTIGLLSIISTLYL--PRMIIKNALT 122

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM--LLTIAELSF 231
           KR +++ ++ P  +D+   CV+SG++I+ +L    +     +  L   M  +   AE++ 
Sbjct: 123 KRTNNLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEING 182

Query: 232 LPN--RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           L N  +++ + +     +M C       L  S  +G+++ + L  L  + R  +L+  E+
Sbjct: 183 LENAIKELQYYSPAIEMKMFC-----STLQYSISFGSTVYEQLTHLSQDMREMQLLMTEE 237

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             + L  KLT+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 238 SISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKN 276


>gi|302542847|ref|ZP_07295189.1| putative integral membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302460465|gb|EFL23558.1| putative integral membrane protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 297

 Score = 66.2 bits (160), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 84/161 (52%), Gaps = 6/161 (3%)

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            +W +  V++R+ +I R  PD LD+L + V +G+   QAL RV+E   G   P ++E+ +
Sbjct: 135 GIWAA--VRERKDAIDRTLPDFLDVLAVVVSAGLGFRQALDRVSEKYEG---PWADELRI 189

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T+ ++    +R+ AFE    R   + V     AL Q +  G  I ++L  + ++ R    
Sbjct: 190 TLRQMDMGVSRRQAFEELRKRNDSEQVAQFVTALQQGEELGAPIVETLIAIANDMRRTDA 249

Query: 285 MEAEKKAASLGPKLTVPMIIFFLP-VLILVIIGPAILSIID 324
             A ++AA   PK T+ +  F +P  ++L++ G  I S  D
Sbjct: 250 QNARRRAARAVPKATMVITTFMVPGTMVLLVAGFFIGSGTD 290


>gi|218663023|ref|ZP_03518953.1| putative tadC pilus assembly protein [Rhizobium etli IE4771]
          Length = 145

 Score = 66.2 bits (160), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 74/138 (53%)

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +L++C+++G+SI+ A  RVA +   +       + + + E+      + A  N   R ++
Sbjct: 1   MLIVCLDAGMSIEAAANRVAREFVDKQQDFGLHLSIMMLEVRGGRRLREALANLATRLRI 60

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D  R       QS+  GTS+  +LRV   E R  R++ AE+KA +L  K+ +P+  F  P
Sbjct: 61  DEARALAVLFRQSEELGTSVTQTLRVYSKEMRDLRIVRAEEKANALPVKMLLPLGAFLFP 120

Query: 309 VLILVIIGPAILSIIDTM 326
           V +++++ P ++ ++  +
Sbjct: 121 VSLIIVLVPIVIRVVSLL 138


>gi|148556412|ref|YP_001263994.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148501602|gb|ABQ69856.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 297

 Score = 65.9 bits (159), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 112/267 (41%), Gaps = 19/267 (7%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDEN-----IVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           RT  +++ R     L L A L         I  +LR AG     ++   L +RL    + 
Sbjct: 38  RTVSAQAARPLWGGLKLPAFLAPRGRDGSEIARELREAGIHHPRAIEYFLWLRLGATAVA 97

Query: 128 LILGIIW-IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             L  I  +      L  P       VIL G   +      +  L   RQ +I   +P  
Sbjct: 98  CGLAAIANLVATGAPLSRPVP-----VILAGAGAYLLSKRLLHFLKGVRQRAITAEFPFL 152

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE----NF 242
           LDLL + +ESG+S+DQ  R +A +   ++ P    +  T+  L F  +R ++++     +
Sbjct: 153 LDLLQMMLESGLSLDQCFRSIATE-ENEATP---RLAATVRRLVFDLDRGMSYDAALGRW 208

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT +   +       Q+   GT +  +LR    E    R+  A +    +  ++ + +
Sbjct: 209 AERTAVGGAKELASLFQQALLQGTELAPALRTFTREFTERRIAHARESIGRISVQMVLVL 268

Query: 303 IIFFLPVLILVIIGPAILSIIDTMKDH 329
           I  FLP + +V+ GP + S+ D ++  
Sbjct: 269 IACFLPAIFIVVGGPPVASLFDMIRSE 295


>gi|170724975|ref|YP_001759001.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810322|gb|ACA84906.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 281

 Score = 65.9 bits (159), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           R  P  LD++ +CV++G++++ AL  +AE++      L   +  T A+ S +   + A  
Sbjct: 138 RQLPYMLDMMSVCVQTGMTVEAALAYLAEELKAFDKDLCFHIKKT-ADTSRITGLEKALL 196

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               R     VR+ +  LIQ+ +YGTSI + L  L  + R  +++  E+    L  K++V
Sbjct: 197 ELSERIPTPEVRSFSLTLIQNIQYGTSIANVLADLAEDMRQMQVLAMEESIGKLAAKMSV 256

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           P+I+F +  ++++I+ P  + +
Sbjct: 257 PLILFIMFPIVVLILAPGFMQL 278


>gi|116689547|ref|YP_835170.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|116647636|gb|ABK08277.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 332

 Score = 65.5 bits (158), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 102/225 (45%), Gaps = 5/225 (2%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L   GF    +  + +  R+V  I+   L ++ + G  +   +P  L +  V      G+
Sbjct: 108 LEQCGFVDVRARALFVGARIVCAILLPALAVLVLIGRGQQARWPLWLSIALV-----TGY 162

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D       LS E
Sbjct: 163 MLPKIYVRRRATARRQSLAAELPLLVDMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWE 222

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           + +   + +    R+ + +   N    + +R   + LIQ D++G ++ + L+      R 
Sbjct: 223 LGVAQRQFAAGRTREQSLQRLTNSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLRE 282

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R     ++   L  K+T  MI+  LP L++V  GP I++++  +
Sbjct: 283 GRRATLREQIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVLSAL 327


>gi|107022598|ref|YP_620925.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|105892787|gb|ABF75952.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
          Length = 321

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 102/225 (45%), Gaps = 5/225 (2%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L   GF    +  + +  R+V  I+   L ++ + G  +   +P  L +  V      G+
Sbjct: 97  LEQCGFVDVRARALFVGARIVCAILLPALAVLVLIGRGQQARWPLWLSIALV-----TGY 151

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D       LS E
Sbjct: 152 MLPKIYVRRRATARRQSLAAELPLLVDMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWE 211

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           + +   + +    R+ + +   N    + +R   + LIQ D++G ++ + L+      R 
Sbjct: 212 LGVAQRQFAAGRTREQSLQRLTNSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLRE 271

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R     ++   L  K+T  MI+  LP L++V  GP I++++  +
Sbjct: 272 GRRATLREQIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVLSAL 316


>gi|170732851|ref|YP_001764798.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169816093|gb|ACA90676.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 332

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 102/225 (45%), Gaps = 5/225 (2%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L   GF    +  + +  R+V  I+   L ++ + G  +   +P  L +  V      G+
Sbjct: 108 LEQCGFVDVRARALFVGARIVCAILLPALAVLVLIGRGQQARWPLWLSIALV-----TGY 162

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D       LS E
Sbjct: 163 MLPKIYVRRRATARRQSLGAELPLLVDMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWE 222

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           + +   + +    R+ + +   N    + +R   + LIQ D++G ++ + L+      R 
Sbjct: 223 LGVAQRQFAAGRTREQSLQRLTNSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLRE 282

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R     ++   L  K+T  MI+  LP L++V  GP I++++  +
Sbjct: 283 GRRATLREQIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVLSAL 327


>gi|78486064|ref|YP_391989.1| type II secretion system protein [Thiomicrospira crunogena XCL-2]
 gi|78364350|gb|ABB42315.1| Flp (type IV) pilus assembly protein, TadB homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 296

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 115/260 (44%), Gaps = 17/260 (6%)

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           Q  +  +R +T    +L  F+   N K I  +      L  AGFR E+ L     ++   
Sbjct: 45  QYQANVNRHKTCHWCALGAFMGPKNEKEINANRQF---LMNAGFREEHHLGAYFFIKYA- 100

Query: 124 PIIF---LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
            ++F   L++ ++W +         FQ+     IL+       P   +      R + + 
Sbjct: 101 -LVFSSLLVMLVLWSW---------FQVSPIVAILVPLAFLLLPERVLIFWGNHRLNKVN 150

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
            A PD LD+  IC+ +G+S  +A++RV++++      +  E    I ++     RQ A +
Sbjct: 151 IALPDFLDMANICMSAGLSYLEAIKRVSKELESTFPEICYEFNFLIEQIKIGVPRQEALK 210

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
            F  R     +++  Q LIQ+++ G+ I  +L         +R    E+KAA    K+ +
Sbjct: 211 QFALRNPSKDIQDLVQMLIQNEKLGSPISTALNEFSRRMYQKRESAMEEKAAKTSAKMAI 270

Query: 301 PMIIFFLPVLILVIIGPAIL 320
            ++ F +    ++++G  I+
Sbjct: 271 VILPFLMLPYFMLMLGEKIV 290


>gi|295395665|ref|ZP_06805857.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971481|gb|EFG47364.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 297

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 76/157 (48%), Gaps = 3/157 (1%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G   P   +    +KRQ +I+ + PD LD+L + V +G+S   A+ +V E   G   PL
Sbjct: 130 IGLLFPDFALIQSGRKRQEAIEDSLPDFLDVLAVTVSAGLSFRSAIAKVTERTQG---PL 186

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E+   + +L+       AF     RT  + + +    L+Q++  G  + D+L  +  +
Sbjct: 187 ADELNTVLHQLNMGETVYDAFSALRKRTTSESLDSFITTLLQAEELGAPLADTLATIALD 246

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            R      A +KAA   PK+   + I  +P  + +I+
Sbjct: 247 MRQTTAQRARQKAAKASPKIAGVVTIIMVPGTMALIM 283


>gi|167587310|ref|ZP_02379698.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 264

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 108/247 (43%), Gaps = 26/247 (10%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVR----LVVPIIFL------ILGIIWIFGYD 139
           + I+ DE+    L   G+    +  + L  R    LV P++FL      + G  W+ G  
Sbjct: 29  RHIVADED-RRLLEQCGYVDARTRGLFLSARIAGALVAPVLFLAFVGPRLHGGRWVLG-- 85

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                        ++L    GF  P + I      R+ ++    P  +D+L +    G+S
Sbjct: 86  -------------LVLAFVTGFMLPKILIRRRAAARRQAVVDELPLLVDMLRLLQGVGLS 132

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           +DQ+L+ V  D  G    LS EM +   + +    R+ + +   +    + +R   + +I
Sbjct: 133 LDQSLQVVTNDFRGMMPVLSSEMGIAQRQFAAGRTREQSLQRLASGFDNEDLRAIVRLMI 192

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q D++G ++ + L+      R  R     ++   L  K+T  MI+  LP L++V  GP +
Sbjct: 193 QVDKHGGAVQEPLKQFGDRLREARRAMLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGM 252

Query: 320 LSIIDTM 326
           +S++  +
Sbjct: 253 ISVMHAL 259


>gi|332534353|ref|ZP_08410194.1| type II secretion system protein [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036172|gb|EGI72646.1| type II secretion system protein [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 271

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 86/174 (49%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +L+ +V F AP  W      +R++ I  +    L +LL+ + +G S++++     +    
Sbjct: 92  LLLCFVCFFAPECWFLLRKNQRKTVINNSLEFFLRVLLVYMRAGFSLERSFALAVDHGLS 151

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           Q  PL +E+ L + ELS   +R+ AF + + RT +  ++  T  ++   + GT +  ++ 
Sbjct: 152 QKHPLYKELKLFLFELSAGKDREFAFNSLFERTGVLGIKKLTNLMLIGSKLGTPLIQAVE 211

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
             +     ++ +   KK        T P+I+   P+ ++++  PA L +++ +K
Sbjct: 212 AQLEGLALKKNILLAKKVNKKAMHTTFPIILICFPMFLVLVFFPAALQVMNVLK 265


>gi|206559898|ref|YP_002230662.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035939|emb|CAR51831.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 332

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 102/225 (45%), Gaps = 5/225 (2%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L   GF    +  + +  R+V  I+   L ++ + G  +   +P  + V  V      G+
Sbjct: 108 LEQCGFVDVRARALFVGARIVCAILLPALAVLVLIGRGQQTRWPLWISVALV-----TGY 162

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +++      R+ SI    P  +D+L +    G+S+DQ+++ V  D       LS E
Sbjct: 163 MLPKIYVRRRATARRQSIAAELPLLVDMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWE 222

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           + +   + +    R+ + +   N    + +R   + LIQ D++G ++ + L+      R 
Sbjct: 223 LGVAQRQFAAGRTREQSLQRLTNSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLRE 282

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R     ++   L  K+T  MI+  LP L++V  GP I++++  +
Sbjct: 283 GRRATLREQIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVLAAL 327


>gi|319779646|ref|YP_004130559.1| Type II/IV secretion system protein TadC [Taylorella equigenitalis
           MCE9]
 gi|317109670|gb|ADU92416.1| Type II/IV secretion system protein TadC [Taylorella equigenitalis
           MCE9]
          Length = 267

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 81/171 (47%), Gaps = 8/171 (4%)

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           ++    P  +I   + KR++ +   +P  LD+L + + SG +   +L+         S+P
Sbjct: 101 FITLLWPKAYIKRYISKRRTELSEIFPFFLDVLSVSLSSGQNFTMSLQYAFN-----SLP 155

Query: 218 ---LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              L +E+  TI E+     +  A ++   R+ ++ V+     + Q+D+ G  +  + R 
Sbjct: 156 NGVLKDELGFTIREMQAGKPKLEAIDDMAQRSDLNVVKQWVNNIKQADQLGLQLASAFRA 215

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             S  R +R + AEK A     K+  P++ F  P   +V++ P  + I+++
Sbjct: 216 QASYIRKQRYLMAEKLAFEAPVKMLFPLVFFIFPCTFIVLLFPVFMQILES 266


>gi|83747913|ref|ZP_00944945.1| TRANSMEMBRANE TIGHT ADHERENCE TADC RELATED PROTEIN; tadC2
           [Ralstonia solanacearum UW551]
 gi|207739454|ref|YP_002257847.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
 gi|83725446|gb|EAP72592.1| TRANSMEMBRANE TIGHT ADHERENCE TADC RELATED PROTEIN; tadC2
           [Ralstonia solanacearum UW551]
 gi|206592830|emb|CAQ59736.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
          Length = 326

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 108/243 (44%), Gaps = 14/243 (5%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L   +V E     L   G+  E +  +    R+++P    +LG+++   + K L + F 
Sbjct: 87  GLGQRIVTEEDRRLLEECGYYGEQARTVFGGTRILLPPFLCVLGVLYAAAFWKALLWGF- 145

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
               A   +GY+G   P   ++   + R+  +    P  +D+L +    G+SIDQ+L+ +
Sbjct: 146 ----AGFALGYLG---PKWLLTRRKESRRRRVDDELPVMVDMLRLLQGVGLSIDQSLQVI 198

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A +  G    L+ E      + +    R+            + ++     L Q DR+G +
Sbjct: 199 ANEFYGMLPVLAGEFGRANQQFASGRPREQTLLRIAKMFDSEDLKGLITLLTQVDRFGGA 258

Query: 268 IGDSLR---VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           + + LR   V + E R  RL E   +   L  K+TV M++  LP L+++  GP  +S+  
Sbjct: 259 VQEPLRQFGVRLQENRRSRLKE---RVGKLTVKMTVVMVLTLLPALLIITAGPGFVSVTR 315

Query: 325 TMK 327
           T+ 
Sbjct: 316 TLH 318


>gi|303241938|ref|ZP_07328431.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590493|gb|EFL60248.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 289

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 119/268 (44%), Gaps = 29/268 (10%)

Query: 81  RNFVKKLNL-KAILVDENIVNKLRAAGFR---SEY----------------SLNILLVVR 120
           +NF   L   KA+ V+E+ + +L+    R   +EY                S+  +L   
Sbjct: 30  KNFASNLYFSKAVTVEESFLKRLKNRIIRLMGNEYQEKMRIMLLQADMENVSVETVLFTS 89

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           ++  +I   L  I + GY  +L   F    GA     + GF  P  +I   V KR+  + 
Sbjct: 90  IIASVIAATLFSIILTGYGNILAV-FGFIAGA-----FTGFKIPEAYIKRKVDKRKDILN 143

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
                 ++LL    ++G++ + A+ R+A++       L++E+     E      R+ A +
Sbjct: 144 ATILYYVELLSTACQAGLNTENAIERIADNTNS---ILADEIKRIWKESYKTKTREEAIQ 200

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           +   R   + VR   +++ Q    GT + D L+      RS    E  KK      K+  
Sbjct: 201 DMIQRCGTNEVRLFMESVGQGLEMGTPVTDILKDQARSIRSRAKSEIVKKGELAKVKIVF 260

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKD 328
           PMI+F LP ++LV + PA+++++  +++
Sbjct: 261 PMILFLLPSVLLVALTPALITLMKIIQE 288


>gi|54309665|ref|YP_130685.1| Flp pilus assembly protein TadC [Photobacterium profundum SS9]
 gi|46914103|emb|CAG20883.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum SS9]
          Length = 283

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 97/183 (53%), Gaps = 7/183 (3%)

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK--RAWPDALDLLLICVESGIS 199
           L +  Q  +GAV +I  +    P + +S  ++K+   +K  R  P  LD++ +CV++G++
Sbjct: 100 LSFTNQAAIGAVAMIAIL--LVPEMVLS--MRKKALILKTSRQLPYMLDMMSVCVQTGMT 155

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           I+ AL  ++ ++      L   +  T A+ + +   + A      R     VR+ T  LI
Sbjct: 156 IEAALTYLSTELEAFDRDLCFHIKKT-ADSARVKGLEKALIELSERIPTPDVRSFTLTLI 214

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q+ +YGTSI + L  L  + R  +++  E+K   L  K++VP+I+  +  ++++I+ P +
Sbjct: 215 QNLQYGTSIANVLSALAEDMRKMQVLTMEEKIGKLAAKMSVPLILLIMFPIVILILAPGM 274

Query: 320 LSI 322
           + +
Sbjct: 275 MQM 277


>gi|238027558|ref|YP_002911789.1| type II secretion system protein [Burkholderia glumae BGR1]
 gi|237876752|gb|ACR29085.1| Type II secretion system protein [Burkholderia glumae BGR1]
          Length = 330

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 105/234 (44%), Gaps = 7/234 (2%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K ++ DE+    L   G+    S  + LVVRL   I  L L I+    +    ++ F L 
Sbjct: 96  KQLVADED-RKLLEQCGYVEARSRGLFLVVRLACAI-GLPLAILPFLTHGGPGKWLFGL- 152

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
                L    GF  P V++      R+ S+    P  +D+L +    G+S+DQ+++ +  
Sbjct: 153 ----FLALAAGFMLPKVYVRRRAAARRESVADEMPLFVDMLRLLQGVGLSLDQSMQVITH 208

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           D       LS E+ +   + +    R+ +          + +R   + LIQ D++G ++ 
Sbjct: 209 DFTSMLPVLSWELGVAQRQFAAGRTREQSLARLTTSFDNEDLRAIVRLLIQVDKHGGAVQ 268

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + LR+     R  R     ++   L  K+T  MI+  LP L++V  GP I++++
Sbjct: 269 EPLRLFGDRLREGRRATLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGIMTVV 322


>gi|221197785|ref|ZP_03570831.1| type II secretion system protein [Burkholderia multivorans CGD2M]
 gi|221204657|ref|ZP_03577674.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221213135|ref|ZP_03586111.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221167348|gb|EED99818.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221175514|gb|EEE07944.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221181717|gb|EEE14118.1| type II secretion system protein [Burkholderia multivorans CGD2M]
          Length = 330

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 83/171 (48%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VGF  P ++I      R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G    L
Sbjct: 159 VGFMLPKLYIRRRAAARRQSVGNELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGMLPVL 218

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S E+ +   + +    R+ + +   +    + +R   + +IQ D++G ++ + L+     
Sbjct: 219 SSEVGIAQRQFAAGRTREQSLQRLSSGFDNEDLRAVVRLMIQVDKHGGAVQEPLKQFGDR 278

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            R  R     ++   L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 279 LRETRRALLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGMLAVMRALSPH 329


>gi|307133501|dbj|BAJ19013.1| TadC [Aggregatibacter actinomycetemcomitans]
          Length = 288

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 131/268 (48%), Gaps = 18/268 (6%)

Query: 56  RKQQITSLQ-KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           RK+ IT  + KD  S  +    SK      +++ L+ +L++ N +  L+  G   +    
Sbjct: 33  RKEIITGERPKDQDSDEVAKNKSK------QQIELELLLINNNPI--LKVLGIIDKN--- 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
               +++ + I+ L+ G+ +++           L +G + ++  V    P V I ++++ 
Sbjct: 82  ----IKVKLLIMLLLFGVYYLYSLTDEATDSSSLLLGFLTIL-IVTIVVPGVLIGSILKA 136

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           +   I       +DL+ + V++GISI+ AL++VA D    +  L+  ML  I + S +  
Sbjct: 137 KIKKIMNDLAGFIDLVAVNVQTGISIEAALKQVATDFKTLNPDLTYVMLRIIRK-SEITG 195

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
              A ++         +R     + QS  +G+SI   L  L ++ R  +L+  E+K  +L
Sbjct: 196 MSQALQDLSVSLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSTDIREIQLLAIEEKLGTL 255

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSI 322
             K+++P+I+F +  +I++I+ P ++ +
Sbjct: 256 SAKMSIPLILFIMFPIIILILAPGVMRV 283


>gi|300694107|ref|YP_003750080.1| type II secretion system protein [Ralstonia solanacearum PSI07]
 gi|299076144|emb|CBJ35457.1| Type II secretion system protein [Ralstonia solanacearum PSI07]
          Length = 324

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 108/239 (45%), Gaps = 16/239 (6%)

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           +V E     L A G+  E +  +    R+++P +  ++G+++     K L + F      
Sbjct: 90  IVTEEDRKLLEACGYYGEQARTVFGGTRILLPPLLCVVGVLYAGELGKALLWGFA----- 144

Query: 153 VILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
               G+ +G+ AP   ++   + R+  +    P  +D+L +    G+SIDQ+L+ +A + 
Sbjct: 145 ----GFALGYLAPKWLLARRKESRRRRVDDELPAMVDMLRLLQGVGLSIDQSLQVIANEF 200

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G    L+ E      + +    R+            + ++     L Q DR+G ++ + 
Sbjct: 201 HGMLPVLAGEFGRANQQFASGRPREQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEP 260

Query: 272 LR---VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LR   V + E R  RL E   +   L  K+TV M++  LP L+++  GP  +S+  ++ 
Sbjct: 261 LRQFGVRLQENRRSRLKE---RVGKLTVKMTVVMVLTLLPALLIITAGPGFMSVTRSLN 316


>gi|73539235|ref|YP_299602.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72122572|gb|AAZ64758.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 344

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 115/260 (44%), Gaps = 17/260 (6%)

Query: 69  SSRLRTR-DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            +RL  R D+  LR     L  +A++  E I+  L   G+    +  I   +RL VP++ 
Sbjct: 87  GARLGGRVDAHWLRWLDSPLG-RAVVTAEEIL-LLEQCGWHGLRARAIFGALRLNVPVLL 144

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGY----VGFCAPSVWISNLVQKRQSSIKRAW 183
            +    W  G            + A +  G+    V + AP  ++    Q R  S++   
Sbjct: 145 ALCAAAWHVGQG----------LAASLAWGFATFAVSYLAPKHYLRRRAQARLRSVEDEL 194

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P  +D+L +    G+SIDQ+L+ +  + GG    L  E+ L+  + +   +R+       
Sbjct: 195 PIVIDMLRLLQGVGLSIDQSLQIIVSEFGGMLRVLGPELALSNQQFASGRSREQTLLRIG 254

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
                + +++    L Q DR+G ++ + LR+     +  R    + +   L  K+T  M+
Sbjct: 255 RLFDSENLKSLITLLTQVDRHGGAVQEPLRLFGQRMQEARKSRMKDEIGRLTVKMTAVMV 314

Query: 304 IFFLPVLILVIIGPAILSII 323
           +  LPVL+++  GP  L +I
Sbjct: 315 VSMLPVLLIITAGPGFLGVI 334


>gi|283787697|ref|YP_003367562.1| tight adherence protein C [Citrobacter rodentium ICC168]
 gi|282951151|emb|CBG90842.1| putative tight adherence protein C [Citrobacter rodentium ICC168]
          Length = 283

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 83/154 (53%), Gaps = 3/154 (1%)

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           ++  R   I    P  +D++ ICV+SG++I+  +R +AE+    +  +S  +  TI ++ 
Sbjct: 126 IIDSRVRRICNDLPYIIDIMAICVQSGMTIENTIRYLAENTETINPDISVLLARTIMKME 185

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
            +     A +  YN      +R     L QS ++G+SI   L  L  E R  +L+  ++K
Sbjct: 186 -VSGMSEALDLLYNEVPSQEIRMLASTLQQSIKFGSSIYLLLLDLSREIREMQLLAIDEK 244

Query: 291 AASLGPKLTVPMIIFFL-PVLILVIIGPAILSII 323
            +SL  K+++PMII  + P+L+LV  GP ++ I+
Sbjct: 245 ISSLAAKMSLPMIICIMFPILVLV-AGPGVIRIV 277


>gi|33596530|ref|NP_884173.1| hypothetical protein BPP1912 [Bordetella parapertussis 12822]
 gi|33566299|emb|CAE37212.1| putative membrane protein [Bordetella parapertussis]
          Length = 298

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 4/135 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL-SFLPNRQVAFENF 242
           P  LDL+ +C E+G+ +  AL++ A    G   PL E ++  + ++ + +P RQ A +  
Sbjct: 157 PFILDLMTLCAEAGLGMHGALQQAASH--GPPGPLRELLVQALCDMRAGMPRRQ-AMQAL 213

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R     VR    AL  +D  G S+G  LR L +  R+ER   AE+ A     K+ +P+
Sbjct: 214 AARADSPPVRAWVGALAHADAQGMSLGPMLRGLATRYRAERHQRAERLAMEAPVKMLLPL 273

Query: 303 IIFFLPVLILVIIGP 317
           I    P   +V+  P
Sbjct: 274 IACIFPCTFIVLAFP 288


>gi|33601083|ref|NP_888643.1| hypothetical protein BB2100 [Bordetella bronchiseptica RB50]
 gi|33575518|emb|CAE32596.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 298

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 4/135 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL-SFLPNRQVAFENF 242
           P  LDL+ +C E+G+ +  AL++ A    G   PL E ++  + ++ + +P RQ A +  
Sbjct: 157 PFILDLMTLCAEAGLGMHGALQQAASH--GPPGPLRELLVQALCDMRAGMPRRQ-AMQAL 213

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R     VR    AL  +D  G S+G  LR L +  R+ER   AE+ A     K+ +P+
Sbjct: 214 AARADSPPVRAWVGALAHADAQGMSLGPMLRGLATRYRAERHQRAERLAMEAPVKMLLPL 273

Query: 303 IIFFLPVLILVIIGP 317
           I    P   +V+  P
Sbjct: 274 IACIFPCTFIVLAFP 288


>gi|149188841|ref|ZP_01867131.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
 gi|148837261|gb|EDL54208.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
          Length = 283

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 80/144 (55%), Gaps = 1/144 (0%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I R  P  LD++ +CV++G++I+ +   + +++      LS ++  T ++   +   + A
Sbjct: 134 ISRNLPYVLDIMSVCVQTGMTIEASFDYLHKELAAFDSDLSYQIKKT-SDAGKIHGIEKA 192

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
             +  NR     V++    +IQ+ +YGTS+ + L  L  + R  +L++ E+K   L  K+
Sbjct: 193 LNDLNNRLPAPEVQSFVLTIIQNLQYGTSVANILSDLAEDMRRIQLLKVEEKVGKLSAKM 252

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           +VP+I+  +  ++++I+ P ++ +
Sbjct: 253 SVPLILLIMFPIVILILAPGVMQL 276


>gi|254381954|ref|ZP_04997317.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194340862|gb|EDX21828.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 297

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 79/155 (50%), Gaps = 8/155 (5%)

Query: 167 WIS----NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           WI     + ++ R+  I+R  PD LD+L + V +G+    AL RVA+   G   P S+E+
Sbjct: 130 WIEFGLWSAIRIRRDHIERTLPDFLDVLAVVVSAGLGFRPALERVADKYEG---PWSDEI 186

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +T+ +++   +R+ AF+    R   + V     AL Q +  G+ I ++L  L  + R  
Sbjct: 187 RITLQQMTMGVSRRQAFDELRRRNDSEQVAQFVTALQQGEELGSPIVETLIALAEDMRRT 246

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLP-VLILVIIG 316
               A ++AA   PK T  +  F LP  LIL++ G
Sbjct: 247 DAQNARRRAARAVPKATFAVTTFMLPGTLILLVCG 281


>gi|148975967|ref|ZP_01812756.1| hypothetical Flp pilus assembly protein TadC [Vibrionales bacterium
           SWAT-3]
 gi|145964712|gb|EDK29965.1| hypothetical Flp pilus assembly protein TadC [Vibrionales bacterium
           SWAT-3]
          Length = 280

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 91/173 (52%), Gaps = 5/173 (2%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQ----SSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +L+  V   A  V    L+Q R+    S      P  LD++ +CV++G++I+ +L  + +
Sbjct: 105 LLVVIVSLIAVIVVPDTLLQMRRKMLISKTSAQLPYLLDMMSVCVQTGMTIEASLVYLGK 164

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++      L  ++  T ++ + +   + A  +   R     +R+    +IQ+ +YGTS+ 
Sbjct: 165 ELAEFDSDLCYQIKRT-SDSAKIHGVEKALNDLTERIPTPAIRSFVLTIIQNLQYGTSVA 223

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            +L  L  + R  +++  E+K   L  K++VP+I+F +  ++++I+ P+I+ +
Sbjct: 224 QTLSDLAEDMRKVQILTVEEKVGKLSAKMSVPLILFIMFPIVILILAPSIMQM 276


>gi|182436318|ref|YP_001824037.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776948|ref|ZP_08236213.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464834|dbj|BAG19354.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657281|gb|EGE42127.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 295

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (49%), Gaps = 5/139 (3%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +    +W  + ++ R+  I+R  PD LD+L + V +G+   QAL RVAE   G   P S+
Sbjct: 129 WVEAGIW--SAIRVRREHIERTLPDFLDVLAVVVSAGLGFRQALDRVAEKYEG---PWSD 183

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +T+ ++    +R+ AFE    R   + V      L Q +  G  I ++L  + ++ R
Sbjct: 184 ELRITLRQMDMGVSRRQAFEELRRRNDSEQVAMFVTTLQQGEELGAPIVETLIQIANDMR 243

Query: 281 SERLMEAEKKAASLGPKLT 299
                 A +KAA   PK T
Sbjct: 244 RTDAQNARRKAARAVPKAT 262


>gi|239943899|ref|ZP_04695836.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           15998]
 gi|239990353|ref|ZP_04711017.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           11379]
 gi|291447362|ref|ZP_06586752.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291350309|gb|EFE77213.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 295

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (49%), Gaps = 5/139 (3%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +    +W  + ++ R+  I+R  PD LD+L + V +G+   QAL RVAE   G   P S+
Sbjct: 129 WVEAGIW--SAIRVRREHIERTLPDFLDVLAVVVSAGLGFRQALDRVAEKYEG---PWSD 183

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +T+ ++    +R+ AFE    R   + V      L Q +  G  I ++L  + ++ R
Sbjct: 184 ELRITLRQMDMGVSRRQAFEELRRRNDSEQVAMFVTTLQQGEELGAPIVETLIQIANDMR 243

Query: 281 SERLMEAEKKAASLGPKLT 299
                 A +KAA   PK T
Sbjct: 244 RTDAQNARRKAAKAVPKAT 262


>gi|15602712|ref|NP_245784.1| hypothetical protein PM0847 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721156|gb|AAK02931.1| TadC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 284

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 91/173 (52%), Gaps = 2/173 (1%)

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           +G  I++ ++    P +  + +++ +   I    P  +DL+ + V++GISID AL++VA 
Sbjct: 109 IGLSIILVFI-IVIPGILTNAILKAKVKKIMVDLPGFIDLVAVNVQTGISIDAALKQVAI 167

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           D    +  L+  ML  I + S L     A ++         +R     L QS  +G+SI 
Sbjct: 168 DFKKLNPDLTYVMLRIIRK-SELTGLSQALQDLSISLPTTEIRMFCTVLQQSLNFGSSIY 226

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             L  L ++ R  +L+  E+K  +L  K+++P+I+F +  +I++I+ P I+ +
Sbjct: 227 SHLIQLSADIREIQLLIIEEKLGTLSAKMSIPLILFIMFPIIILILAPGIMRV 279


>gi|115351460|ref|YP_773299.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115281448|gb|ABI86965.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 337

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 84/170 (49%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VGF  P +++     KR+ ++    P  +D+L +    G+S+DQ+++ V  D  G    L
Sbjct: 165 VGFMVPKLYLRRRAAKRRQAVTDELPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMMPVL 224

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S EM +   + +    R+ + +   +  + + +R   + LIQ D++G ++ + L+     
Sbjct: 225 SSEMEIAQRQFAAGRTREQSLQRLSSGFENEDLRAIVRLLIQVDKHGGAVQEPLKQFGER 284

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R  R     ++   L  K+T  MI+  LP L++V  GP ++S++  +  
Sbjct: 285 LREARRAMLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGMISVLRALNQ 334


>gi|307295329|ref|ZP_07575168.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306878832|gb|EFN10051.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 287

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 2/134 (1%)

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEML-LTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ESG+S+DQ  R +A D    +VP    ++ + +A+L       +A + +  R  +   R 
Sbjct: 151 ESGVSLDQCFRSIARD-EAIAVPHHARLIAMLVADLERGMRYDLALDRWAARVAVSGARE 209

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
                 Q+   G  +  +LR  V E    R+M A +    +  ++ V MI+FF+P L +V
Sbjct: 210 LAALFRQALFQGVELAPALREFVREFTQRRVMRAREAMGGITVRMVVLMILFFMPALFVV 269

Query: 314 IIGPAILSIIDTMK 327
           + GP +++I DT++
Sbjct: 270 LGGPPVVAIFDTLR 283


>gi|170701756|ref|ZP_02892692.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170133339|gb|EDT01731.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 337

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 84/169 (49%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VGF  P +++     KR+ ++    P  +D+L +    G+S+DQ+++ V  D  G    L
Sbjct: 165 VGFMVPKLYLRRRAAKRRQAVTDELPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMMPVL 224

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           S EM +   + +    R+ + +   +  + + +R   + LIQ D++G ++ + L+     
Sbjct: 225 SSEMEIAQRQFAAGRTREQSLQRLSSGFENEDLRAIVRLLIQVDKHGGAVQEPLKQFGER 284

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            R  R     ++   L  K+T  MI+  LP L++V  GP ++S++  + 
Sbjct: 285 LREARRAMLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGMISVLRALN 333


>gi|303238717|ref|ZP_07325250.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302593836|gb|EFL63551.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 292

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 83/152 (54%), Gaps = 3/152 (1%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           V+KR++S++  +PD L+ L + + +G+++ +A  ++  D    SV L EE+ + +A++  
Sbjct: 140 VKKRRTSMQLDFPDFLNKLTLLINAGMTVQRAWEKIVTDNKKNSV-LYEELSIAVADIRA 198

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG-TSIGDSLRVLVSETRSERLMEAEKK 290
             +   A+E+F  R ++  +      ++Q+ + G T +   LR+  SE    R   A + 
Sbjct: 199 GKSEMSAYEDFAKRCRIPEITKFVSVVLQNIKKGNTELVSILRLQASECWEMRKRAATRL 258

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
                 K+  PM+I F+ +LI+V + PAI ++
Sbjct: 259 GEEASTKMLFPMMIMFVAILIIVTV-PAIFAM 289


>gi|312882149|ref|ZP_07741898.1| hypothetical protein VIBC2010_06159 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370195|gb|EFP97698.1| hypothetical protein VIBC2010_06159 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 280

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 125/262 (47%), Gaps = 20/262 (7%)

Query: 67  SASSRLRTRDSKSLRNFVK--KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           + SSR  +R ++    F K  +  L+  L+D  I N+   A F     L IL+VV  ++ 
Sbjct: 37  TQSSRTPSRVNRFFVRFGKEHRHELEKKLIDAGIYNR-ELAKFYFPAKLMILIVVTSLIL 95

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I  + +    +FG   L        +G ++L        P   +    +     I    P
Sbjct: 96  ISDMTMQNQLMFGILNL--------IGVILL--------PDTLLHIKGKLLIGKISAQLP 139

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             LD++ +C+++G++I+ +L  + E++      L  ++  T ++ + +   + A  +F +
Sbjct: 140 YLLDMMAVCIQTGMTIEASLVYLGEELEEFDKDLCYQIQRT-SDSAKIHGLEKALNDFAD 198

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R     VR+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K+++P+I+
Sbjct: 199 RVPTTAVRSFVLTIIQNLQYGTSVAQVLGDLSEDMRKVQILTVEEKVGKLSAKMSLPLIL 258

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
             +  ++++I+ P I+ ++  M
Sbjct: 259 LIMFPIVVLILAPGIMQMMINM 280


>gi|302536567|ref|ZP_07288909.1| integral membrane protein [Streptomyces sp. C]
 gi|302445462|gb|EFL17278.1| integral membrane protein [Streptomyces sp. C]
          Length = 292

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 80/155 (51%), Gaps = 8/155 (5%)

Query: 167 WIS----NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           WI     + ++ R+ +I+R  PD LD+L + V +G+   QAL RVA    G   P ++E+
Sbjct: 125 WIEAGLWSAIRIRRDNIERTLPDFLDVLAVVVSAGLGFRQALERVAGKYEG---PWADEI 181

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +T+ ++    +R+ AF+    R   + V     AL Q +  G+ I ++L  +  + R  
Sbjct: 182 RITLQQMDMGVSRRQAFDELRRRNDSEQVAQFVTALQQGEELGSPIVETLIAIAEDMRRT 241

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLP-VLILVIIG 316
               A ++AA   PK T  + +F LP  LIL++ G
Sbjct: 242 DAQNARRRAARAVPKATFAVTMFMLPGTLILLVCG 276


>gi|300697738|ref|YP_003748399.1| type II secretion system protein [Ralstonia solanacearum CFBP2957]
 gi|299074462|emb|CBJ54012.1| Type II secretion system protein [Ralstonia solanacearum CFBP2957]
          Length = 326

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 108/243 (44%), Gaps = 14/243 (5%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L   +V E     L   G+  E +  +    R+++P    +LG+++   + K L + F 
Sbjct: 87  GLGQRIVTEEDRRLLEECGYYGEQARTVFGGTRILLPPFLCVLGVLYAGAFWKALLWGF- 145

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
               A   +GY+G   P   ++   + R+  +    P  +D+L +    G+SIDQ+L+ +
Sbjct: 146 ----AGFALGYLG---PKWLLTRRKESRRRRVDDELPVMVDMLRLLQGVGLSIDQSLQVI 198

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A +  G    L+ E      + +    R+            + ++     L Q DR+G +
Sbjct: 199 ANEFYGMLPVLAGEFGRANQQFASGRPREQTLLRIAKMFDSEDLKGLITLLTQVDRFGGA 258

Query: 268 IGDSLR---VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           + + LR   V + E R  RL E   +   L  K+TV M++  LP L+++  GP  +S+  
Sbjct: 259 VQEPLRQFGVRLQENRRSRLKE---RVGKLTVKMTVVMVLTLLPALLIITAGPGFVSVTR 315

Query: 325 TMK 327
           ++ 
Sbjct: 316 SLH 318


>gi|170022929|ref|YP_001719434.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
 gi|169749463|gb|ACA66981.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
          Length = 277

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 90/170 (52%), Gaps = 9/170 (5%)

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           AP + I N + KR +++ ++ P  +D+   CV+SG++I+ +L    +     +  L   M
Sbjct: 112 APRMIIKNALTKRTNTLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIM 171

Query: 223 --LLTIAELSFLPN--RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             +   AE++ L N  +++ + +     +M C       L  S  +G+++ + L  L  +
Sbjct: 172 SKVTKRAEINGLENAIKELQYYSPAIEMKMFC-----STLQYSLSFGSTVYEQLTHLSQD 226

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            R  +L+  E+  + L  KLT+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 227 MREMQLLMTEESISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKN 276


>gi|172060499|ref|YP_001808151.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171993016|gb|ACB63935.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 330

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 127/304 (41%), Gaps = 32/304 (10%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAI-------- 92
           L++RM ++   R       +    +D AS++  TR  + +   + +L+   +        
Sbjct: 43  LDRRMAALEAAR-------VPKTAEDGASAKPDTRGRQRIERMLDRLSAAGMRWLDTGFG 95

Query: 93  --LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
             +V E     L   G+    +  + L  R+   I   +L  I+  G+ K          
Sbjct: 96  KHIVAEEDRRILEQCGYVDTRTRGLFLSARIACGIALPLLFAIFASGHLK---------- 145

Query: 151 GAVILIGY-----VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           G   +IG      +GF  P + +      R+ S+    P  +D+L +    G+S+DQ+L+
Sbjct: 146 GRHWMIGTFAAFALGFMLPKLVLRRRAAARRQSVVDELPLFVDMLRLLQGVGLSLDQSLQ 205

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
            V  D  G    LS E+ +   + +    R  + +   +    + +R   + ++Q D++G
Sbjct: 206 VVTNDFRGMMPVLSSEVGIAQRQFAAGRTRDQSMQRLSSGFDNEDLRAIARLVVQVDKHG 265

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            ++ + L+      R  R     ++   L  K+T  M++  LP L++V  GP  L+++  
Sbjct: 266 GAVQEPLKQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGFLAVMHA 325

Query: 326 MKDH 329
           +  H
Sbjct: 326 LSAH 329


>gi|149188858|ref|ZP_01867148.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
 gi|148837278|gb|EDL54225.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
          Length = 282

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 78/139 (56%), Gaps = 1/139 (0%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P  LD++ +CV++G++I+ AL  + +++      L  ++  T ++ + +   + A  +  
Sbjct: 139 PYLLDMMSVCVQTGMTIEAALIYLGKELAEFDSDLCYQVKRT-SDSAKIHGLEKALNDLS 197

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           +R     VR+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K+++P+I
Sbjct: 198 DRIPTPAVRSFVLTIIQNLQYGTSVAQVLSDLAEDMRKVQILAVEEKVGKLSAKMSIPLI 257

Query: 304 IFFLPVLILVIIGPAILSI 322
           +F +  ++++I+ P I+ +
Sbjct: 258 LFIMFPIVILILAPGIMQM 276


>gi|254245561|ref|ZP_04938882.1| Flp pilus assembly protein TadC [Burkholderia cenocepacia PC184]
 gi|124870337|gb|EAY62053.1| Flp pilus assembly protein TadC [Burkholderia cenocepacia PC184]
          Length = 330

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 95/215 (44%), Gaps = 21/215 (9%)

Query: 121 LVVPIIFLIL------GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           + +P++F I       G IW+ G    L                +GF  P +++      
Sbjct: 130 IALPLLFAICASGRMKGSIWMVGMCAALG---------------LGFMLPKLYVQRRAAS 174

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G    LS E+ +   + +    
Sbjct: 175 RRQSVVDELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGMLPVLSSEVGIAQRQFAAGRT 234

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R+ + +   +    + +R   + +IQ D++G ++ + L+      R  R     ++   L
Sbjct: 235 REQSLQRLSSGFDNEDLRAIVRLMIQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIGRL 294

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
             K+T  M++  LP L++V  GP +L+++  +   
Sbjct: 295 TVKMTGVMVLTLLPALLIVTAGPGMLAVMRALSSQ 329


>gi|307548792|dbj|BAJ19114.1| TadC [Aggregatibacter actinomycetemcomitans]
 gi|307548807|dbj|BAJ19128.1| TadC [Aggregatibacter actinomycetemcomitans]
          Length = 288

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 133/273 (48%), Gaps = 28/273 (10%)

Query: 56  RKQQITSLQ-KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           RK+ IT  + KD  S  +    SK      +++ L+ +L++ N +  L+  G   +    
Sbjct: 33  RKEVITGERPKDQDSDEVAKNKSK------QQIELELLLINNNPI--LKVLGIIDKN--- 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA-----PSVWIS 169
               +++ + I+ L+ G+ +++ +        +    + +L+G++         P V I 
Sbjct: 82  ----IKVKLLIMLLLFGVYYLYSFTD------ETTDSSSLLLGFLTILIITIVIPGVLIG 131

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
           ++++ +   I       +DL+ + V++GISI+ AL++VA D    +  L+  ML  I + 
Sbjct: 132 SILKAKIKKIMNDLAGFIDLVAVNVQTGISIEAALKQVATDFKTLNPDLTYVMLRIIRK- 190

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           S +     A ++         +R     + QS  +G+SI   L  L ++ R  +L+  E+
Sbjct: 191 SEITGMSQALQDLSVSLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSTDIREIQLLAIEE 250

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           K  +L  K+++P+I+F +  +I++I+ P ++ +
Sbjct: 251 KLGTLSAKMSIPLILFIMFPIIILILAPGVMRV 283


>gi|296158799|ref|ZP_06841628.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891004|gb|EFG70793.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 336

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 106/238 (44%), Gaps = 13/238 (5%)

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           +V E     L   GF    +  + LV RLV  ++  +L      G    LE P    V  
Sbjct: 103 IVAEEDRRLLEQCGFVDTRTRGLFLVARLVGALVLPVLAGTLTRGQ---LEGPRY--VAL 157

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI+    GF  P   +     KR++ +    P  +DLL +    G+S+DQ+L+ V  D  
Sbjct: 158 VIIAAMAGFMLPKFALRRRAGKRRNGVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFR 217

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR--TQMDC--VRNATQALIQSDRYGTSI 268
           G    L+ E  L IA+  F   R    E   NR  T  D   +R   + L+Q DR+G ++
Sbjct: 218 GMLPVLAGE--LEIAQRQFAAGR--TREQSLNRLATSYDNEDLRAVMRLLVQVDRHGGAV 273

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            + L+      R  R     ++   L  K+T  MI+  LP L++V  GP +L++  ++
Sbjct: 274 QEPLKQFGDRLRETRRAMLRERIGRLAVKMTGVMIVTLLPALMIVTAGPGVLAVQHSL 331


>gi|313835699|gb|EFS73413.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA2]
 gi|314928370|gb|EFS92201.1| type II secretion system F domain protein [Propionibacterium acnes
           HL044PA1]
 gi|314970222|gb|EFT14320.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA3]
 gi|328908049|gb|EGG27808.1| LOW QUALITY PROTEIN: Type II secretion system F domain protein
           [Propionibacterium sp. P08]
          Length = 301

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 76/151 (50%), Gaps = 6/151 (3%)

Query: 161 FCAPSVWISNL---VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           F  P + +  L   V++R+  I +  P  +D+L + V +GI   +ALR V+E  GG   P
Sbjct: 129 FIPPVIPLGKLTGDVKRRKEQIDQDLPSFMDVLAVTVTAGIGFRRALRTVSERYGG---P 185

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L++E+ LT+  +    + + AF    +RT    V     A +QS+  G  + D+L  + +
Sbjct: 186 LADEIQLTLQHVDNGASMRQAFTALRDRTGSAAVDEFVSAYVQSEELGAPLVDTLNHIAA 245

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + R      A ++A+ + P++++      +P
Sbjct: 246 DMRRSSAQAALQRASRIEPRVSLVTTTVMVP 276


>gi|46143337|ref|ZP_00204444.1| COG2064: Flp pilus assembly protein TadC [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208032|ref|YP_001053257.1| tight adherence protein C [Actinobacillus pleuropneumoniae L20]
 gi|126096824|gb|ABN73652.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 281

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 94/174 (54%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           AV+++  + F  PS+ I  +++ +   I    P  +DL+ + V++GISI+ A ++VA D 
Sbjct: 109 AVVVVLAIMF--PSITIGVILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDF 166

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  L+  +L  I  AEL+ L     A ++         +R     + QS  +G+S+ 
Sbjct: 167 EHLNADLTYVILRIIRKAELTSLST---ALQDMAISLPTKEIRMFCTVMQQSLNFGSSLY 223

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L ++ R  +L+  E+K  +L  K+++P+I+F +  +I++I+ P  + ++
Sbjct: 224 EHLTQLSADIREMQLLVMEEKLGTLSAKMSIPLILFIMFPIIILIVAPGAMRVL 277


>gi|84385679|ref|ZP_00988710.1| hypothetical Flp pilus assembly protein TadC [Vibrio splendidus
           12B01]
 gi|84379659|gb|EAP96511.1| hypothetical Flp pilus assembly protein TadC [Vibrio splendidus
           12B01]
          Length = 280

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 78/139 (56%), Gaps = 1/139 (0%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P  LD++ +CV++G++I+ AL  + +++      L  ++  T ++ + +   + A  +  
Sbjct: 139 PYLLDMMSVCVQTGMTIEAALVYLGKELAEFDSDLCYQIKRT-SDSAKIHGLEKALNDLS 197

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R     VR+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K++VP+I
Sbjct: 198 ERIPTPPVRSFVLTIIQNLQYGTSVASVLSDLAEDMRKVQILTVEEKVGKLSAKMSVPLI 257

Query: 304 IFFLPVLILVIIGPAILSI 322
           +F +  ++++I+ P+I+ +
Sbjct: 258 LFIMFPIVILILAPSIMQM 276


>gi|165975969|ref|YP_001651562.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190149860|ref|YP_001968385.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251577|ref|ZP_07337751.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252182|ref|ZP_07338350.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245407|ref|ZP_07527495.1| hypothetical protein appser1_6120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247522|ref|ZP_07529567.1| hypothetical protein appser2_5180 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249754|ref|ZP_07531732.1| hypothetical protein appser4_5560 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252110|ref|ZP_07534009.1| hypothetical protein appser6_6280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254362|ref|ZP_07536200.1| hypothetical protein appser9_6100 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256569|ref|ZP_07538350.1| hypothetical protein appser10_5740 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258820|ref|ZP_07540552.1| hypothetical protein appser11_6180 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260999|ref|ZP_07542681.1| hypothetical protein appser12_5660 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307263184|ref|ZP_07544805.1| hypothetical protein appser13_6060 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|165876070|gb|ABY69118.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189914991|gb|ACE61243.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302648965|gb|EFL79153.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302649575|gb|EFL79757.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853748|gb|EFM85965.1| hypothetical protein appser1_6120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856025|gb|EFM88183.1| hypothetical protein appser2_5180 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858169|gb|EFM90247.1| hypothetical protein appser4_5560 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860410|gb|EFM92424.1| hypothetical protein appser6_6280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862661|gb|EFM94617.1| hypothetical protein appser9_6100 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864979|gb|EFM96881.1| hypothetical protein appser10_5740 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867171|gb|EFM99027.1| hypothetical protein appser11_6180 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869301|gb|EFN01096.1| hypothetical protein appser12_5660 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871546|gb|EFN03269.1| hypothetical protein appser13_6060 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 281

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 94/174 (54%), Gaps = 7/174 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           AV+++  + F  PS+ I  +++ +   I    P  +DL+ + V++GISI+ A ++VA D 
Sbjct: 109 AVVVVLAIMF--PSITIGVILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDF 166

Query: 212 GGQSVPLSEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              +  L+  +L  I  AEL+ L     A ++         +R     + QS  +G+S+ 
Sbjct: 167 EHLNADLTYVILRIIRKAELTSL---SAALQDMAISLPTKEIRMFCTVMQQSLNFGSSLY 223

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           + L  L ++ R  +L+  E+K  +L  K+++P+I+F +  +I++I+ P  + ++
Sbjct: 224 EHLTQLSADIREMQLLVMEEKLGTLSAKMSIPLILFIMFPIIILIVAPGAMRVL 277


>gi|17549304|ref|NP_522644.1| putative tight adherence TadC related transmembrane protein
           [Ralstonia solanacearum GMI1000]
 gi|17431556|emb|CAD18234.1| probable pilus assembly tadc transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 326

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 110/239 (46%), Gaps = 16/239 (6%)

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           +V E     L   G+  E +  +    R+++P +  ++G+++   + + L + F      
Sbjct: 92  IVTEEDRKLLEECGYYGEQARTVFGGTRILLPPLLCVVGVLYAASFREALLWGFA----- 146

Query: 153 VILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
               G+ +G+ AP   ++   + R+  +    P  +D+L +    G+SIDQ+L+ +A + 
Sbjct: 147 ----GFALGYLAPKWLLARRKESRRRRLDDELPVMVDMLRLLQGVGLSIDQSLQVIANEF 202

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G    L++E      + +   +R+            + ++     L Q DR+G ++ + 
Sbjct: 203 HGMLPVLADEFGRANQQFASGRSREQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEP 262

Query: 272 LR---VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LR   + + E R  RL E   +   L  K+TV M++  LP L+++  GP  +S+  ++ 
Sbjct: 263 LRQFGLRLQENRRSRLKE---RVGKLTVKMTVVMVLTLLPALLIITAGPGFMSVTRSLH 318


>gi|56460009|ref|YP_155290.1| Flp pilus assembly protein TadC [Idiomarina loihiensis L2TR]
 gi|56179019|gb|AAV81741.1| Flp pilus assembly protein TadC [Idiomarina loihiensis L2TR]
          Length = 237

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 2/153 (1%)

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
            L  K   +I R  PD  DL+ + + SGI +  AL +V+       + L+ E+   ++ L
Sbjct: 81  QLALKNNKAIVRQLPDFCDLISMMIASGIPLISALEKVSASCS--DLLLAREITSMLSRL 138

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
               +   +      R     +   +  LI+  + GTS+  SLR   ++ R + L  AEK
Sbjct: 139 RRGTSFAQSMYELSERYDAKQIHEWSSMLIKGYQQGTSLTKSLRFYANQLRQDLLNSAEK 198

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +A     KL  P++  F PV  LVI+GP I+ I
Sbjct: 199 RAQEAPVKLLFPLVTCFFPVNFLVILGPVIVQI 231


>gi|257790636|ref|YP_003181242.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257474533|gb|ACV54853.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 288

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 4/159 (2%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P  W+     + +  + R  PDALDL+ IC+ +G S + AL  V   + G       E  
Sbjct: 130 PQAWLLARRAEWRDELDRQLPDALDLMAICISAGSSFEGALASVGTRMDGAIA----EAF 185

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
             +A+ +   +R  A     +R Q++ +   T +L+Q++R G+S+ D +R+     R+ER
Sbjct: 186 ARVAKEAAYSSRSEALLGLADRAQVNSITFFTASLVQAERAGSSLVDIIRMQAQSVRTER 245

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            +  +     L  K+  PM++  LP +I++++ P IL +
Sbjct: 246 RLRVDDMTNKLSTKMLFPMLLLMLPSIIMLMLAPMILQL 284


>gi|283778864|ref|YP_003369619.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437317|gb|ADB15759.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 361

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 108/225 (48%), Gaps = 13/225 (5%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLIL-GIIWIFGYDKLLEYPFQ-LRVGAVILIGYV 159
           LR AGF S  ++  +   R ++ +  L+  G+I IF         F+ L VGA I I   
Sbjct: 90  LRQAGFYSRTAMASVYAYRFLLLVFPLVCAGLIAIFSPRS---QTFRILFVGAFIAIALS 146

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
               P ++I    +KR + I     D LD+L +C+  G+ +  +L  VA+++      L+
Sbjct: 147 --IIPRLYIFFRRRKRLTEINNGLADMLDMLGMCLSGGMPLSASLDHVAKNLTNYPA-LA 203

Query: 220 EEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +E+L+    AE+S L +   A  +F NR     VR     L + D+ G+SI  +L     
Sbjct: 204 DELLIMKRQAEVSSLKH---ALADFANRLDTPEVRQVASLLSRGDQLGSSISRNLLDQAD 260

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             R+ R   A  +A      LT P++  F P ++++++ P+ + +
Sbjct: 261 HFRTARRQMATMQANRTPVFLTFPLMFCFAPAVLILLMSPSFMQL 305


>gi|261867450|ref|YP_003255372.1| TadC [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412782|gb|ACX82153.1| TadC [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 288

 Score = 62.8 bits (151), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 84/159 (52%), Gaps = 1/159 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P V I ++++ +   I       +DL+ + V++GISI+ AL++VA D    +  L+  ML
Sbjct: 126 PGVLIGSILKAKIKKIMNDLAGFIDLVAVNVQTGISIEAALKQVATDFKTLNPDLTYVML 185

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
             I + S +     A ++         +R     + QS  +G+SI   L  L ++ R  +
Sbjct: 186 RIIRK-SEITGMSQALQDLSVSLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSTDIREIQ 244

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L+  E+K  +L  K+++P+I+F +  +I++I+ P ++ +
Sbjct: 245 LLAIEEKLGTLSAKMSIPLILFIMFPIIILILAPGVMRV 283


>gi|167570100|ref|ZP_02362974.1| hypothetical protein BoklC_09666 [Burkholderia oklahomensis C6786]
          Length = 261

 Score = 62.8 bits (151), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 4/166 (2%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VGF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    L
Sbjct: 89  VGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVL 148

Query: 219 SEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           S E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+   
Sbjct: 149 SSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFG 206

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
              R  R     ++   L  K+T  MI+  LP L +V  GP +L++
Sbjct: 207 DRLREVRRAMLRERIGRLTVKMTGVMIVTLLPALFIVTAGPGMLAV 252


>gi|167561752|ref|ZP_02354668.1| hypothetical protein BoklE_04253 [Burkholderia oklahomensis EO147]
          Length = 234

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 4/166 (2%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           VGF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    L
Sbjct: 62  VGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVL 121

Query: 219 SEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           S E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+   
Sbjct: 122 SSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFG 179

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
              R  R     ++   L  K+T  MI+  LP L +V  GP +L++
Sbjct: 180 DRLREVRRAMLRERIGRLTVKMTGVMIVTLLPALFIVTAGPGMLAV 225


>gi|323525750|ref|YP_004227903.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323382752|gb|ADX54843.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 367

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 107/231 (46%), Gaps = 15/231 (6%)

Query: 102 LRAAGFRSEYSLNILLVVR----LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           L   GF    +  + L+ R    +V+P++   LG   + G   +L          V+++ 
Sbjct: 143 LEQCGFVDARARGLFLIARVAGAIVLPLVAGALGHAHVEGPRYVL----------VVIVA 192

Query: 158 YV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           +V G  AP V +      R+ ++    P  +DLL +    G+S+DQ+L+ +  D  G   
Sbjct: 193 FVCGVMAPKVVLRRRAAARRGAVVDELPMLVDLLRLLQGVGLSLDQSLQVMVNDFRGVLP 252

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            LS E+ +   + +    R+ +     +  + + +R   + LIQ DR+G ++ + L+   
Sbjct: 253 VLSSELDIAQRQFAAGRTREQSLSRLASSFENEDLRAVVRLLIQVDRHGGAVQEPLKQFG 312

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
              R  R     ++   +  K+T  MI+  LP L++V  GP +LS+  ++K
Sbjct: 313 DRLRETRRAMLRERIGRMAVKMTGVMILTLLPALMIVTAGPGVLSVSHSLK 363


>gi|90412171|ref|ZP_01220177.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum 3TCK]
 gi|90326895|gb|EAS43280.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum 3TCK]
          Length = 283

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           R  P  LD++ +CV++G++I+ AL  ++ ++      L   +  T A+ + +   + A  
Sbjct: 137 RQLPYMLDMMSVCVQTGMTIEAALTYLSIELEAFDKDLCFHIKKT-ADGARVKGLEKALI 195

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               R     VR+ T  LIQ+ +YGTSI + L  L  + R  +++  E+K   L  K++V
Sbjct: 196 ELSERIPTPDVRSFTLTLIQNLQYGTSIANVLSALAEDMRKMQVLTMEEKIGKLAAKMSV 255

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           P+I+  +  ++++I+ P ++ +
Sbjct: 256 PLILLIMFPIVILILAPGMMQM 277


>gi|167399416|ref|ZP_02304940.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167051920|gb|EDR63328.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. UG05-0454]
          Length = 205

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 105/210 (50%), Gaps = 8/210 (3%)

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           ++V  I  IL I+ IF    + +    L +G + +I  +    P + I N + KR +++ 
Sbjct: 1   MIVIFILSILTILAIFNVVNINQKTL-LTIGLLSIISTLYL--PRMIIKNALTKRTNNLL 57

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM--LLTIAELSFLPNRQVA 238
           ++ P  +D+   CV+SG++I+ +L    +     +  L   M  +   AE++ L N    
Sbjct: 58  KSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEINGLENAIKE 117

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            + +    +M    +  Q    S  +G+++ + L  L  + R  +L+  E+  + L  KL
Sbjct: 118 LQYYSPAIEMKMFCSTLQY---SISFGSTVYEQLTHLSQDMREMQLLMTEESISKLSTKL 174

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           T+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 175 TLPLFLFILIPFVLLVISPSILELLNYVKN 204


>gi|238563945|ref|ZP_00437984.2| type II secretion system protein [Burkholderia mallei GB8 horse 4]
 gi|238519622|gb|EEP83092.1| type II secretion system protein [Burkholderia mallei GB8 horse 4]
          Length = 268

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 34  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 85

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 86  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 145

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 146 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 203

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 204 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 263


>gi|167911130|ref|ZP_02498221.1| type II secretion system protein [Burkholderia pseudomallei 112]
          Length = 267

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 33  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 84

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 85  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 144

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 145 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 202

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 203 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 262


>gi|91783015|ref|YP_558221.1| putative tight adherence TadC related transmembrane protein
           [Burkholderia xenovorans LB400]
 gi|91686969|gb|ABE30169.1| Putative tight adherence TadC related transmembrane protein
           [Burkholderia xenovorans LB400]
          Length = 337

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 13/238 (5%)

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           +V E     L   GF    +  + LV RL   ++  +L  +   G  +   Y     V  
Sbjct: 104 IVAEEDRRLLEQCGFVDTRTRGLFLVARLAGAMVLPVLAGMLTRGQFEGSRY-----VAL 158

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI+    GF  P   +     KR++ +    P  +DLL +    G+S+DQ+L+ V  D  
Sbjct: 159 VIIAAMAGFMLPKFVLRRRAGKRRNGVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFR 218

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR--TQMDC--VRNATQALIQSDRYGTSI 268
           G    L+ E  L IA+  F   R    E   NR  T  D   +R   + L+Q DR+G ++
Sbjct: 219 GMLPVLAGE--LEIAQRQFTAGR--TREQSLNRLATSYDNEDLRAVMRLLVQVDRHGGAV 274

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            + L+      R  R     ++   L  K+T  MI+  LP L++V  GP +L++  ++
Sbjct: 275 QEPLKQFGDRLRETRRAMLRERIGRLAVKMTGVMIVTLLPALMIVTAGPGVLAVQHSL 332


>gi|153833197|ref|ZP_01985864.1| bipartite nuclear localization signal containing protein [Vibrio
           harveyi HY01]
 gi|156977404|ref|YP_001448310.1| hypothetical protein VIBHAR_06191 [Vibrio harveyi ATCC BAA-1116]
 gi|148870468|gb|EDL69383.1| bipartite nuclear localization signal containing protein [Vibrio
           harveyi HY01]
 gi|156528998|gb|ABU74083.1| hypothetical protein VIBHAR_06191 [Vibrio harveyi ATCC BAA-1116]
          Length = 280

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 85/157 (54%), Gaps = 5/157 (3%)

Query: 170 NLVQKRQSSIKRA----WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           +L+Q R+  + R      P  LD++ +CV++G++I+ AL  + +++      L  ++  T
Sbjct: 121 SLLQMRRKILIRKTSAQLPYLLDMMSVCVQTGMTIEAALVYLGKELAEFDSDLCYQIKRT 180

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
            ++ + +   + A  +   R     +R+    +IQ+ +YGTS+   L  L  + R  +++
Sbjct: 181 -SDSAKIHGLEKALNDLSERIPTPPIRSFVLTIIQNLQYGTSVAQVLSDLAEDMRKVQIL 239

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             E+K   L  K++VP+I+F +  ++++I+ P I+ +
Sbjct: 240 TVEEKVGKLSAKMSVPLILFIMFPIVILILAPGIMQM 276


>gi|167845911|ref|ZP_02471419.1| type II secretion system protein [Burkholderia pseudomallei B7210]
          Length = 270

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 36  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 87

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 88  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 147

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 148 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 205

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 206 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 265


>gi|171921006|gb|ACB59189.1| TadC [Actinobacillus suis ATCC 33415]
          Length = 281

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 86/160 (53%), Gaps = 1/160 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           PS+ I  +++ +   I    P  +DL+ + V++GISI+ A ++VA D    +  L+  ++
Sbjct: 119 PSITIGIILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDFEHLNADLTY-VI 177

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L I   + L +   A ++         +R     + QS  +G+S+ + L  L ++ R  +
Sbjct: 178 LRIMRKAELTSLSAALQDMAISLPTKEIRMFCTVMQQSLNFGSSLYEHLTQLSADIREMQ 237

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L+  E+K  +L  K+++P+I+F +  +I++I+ P  + ++
Sbjct: 238 LLVMEEKLGTLSAKMSIPLILFIMFPIIILIVAPGAMRVL 277


>gi|5670332|gb|AAD38174.2|AF152598_3 TadC [Aggregatibacter actinomycetemcomitans]
 gi|26000717|gb|AAN75213.1| TadC [Aggregatibacter actinomycetemcomitans]
          Length = 288

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 132/273 (48%), Gaps = 28/273 (10%)

Query: 56  RKQQITSLQ-KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           RK+ IT  + KD  S  +    SK      +++ L+ +L++ N +  L+  G   +    
Sbjct: 33  RKEVITGERPKDQDSDEVAKNKSK------QQIELELLLINNNPI--LKVLGIIDKN--- 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA-----PSVWIS 169
               +++ + I+ L+ G+ +++ +        +    + +L+G++         P V I 
Sbjct: 82  ----IKVKLLIMLLLFGVYYLYSFTD------ETTDSSSLLLGFLTILIITIVIPGVLIG 131

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
           ++++ +   I       +DL+ + V++GISI+ AL++VA D    +  L+  ML  I + 
Sbjct: 132 SILKAKIKKIMNDLAGFIDLVAVNVQTGISIEAALKQVATDFKTLNPDLTYVMLRIIRK- 190

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           S +     A ++         +R     + QS  +G+SI   L  L ++ R  +L+  E+
Sbjct: 191 SEITGMSQALQDLSVSLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSTDIREIQLLAIEE 250

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           K  +L  K+++P+I+F +  +I++ + P ++ +
Sbjct: 251 KLGTLSAKMSIPLILFIMFPIIILTLAPGVMKV 283


>gi|167738780|ref|ZP_02411554.1| type II secretion system protein [Burkholderia pseudomallei 14]
          Length = 271

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 37  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 88

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 89  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 148

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 149 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 206

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 207 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 266


>gi|296130402|ref|YP_003637652.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
 gi|296022217|gb|ADG75453.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
          Length = 299

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD LD+L + V +G++   AL RV++   G   PLSEE+ LT+ +++   + + AF++  
Sbjct: 153 PDFLDVLAVTVMAGVNFRAALARVSQHFEG---PLSEEIDLTLHQIANGASVRQAFQDLR 209

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R+  + V     AL+QS   G  + +SL+ +  + R        + AA   P++T+   
Sbjct: 210 RRSASESVGQFVSALLQSQELGAPLAESLQRIAEDMRKASGQRQRQAAAKASPRVTLVTS 269

Query: 304 IFFLP-VLILVIIG 316
           +  +P  L+ + +G
Sbjct: 270 MVLVPGALVFIFVG 283


>gi|53723518|ref|YP_102952.1| hypothetical protein BMA1286 [Burkholderia mallei ATCC 23344]
 gi|76808991|ref|YP_333345.1| hypothetical protein BURPS1710b_1946 [Burkholderia pseudomallei
           1710b]
 gi|121599511|ref|YP_993094.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124383879|ref|YP_001026129.1| hypothetical protein BMA10229_A0121 [Burkholderia mallei NCTC
           10229]
 gi|126450979|ref|YP_001080599.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|126452133|ref|YP_001066062.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242317541|ref|ZP_04816557.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254178228|ref|ZP_04884883.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|254206225|ref|ZP_04912577.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|254261112|ref|ZP_04952166.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|254297789|ref|ZP_04965242.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52426941|gb|AAU47534.1| membrane protein, putative [Burkholderia mallei ATCC 23344]
 gi|76578444|gb|ABA47919.1| membrane protein, putative [Burkholderia pseudomallei 1710b]
 gi|121228321|gb|ABM50839.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124291899|gb|ABN01168.1| putative membrane protein [Burkholderia mallei NCTC 10229]
 gi|126225775|gb|ABN89315.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|126243849|gb|ABO06942.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|147753668|gb|EDK60733.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|157807302|gb|EDO84472.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|160699267|gb|EDP89237.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|242140780|gb|EES27182.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254219801|gb|EET09185.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 336

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 102 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 153

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 154 LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 213

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 214 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 271

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 272 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 331


>gi|161524901|ref|YP_001579913.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189350349|ref|YP_001945977.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342330|gb|ABX15416.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189334371|dbj|BAG43441.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 330

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 105/244 (43%), Gaps = 20/244 (8%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+    L   G+    S  + L  R+   I+   L  ++  G  K         
Sbjct: 96  KHIVADED-RRLLEQCGYVDARSRGLFLSARMACGIVLPFLFAVFASGRMK--------- 145

Query: 150 VGAVILIGY-----VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
            G   +IG      +G   P +++      R+  +    P  +D+L +    G+S+DQ+L
Sbjct: 146 -GGYWVIGMCVAFALGLMLPKLYVQRRAAARRQCVDDELPLFVDMLRLLQGVGLSLDQSL 204

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSD 262
           + V  D  G    LS E  + +A+  F+  R  + + +        + +R   + ++Q D
Sbjct: 205 QVVTNDFRGMMPVLSSE--VGVAQRQFVAGRTREQSMQRLSGGFDNEDLRAIVRLMVQVD 262

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           ++G ++ + L+      R  R     ++   L  K+T  M++  LP L++V  GP  L++
Sbjct: 263 KHGGAVQEPLKQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGFLAV 322

Query: 323 IDTM 326
           +  +
Sbjct: 323 MHAL 326


>gi|307730002|ref|YP_003907226.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307584537|gb|ADN57935.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 353

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 85/176 (48%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           AVI+    G  AP V +      R++++    P  +DLL +    G+S+DQ+L+ +  D 
Sbjct: 174 AVIVAFVCGVMAPKVVLRRRAAARRAAVVDELPMLVDLLRLLQGVGLSLDQSLQVMVNDF 233

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G    LS E+ +   + +    R+ +     +    + +R   + LIQ DR+G ++ + 
Sbjct: 234 RGVLPVLSGELEIAQRQFAAGRTREQSLARLASSFDNEDLRAVVRLLIQVDRHGGAVQEP 293

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           L+      R  R     ++   +  K+T  MI+  LP L++V  GP +LS+  ++K
Sbjct: 294 LKQFGDRLRETRRAMLRERIGRMAVKMTGVMILTLLPALMIVTAGPGVLSVSHSLK 349


>gi|262360786|gb|ACY57507.1| hypothetical protein YPD4_0598 [Yersinia pestis D106004]
          Length = 193

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 89/169 (52%), Gaps = 9/169 (5%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM- 222
           P + I N + KR +++ ++ P  +D+   CV+SG++I+ +L    +     +  L   M 
Sbjct: 29  PRMIIKNALTKRTNNLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMS 88

Query: 223 -LLTIAELSFLPN--RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            +   AE++ L N  +++ + +     +M C       L  S  +G+++ + L  L  + 
Sbjct: 89  KVTKRAEINGLENAIKELQYYSPAIEMKMFC-----STLQYSISFGSTVYEQLTHLSQDM 143

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           R  +L+  E+  + L  KLT+P+ +F L   +L++I P+IL +++ +K+
Sbjct: 144 REMQLLMTEESISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKN 192


>gi|251767749|ref|ZP_02268267.2| type II secretion system protein [Burkholderia mallei PRL-20]
 gi|254188637|ref|ZP_04895148.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157936316|gb|EDO91986.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|243061818|gb|EES44004.1| type II secretion system protein [Burkholderia mallei PRL-20]
          Length = 339

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G +     P +  
Sbjct: 105 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGE-----PVRTH 156

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 157 LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 216

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 217 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 274

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 275 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 334


>gi|125973852|ref|YP_001037762.1| type II secretion system protein [Clostridium thermocellum ATCC
           27405]
 gi|125714077|gb|ABN52569.1| type II secretion system protein [Clostridium thermocellum ATCC
           27405]
          Length = 289

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 86/160 (53%), Gaps = 3/160 (1%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +S  V +R+ SI+  +PD L+ +++ V +G+++ +A  +   D    +V L +E+   +A
Sbjct: 132 LSGKVNRRRLSIQLDFPDFLNKVILLVNAGMTVSRAWEKSVTDSEKDTV-LYQELRTVLA 190

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS-IGDSLRVLVSETRSERLME 286
           ++    +   AFE+F NR ++  +     AL+Q+   G + +   LR+  +E    R   
Sbjct: 191 DIRGGKSETSAFEDFANRCRIPEITKFVSALLQNLNKGNAEMVSILRLQAAECWEMRKHA 250

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           A++       K+  PM++ F+ V IL++  PA+L++  +M
Sbjct: 251 AKRLGEEASTKMLFPMMLMFIAV-ILIVATPAVLTLTGSM 289


>gi|256004306|ref|ZP_05429288.1| type II secretion system protein [Clostridium thermocellum DSM
           2360]
 gi|281418014|ref|ZP_06249034.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|255991740|gb|EEU01840.1| type II secretion system protein [Clostridium thermocellum DSM
           2360]
 gi|281409416|gb|EFB39674.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|316939950|gb|ADU73984.1| Type II secretion system F domain [Clostridium thermocellum DSM
           1313]
          Length = 289

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 86/160 (53%), Gaps = 3/160 (1%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +S  V +R+ SI+  +PD L+ +++ V +G+++ +A  +   D    +V L +E+   +A
Sbjct: 132 LSGKVNRRRLSIQLDFPDFLNKVILLVNAGMTVSRAWEKSVTDSEKDTV-LYQELRTVLA 190

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS-IGDSLRVLVSETRSERLME 286
           ++    +   AFE+F NR ++  +     AL+Q+   G + +   LR+  +E    R   
Sbjct: 191 DIRGGKSETSAFEDFANRCRIPEITKFVSALLQNLNKGNAEMVSILRLQAAECWEMRKHA 250

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           A++       K+  PM++ F+ V IL++  PA+L++  +M
Sbjct: 251 AKRLGEEASTKMLFPMMLMFIAV-ILIVATPAVLTLTGSM 289


>gi|78066135|ref|YP_368904.1| Flp pilus assembly protein TadC [Burkholderia sp. 383]
 gi|77966880|gb|ABB08260.1| Flp pilus assembly protein TadC [Burkholderia sp. 383]
          Length = 332

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 81/169 (47%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+  P +++      R+ SI    P  +D+L +    G+S+DQ+++ V  D       LS
Sbjct: 161 GYMLPKIYVRRRATARRRSISAELPLLVDMLRLLQGVGLSLDQSIQVVVHDFQTMLPVLS 220

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E+ +   + +    R+ + +   N    + +R   + LIQ D++G ++ + L+      
Sbjct: 221 WELAVAQRQFAAGRTREQSLQRLTNSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRL 280

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           R  R     ++   L  K+T  MI+  LP L++V  GP +++++  + +
Sbjct: 281 REGRRATLREQIGRLTVKMTGVMIVTLLPALLIVTAGPGVMTVLAALAE 329


>gi|251791986|ref|YP_003006706.1| TadC [Aggregatibacter aphrophilus NJ8700]
 gi|247533373|gb|ACS96619.1| TadC [Aggregatibacter aphrophilus NJ8700]
          Length = 288

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 84/159 (52%), Gaps = 1/159 (0%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   ++++++ +   I       +DL+ + V++G+SI+ AL++VA D    +  L+  ML
Sbjct: 126 PGFLVNSILKSKIKKIMNDLAGFIDLVAVNVQTGVSIEAALKQVATDFKTLNPDLTYVML 185

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
             I + S +     A ++         +R     + QS  +G+SI   L  L S+ R  +
Sbjct: 186 RIIRK-SEITGMSQALQDLSISLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSSDIRELQ 244

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L+  E+K  +L  K+++P+I+F +  +I++I+ P ++ +
Sbjct: 245 LLTIEEKLGTLAAKMSIPLILFIMFPIIILILAPGVMRV 283


>gi|257139285|ref|ZP_05587547.1| hypothetical protein BthaA_08776 [Burkholderia thailandensis E264]
          Length = 253

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    LS
Sbjct: 82  GFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVLS 141

Query: 220 EEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
            E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+    
Sbjct: 142 SE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGD 199

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 200 RLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 248


>gi|167582055|ref|ZP_02374929.1| hypothetical protein BthaT_28187 [Burkholderia thailandensis TXDOH]
          Length = 278

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    LS
Sbjct: 107 GFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVLS 166

Query: 220 EEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
            E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+    
Sbjct: 167 SE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGD 224

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 225 RLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 273


>gi|317133736|ref|YP_004089647.1| Type II secretion system F domain [Ruminococcus albus 7]
 gi|315450198|gb|ADU23761.1| Type II secretion system F domain [Ruminococcus albus 7]
          Length = 286

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 114/221 (51%), Gaps = 13/221 (5%)

Query: 110 EYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF-QLRVG-AVILIGYVGFCAPSVW 167
           E +L+ L++ R ++ +   +LGI+  F    L+  P   L +G A  +I  + F +P+  
Sbjct: 75  EPNLDKLIITR-ILAVTIAVLGILIAF----LINTPLISLLIGLATAVITILVFISPTAT 129

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML--LT 225
           I++  QK+++  +   P  LDL    ++  + +  A++  AE I G    LSEE+L  L 
Sbjct: 130 INDRAQKKKAQFESEIPRFLDLFQTAIKINLPVATAIKITAESIDG---ILSEELLRALV 186

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + EL    N Q +  +   + ++D   +    ++ + + G+ I +S+       +S  L+
Sbjct: 187 VTELG-TSNWQDSLYDIAQKYEVDSFSDFVLDIVTAFQKGSDITESVERQSRSIKSSTLL 245

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            A+++AA     + +P+++F +  L++++  P I+ I++ M
Sbjct: 246 SAKEQAAKTTSLILIPVVVFKMIPLMIILFLPVIMQILNGM 286


>gi|149909542|ref|ZP_01898196.1| bipartite nuclear localization signal containing protein, similarto
           TadC [Moritella sp. PE36]
 gi|149807447|gb|EDM67398.1| bipartite nuclear localization signal containing protein, similarto
           TadC [Moritella sp. PE36]
          Length = 296

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 80/145 (55%), Gaps = 1/145 (0%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I    P  LDL+ +CV++G++++ A+  +++++      L+  +L+   + + +    +A
Sbjct: 150 ISNKLPYLLDLMAVCVQTGMTLESAISYLSKEMTEFDKDLTN-VLVKTNDRARIVGLAMA 208

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            +  Y R   + +R+    L QS ++G+SI   L  L  + R  +++  E+K   L  K+
Sbjct: 209 LDELYLRVPSNEMRSFVMTLKQSLQFGSSISQVLTTLSGDIRQVQILGLEEKIGKLAAKM 268

Query: 299 TVPMIIFFLPVLILVIIGPAILSII 323
           ++P+I+F +  ++++I  P I+ ++
Sbjct: 269 SIPLIVFIMVPVVILIAAPGIMRMM 293


>gi|294146460|ref|YP_003559126.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292676877|dbj|BAI98394.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 287

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPI-IFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
            I +KL  AGF+   + +  +  R+   +   L   ++   G+   L  P  +    VI+
Sbjct: 57  EIADKLMLAGFQDARAADRFVWARMAATVGAGLAAMLVSRIGWGGFLAQPLLV----VIV 112

Query: 156 IG--YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
            G  YVG       I  L  +R  +I   +P  LDL+L+ +ESGIS+DQ  R +A D   
Sbjct: 113 TGLTYVG---AKQAIHLLAARRARAIMAEFPFLLDLMLMMLESGISLDQCFRSIARD-EA 168

Query: 214 QSVPLSEEML-LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
            +VP    ++ + +A+L      + A + +  R  ++  +       Q+   G  +  +L
Sbjct: 169 IAVPHHARLIAMLVADLDRGMRYEQALDRWAARVAVNGAKELAALFRQALFQGVELAPAL 228

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R  V E    R+  A +    +  ++ V MI+FF+P L +V+ GP +++I DT++
Sbjct: 229 REFVREFTQRRVANAREAMGGITVRMVVLMILFFMPALFVVLGGPPVVAIFDTLR 283


>gi|160897511|ref|YP_001563093.1| type II secretion system protein [Delftia acidovorans SPH-1]
 gi|160363095|gb|ABX34708.1| type II secretion system protein [Delftia acidovorans SPH-1]
          Length = 334

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 12/239 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF--LILGIIWIFGYDKLLEYPFQ 147
           KA+L DE+    L  AG  +       +  R+V+ ++   L LG++   G +  L Y F 
Sbjct: 100 KALLADED-RKLLDQAGVGTRNGSMAYVASRMVLCVVLPLLALGVL-RPGENAALMYGF- 156

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
                  L   +G   P  ++ +  + R+  +    P  +DLL +    G+S+DQ+L+ +
Sbjct: 157 -------LGVSLGLMLPKWFLRSRAKGRREQVVEELPLFVDLLRLLQGVGLSVDQSLQIL 209

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A +       +S E+ L     +    R+ +F+   N +  D +      L+Q D++G +
Sbjct: 210 ASEFKSVLRVISGELALANQLYNTGRTREQSFQRMVNMSADDDMSAIVNLLVQVDKHGGA 269

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           + + LR      R +R    ++K  S+  K+T  M++  LP L+++  GP  L++I  +
Sbjct: 270 VQEPLREFSIRLREKRQASFKEKIGSITVKMTGVMVLTLLPALLVITAGPGFLAVIRAL 328


>gi|167894486|ref|ZP_02481888.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 269

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 35  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 86

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 87  LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 146

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 147 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 204

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 205 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 264


>gi|167620218|ref|ZP_02388849.1| hypothetical protein BthaB_28185 [Burkholderia thailandensis Bt4]
          Length = 268

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    LS
Sbjct: 97  GFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVLS 156

Query: 220 EEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
            E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+    
Sbjct: 157 SE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGD 214

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 215 RLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 263


>gi|167919153|ref|ZP_02506244.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
          Length = 274

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 40  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 91

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 92  LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 151

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 152 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 209

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 210 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 269


>gi|327538076|gb|EGF24766.1| type II secretion system protein [Rhodopirellula baltica WH47]
          Length = 306

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 75/156 (48%), Gaps = 14/156 (8%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA-----ELSFLP 233
           + R  P A+DL     E G+  D AL R       Q     + +L +       +L    
Sbjct: 152 VSRDLPLAMDLWATLSEGGLGFDAALDRW------QRTQRPDRVLASACRGFQRDLLGGM 205

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
            R VAF     R  +  +   T A+IQS++ G S+ ++LR+   + R+ER  ++   A S
Sbjct: 206 RRSVAFRRLAGRLDVPPLTRFTAAMIQSEQMGASVSETLRLQAEDVRAERREKSMAFAQS 265

Query: 294 LGPKLTVPMIIFFLPVLILVIIGP---AILSIIDTM 326
           L  K  +P+++ FLP L +  +GP    +L I+D++
Sbjct: 266 LATKRVIPLVVCFLPGLFVWPLGPFFTQLLRIVDSL 301


>gi|32477853|ref|NP_870847.1| integral membrane protein [Rhodopirellula baltica SH 1]
 gi|32448410|emb|CAD77925.1| probable integral membrane protein [Rhodopirellula baltica SH 1]
          Length = 306

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 75/156 (48%), Gaps = 14/156 (8%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA-----ELSFLP 233
           + R  P A+DL     E G+  D AL R       Q     + +L +       +L    
Sbjct: 152 VSRDLPLAMDLWATLSEGGLGFDAALDRW------QRTQRPDRVLASACRGFQRDLLGGM 205

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
            R VAF     R  +  +   T A+IQS++ G S+ ++LR+   + R+ER  ++   A S
Sbjct: 206 RRSVAFRRLAGRLDVPPLTRFTAAMIQSEQMGASVSETLRLQAEDVRAERREKSMAFAQS 265

Query: 294 LGPKLTVPMIIFFLPVLILVIIGP---AILSIIDTM 326
           L  K  +P+++ FLP L +  +GP    +L I+D++
Sbjct: 266 LATKRVIPLVVCFLPGLFVWPLGPFFTQLLRIVDSL 301


>gi|163801672|ref|ZP_02195570.1| hypothetical Flp pilus assembly protein TadC [Vibrio sp. AND4]
 gi|159174589|gb|EDP59391.1| hypothetical Flp pilus assembly protein TadC [Vibrio sp. AND4]
          Length = 280

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 85/157 (54%), Gaps = 5/157 (3%)

Query: 170 NLVQKRQSSIKRA----WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           +L+Q R+  + R      P  LD++ +CV++G++I+ AL  + +++      L  ++  T
Sbjct: 121 SLLQMRRKMLIRKTSAQLPYLLDMMSVCVQTGMTIEAALVYLGKELAEFDSDLCYQIKRT 180

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
            ++ + +   + A  +   R     VR+    +IQ+ ++GTS+   L  L  + R  +++
Sbjct: 181 -SDSAKIQGLEKALTDLSERIPTPPVRSFVLTIIQNLQHGTSVAQILSDLAEDMRKMQIL 239

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             E+K   L  K+++P+IIF +  ++++I+ P I+ +
Sbjct: 240 TVEEKVGKLSAKMSLPLIIFIMFPIVILILAPGIMQM 276


>gi|217423679|ref|ZP_03455180.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|217393537|gb|EEC33558.1| type II secretion system protein [Burkholderia pseudomallei 576]
          Length = 336

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 102 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 153

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 154 LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 213

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 214 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 271

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 272 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 331


>gi|254179954|ref|ZP_04886553.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|184210494|gb|EDU07537.1| type II secretion system protein [Burkholderia pseudomallei 1655]
          Length = 340

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 106 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 157

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 158 LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 217

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 218 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 275

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 276 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 335


>gi|167902893|ref|ZP_02490098.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 264

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 30  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 81

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 82  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 141

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 142 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 199

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 200 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 259


>gi|257790324|ref|YP_003180930.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325830281|ref|ZP_08163738.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
 gi|257474221|gb|ACV54541.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325487748|gb|EGC90186.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
          Length = 313

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 4/147 (2%)

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           APS  +S   + R+ +I+ A PDA++LL I + +G  I+Q  R VAE + G   PL+ E 
Sbjct: 147 APSWALSRRERNRRRAIELALPDAMELLGIAIAAGSPIEQCFREVAESMDG---PLAREF 203

Query: 223 LLTIAELSFLP-NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
            L   E++ L  +R+ A E+   R +   V   T  L+Q+   G+S+ + L V  +  R 
Sbjct: 204 SLVDREVNLLGRSREEALEHLGQRCRSQDVSAFTAQLMQAVSQGSSLTEGLAVQAALARE 263

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLP 308
               EA ++   +  KL + + + FLP
Sbjct: 264 TAQAEAMERIRKMPTKLDIVLSLCFLP 290


>gi|237812071|ref|YP_002896522.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|237506289|gb|ACQ98607.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 340

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 106 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 157

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 158 LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 217

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 218 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 275

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 276 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 335


>gi|254197742|ref|ZP_04904164.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|169654483|gb|EDS87176.1| type II secretion system protein [Burkholderia pseudomallei S13]
          Length = 340

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 106 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 157

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 158 LGAWVALSVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 217

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 218 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 275

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 276 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 335


>gi|167836788|ref|ZP_02463671.1| type II secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 267

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 4/176 (2%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V L    GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  
Sbjct: 89  VALCVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFK 148

Query: 213 GQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ +
Sbjct: 149 GMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQE 206

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 207 PLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 262


>gi|317489773|ref|ZP_07948272.1| hypothetical protein HMPREF1023_01971 [Eggerthella sp. 1_3_56FAA]
 gi|316911119|gb|EFV32729.1| hypothetical protein HMPREF1023_01971 [Eggerthella sp. 1_3_56FAA]
          Length = 301

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 78/149 (52%), Gaps = 4/149 (2%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           + APS  +S   + R+ +I+ A PDA++LL I + +G  I+Q  R VAE + G   PL+ 
Sbjct: 133 WMAPSWALSRRERNRRRAIELALPDAMELLGIAIAAGSPIEQCFREVAESMDG---PLAR 189

Query: 221 EMLLTIAELSFLP-NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           E  L   E++ L  +R+ A E+   R +   V   T  L+Q+   G+S+ + L V  +  
Sbjct: 190 EFSLVDREVNLLGRSREEALEHLGQRCRSQDVSAFTAQLMQAVSQGSSLTEGLAVQAALA 249

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           R     EA ++   +  KL + + + FLP
Sbjct: 250 RETAQAEAMERIRKMPTKLDIVLSLCFLP 278


>gi|167824379|ref|ZP_02455850.1| type II secretion system protein [Burkholderia pseudomallei 9]
          Length = 266

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 32  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 83

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 84  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 143

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 144 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 201

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 202 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 261


>gi|83718806|ref|YP_443055.1| hypothetical protein BTH_I2538 [Burkholderia thailandensis E264]
 gi|83652631|gb|ABC36694.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 373

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P +++      R+ S+    P  +D+L +    G+S+DQ+++ V  D  G    LS
Sbjct: 202 GFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVLS 261

Query: 220 EEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
            E  L IA+  F+  R  + + +        + +R   + LIQ D++G ++ + L+    
Sbjct: 262 SE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGD 319

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 320 RLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 368


>gi|167816004|ref|ZP_02447684.1| type II secretion system protein [Burkholderia pseudomallei 91]
          Length = 272

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 38  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 89

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 90  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 149

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 150 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 207

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 208 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 267


>gi|167719782|ref|ZP_02403018.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 273

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 39  KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 90

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 91  LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 150

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 151 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 208

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 209 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 268


>gi|170696831|ref|ZP_02887931.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170138259|gb|EDT06487.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 372

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 86/176 (48%), Gaps = 1/176 (0%)

Query: 153 VILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           V+++ ++ G  AP + +      R+ ++    P  +DLL +    G+S+DQ+L+ +  D 
Sbjct: 193 VVIVAFMCGVMAPKLVLRRRAAARRGAVVDELPMLVDLLRLLQGVGLSLDQSLQVMVNDF 252

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G    L+ E+ +   + +    R+ +     +    + +R   + LIQ DR+G ++ + 
Sbjct: 253 RGVLPVLASELEIAQGQFAAGRTREQSLSRLASSFDNEDLRAVVRLLIQVDRHGGAVQEP 312

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           L+      R  R     ++   +  K+T  MI+  LP L++V  GP ++S+  ++K
Sbjct: 313 LKQFGDRLRETRRAMLRERIGRMAVKMTGVMILTLLPALMIVTAGPGVMSVSHSLK 368


>gi|225375137|ref|ZP_03752358.1| hypothetical protein ROSEINA2194_00761 [Roseburia inulinivorans DSM
           16841]
 gi|225213011|gb|EEG95365.1| hypothetical protein ROSEINA2194_00761 [Roseburia inulinivorans DSM
           16841]
          Length = 415

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 115/259 (44%), Gaps = 23/259 (8%)

Query: 76  DSKSLR-NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           DS++L   F  ++  K     E I NKL+    +     N      L++P       IIW
Sbjct: 167 DSQTLEYQFFFQICPKIYSEKEKINNKLKQELIKKNEKTND---STLILPESIDDQTIIW 223

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ---KRQSSIKRAWPDALDLLL 191
               +++   P +L +  +I  G    C P V  S   +   +R+  ++  +P+ +  L 
Sbjct: 224 KEKSERM---PLKLLLLGMIAAG----CVPLVEKSRKQEEEKRRKEKLQSEYPELVSKLT 276

Query: 192 ICVESGISIDQALRRVAEDIGGQSV-------PLSEEMLLTIAELSFLPNRQVAFENFYN 244
           I + +G+++  A  ++A     +         PL EEML+T  E+        A+E F  
Sbjct: 277 ILLGAGMTLFSAWNKIATSYSNKRKNNTIPIHPLYEEMLITCHEIESGVGEARAYERFGE 336

Query: 245 RTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           R  +   R     L+Q+ R GT  +   L   VS+   ER   A+K     G K+  PM+
Sbjct: 337 RCGLHRYRKFCSLLVQNLRKGTRGLVQLLEQEVSDAFEERKNLAKKSGEEAGTKMLFPMM 396

Query: 304 IFFLPVLILVIIGPAILSI 322
           + F  ++I++I+ PA LS+
Sbjct: 397 MMF-GIIIVIIMVPAFLSL 414


>gi|226196329|ref|ZP_03791911.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225931546|gb|EEH27551.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 338

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 104 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 155

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 156 LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 215

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 216 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 273

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 274 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 333


>gi|126442067|ref|YP_001058811.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134282402|ref|ZP_01769107.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|126221560|gb|ABN85066.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134246440|gb|EBA46529.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 340

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 106 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 157

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 158 LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 217

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 218 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 275

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 276 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 335


>gi|53719505|ref|YP_108491.1| putative outer-membrane protein [Burkholderia pseudomallei K96243]
 gi|52209919|emb|CAH35891.1| putative outer-membrane protein [Burkholderia pseudomallei K96243]
          Length = 341

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K I+ DE+ +  L   G+   ++  I L  R+   I   +   + + G + +  +     
Sbjct: 107 KQIVADEDRM-LLEQCGYVDAHTRGIFLSARIACAIA--LPAAVALVGGETVRTH----- 158

Query: 150 VGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           +GA + +  + GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+++ V 
Sbjct: 159 LGAWVALSVIAGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVT 218

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNR--QVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
            D  G    LS E  L IA+  F+  R  + + +        + +R   + LIQ D++G 
Sbjct: 219 NDFRGMLPVLSSE--LGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGG 276

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ++ + L+      R  R     ++   L  K+T  MI+  LP L +V  GP +L++   +
Sbjct: 277 AVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHAL 336


>gi|32452628|gb|AAP43990.1| TadC [Aggregatibacter actinomycetemcomitans]
          Length = 288

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 131/269 (48%), Gaps = 20/269 (7%)

Query: 56  RKQQITSLQ-KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           RK+ IT  + KD ++  +    SK      +++ L+ +L++ N + K+     ++     
Sbjct: 33  RKEVITGERPKDQSNDEIAKGKSK------QQIELELLLINNNPILKMLGIIDKN----- 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGY-DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
               +++ + I+ L+ G+ +++   DK  +    L     ILI  V    P + I ++++
Sbjct: 82  ----IKVKLLIMILLCGVYYLYSLIDKTTDSSSLLFGFLTILI--VTIVIPGILIGSILK 135

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            +   I       +DL+ + +++G+ I+ AL+ VA D    +  L+  ML  I + S + 
Sbjct: 136 SKIKKIMNDLAGFIDLVAVNLQTGMGIEAALKHVATDFKILNPDLTYVMLRIIRK-SEIT 194

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
               A ++         +R     + QS  +G+SI   L  L ++ R  +L+  E+K  +
Sbjct: 195 GMSQALQDLSVSLPTAEIRMFCTVMQQSLNFGSSIYHQLVQLSTDIREIQLLAIEEKLGT 254

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L  K++VP+I+F +  +I++I+ P ++ +
Sbjct: 255 LSAKMSVPLILFIMFPIIILILAPGVMRV 283


>gi|293391327|ref|ZP_06635661.1| Flp pilus assembly protein TadC [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951861|gb|EFE01980.1| Flp pilus assembly protein TadC [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 288

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 131/269 (48%), Gaps = 20/269 (7%)

Query: 56  RKQQITSLQ-KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           RK+ IT  + KD ++  +    SK      +++ L+ +L++ N + K+     ++     
Sbjct: 33  RKEVITGERPKDQSNDEIAKGKSK------QQIELELLLINNNPILKMLGIIDKN----- 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGY-DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
               +++ + I+ L+ G+ +++   DK  +    L     ILI  V    P + I ++++
Sbjct: 82  ----IKVKLLIMILLCGVYYLYSLIDKTTDSSSLLFGFLTILI--VTIVIPGILIGSILK 135

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            +   I       +DL+ + +++G+ I+ AL+ VA D    +  L+  ML  I + S + 
Sbjct: 136 SKIKKIMNDLAGFIDLVAVNLQTGMGIEAALKHVATDFKILNPDLTYVMLRIIRK-SEIT 194

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
               A ++         +R     + QS  +G+SI   L  L ++ R  +L+  E+K  +
Sbjct: 195 GMSQALQDLSVSLPTAEIRMFCTVMQQSLNFGSSIYHQLVQLSTDIREIQLLAIEEKLGT 254

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L  K++VP+I+F +  +I++I+ P ++ +
Sbjct: 255 LSAKMSVPLILFIMFPIIILILAPGVMRV 283


>gi|152983555|ref|YP_001350203.1| hypothetical protein PSPA7_4867 [Pseudomonas aeruginosa PA7]
 gi|150958713|gb|ABR80738.1| hypothetical protein PSPA7_4867 [Pseudomonas aeruginosa PA7]
          Length = 303

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 79/164 (48%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   + +  + R++ I       + L+ I  ++G++++QALR V ++  G +  L
Sbjct: 132 IGFLLPKQVLKHFAKARRALIAEEMILFVQLIRILFDAGLTVEQALRVVCQEGRGITPQL 191

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L +A      +     E    R Q+D + +    L Q  R G S   +L  L   
Sbjct: 192 ARELDLALARAGNGIDLAEELEALARRLQVDPLNDCCGVLRQMLRQGGSARGTLLTLKQL 251

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
               RL   +++   L  K+++ M++   P L++V+ GP +++I
Sbjct: 252 FEDRRLTTLQERIGKLSAKMSLVMMVLLFPALLIVLAGPGVIAI 295


>gi|262275464|ref|ZP_06053274.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Grimontia hollisae CIP 101886]
 gi|262220709|gb|EEY72024.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Grimontia hollisae CIP 101886]
          Length = 288

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 81/162 (50%), Gaps = 5/162 (3%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG--QSVPLSEE 221
           P +++    +     I R  P  LD++ +CV++G++I+ ++  +  ++    + +    +
Sbjct: 129 PDLYLEMRRRALARKITRQLPYLLDIMGVCVQTGMTIESSIFYLTTEMAAFDKDIAYVLK 188

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
            L   A+   L    +         +M         L QS ++GTSI ++L +L  + R 
Sbjct: 189 RLRDRAQTKGLEKALLELNEHVPAPEMHSF---VMTLTQSMQHGTSIYEALSILAKDIRE 245

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            +L+  E+KA  L  K++VP+I+F +  ++++I  P I+ ++
Sbjct: 246 IQLLSLEEKAGKLSSKMSVPLILFIMMPIVILITAPGIMRML 287


>gi|311697136|gb|ADQ00008.1| type II secretion system protein-like protein [marine bacterium
           HP15]
          Length = 290

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL----PNRQVAFENFYNRTQMD 249
           VE+G+S +++L+ ++     Q+  L   ++  I   + +     +R VA +       + 
Sbjct: 156 VEAGLSPERSLKLISH----QARELMPRLIRRIDRFNRVMESGADRTVALDELGKNRNLT 211

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +RN    + QS   G+ +   L  +V E + E     +++   +G ++TV M++F LP 
Sbjct: 212 VLRNYVSLMKQSGTLGSKVAGGLDQIVEEAQHEERSNLKEETNKIGARMTVIMMVFMLPS 271

Query: 310 LILVIIGPAILSIIDTMK 327
           L L+I GPA+L+I+D  +
Sbjct: 272 LFLLIGGPAVLAIMDAFQ 289


>gi|297568749|ref|YP_003690093.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924664|gb|ADH85474.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 305

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENF 242
           P    LL + +E+G+ +DQAL  VA D   + +P  S+E+ + + ++     R       
Sbjct: 159 PMLAQLLRVLIEAGLGLDQALLTVATD-NREIIPACSQELSVVMRQVEQGAERGTTLLAM 217

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
                +  +++  + L Q  RYG ++ D LR  V+     R ++ +++   L   +T+ +
Sbjct: 218 ARTLDVQELQDLCEMLRQVYRYGGNVRDPLREFVALLYDRRRIKLQERVGKLAGSMTIIV 277

Query: 303 IIFFLPVLILVIIGPAILSI 322
           IIFF P L+ V+ GP  ++I
Sbjct: 278 IIFFFPALLAVVAGPGFIAI 297


>gi|110833084|ref|YP_691943.1| hypothetical protein ABO_0223 [Alcanivorax borkumensis SK2]
 gi|110646195|emb|CAL15671.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 286

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 87/180 (48%), Gaps = 14/180 (7%)

Query: 154 ILIGYVGFCAPSVW---ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           + +G VGF     +   ++ +   RQ+     +   L +LL   E+G+SI++A R  A  
Sbjct: 112 LFLGVVGFIGSRRYFRSVAKVACHRQNQEAIEFAQLLSMLL---EAGLSIERAFRVAAV- 167

Query: 211 IGGQSVPLSEEMLLTIAELSFL----PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
              QS P+   ++  +   + L      R VA +      Q+  + + T+ L Q    G 
Sbjct: 168 ---QSRPMIPGLVHRLDRFNRLMESGAERGVALDEIGEGKQIPVLHSLTRLLKQGGALGG 224

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +I +S+  L+ E +       +++   +G K+TV M+IF +P L +++ GPA ++I+  +
Sbjct: 225 AISESIEQLILEAQDVEKSRIKEEVNRVGAKMTVAMMIFMMPALFIIVGGPAGVNIVQAI 284


>gi|114798049|ref|YP_761687.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738223|gb|ABI76348.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 106/224 (47%), Gaps = 15/224 (6%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR-----VG 151
           NI +KL  AG   E  + +  ++  V  +I    GI++I G D L+     L+     + 
Sbjct: 83  NIGSKLTQAGL--EIPVPMFWLLSAVCGLI--CAGIVYISGADGLVINGISLKSRPVLIA 138

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A    G +G   P   ++ L++ R + +   + DALD+++  V SG+ +++ +R +A++ 
Sbjct: 139 AAFFGGTLGI--PQFILNFLIKGRHTKMINQFADALDIIVRGVRSGLPLNECIRVIAKE- 195

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                PL +E L     L+     + +    Y R  +  +      LI   + G ++ ++
Sbjct: 196 --SPEPLRKEFLTFADNLAMGAGLERSLAALYKRLPLQEINFFAIVLIIQSKAGGNLSEA 253

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           L  L +  RS ++M  + KA S   K +  MII  LP+ + V++
Sbjct: 254 LHNLSTVIRSRKMMREKVKALSSEAKASA-MIIGSLPIAVGVMV 296


>gi|149927029|ref|ZP_01915287.1| putative tight adherence tadc related transmembrane protein
           [Limnobacter sp. MED105]
 gi|149824250|gb|EDM83470.1| putative tight adherence tadc related transmembrane protein
           [Limnobacter sp. MED105]
          Length = 317

 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 137/290 (47%), Gaps = 21/290 (7%)

Query: 42  EKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNK 101
           EK +  +    E+ RK Q ++  ++   + + T   + L     K       V+E     
Sbjct: 33  EKALARIDEYTELRRKVQSSANMRNQVPTSVLTGRIERLGQQFSKTKAFTYFVEEEDKKL 92

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGII--WIFGYDKLLEYPFQLRVGAVILIGYV 159
           L  AGF  E  L+  +++R+ + ++ L++G+   W  G+  +   P       VI +  +
Sbjct: 93  LGRAGFGREEDLSRFVLIRIALGLLGLLIGLFLNWDAGFGAI---PMI----QVIAVTGI 145

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF AP  ++  + + R+++ +R     +D++ +    G+S+DQ++  +   +    VP++
Sbjct: 146 GFMAPKWYLKTVGEGREAAFERELVAVVDVMRLLQGVGLSVDQSIEVMTSQLY-DLVPIT 204

Query: 220 EEMLL-TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             ML  + A++       V  +   +    D  ++  Q L Q +++G ++ + L+     
Sbjct: 205 GRMLRRSRAQVKSGVPWIVMLKRMSSMYSSDEFKSFVQVLEQIEKFGGAVQEPLKQF--- 261

Query: 279 TRSERLMEAEKKAAS-----LGPKLTVPMIIFFLPVLILVIIGPAILSII 323
             S+RL+E E+  A      L  KLT  M+I  LP L+++  GP I+SII
Sbjct: 262 --SDRLVEKERANAKETMGKLTVKLTGVMVITMLPALLIMTGGPGIISII 309


>gi|256827715|ref|YP_003151674.1| Flp pilus assembly protein TadC [Cryptobacterium curtum DSM 15641]
 gi|256583858|gb|ACU94992.1| Flp pilus assembly protein TadC [Cryptobacterium curtum DSM 15641]
          Length = 306

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 75/149 (50%), Gaps = 2/149 (1%)

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R+  ++R   +AL +L + + SG+S D+AL +        ++  SE     +A ++ L  
Sbjct: 157 RKKQMERHLSEALSILCLGLRSGLSFDRALEKYCASF--PTMLASELSGAHMAWMTGLTT 214

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R  A     ++     +R    ++++S R+G  + D+L  L +E R  R    +++    
Sbjct: 215 RTEALHAVASKYDSPLIRRVMDSIVRSMRFGAPLADALDELAAEARLARKALLDEEVMKA 274

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSII 323
             K+ +P+    LP ++L+++GP +L ++
Sbjct: 275 PVKMMIPVGTLILPSMLLMVLGPVLLDLV 303


>gi|260892929|ref|YP_003239026.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260865070|gb|ACX52176.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 305

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 75/140 (53%), Gaps = 3/140 (2%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P+ +DLL + VE+G+  + AL RV E + G   PL +E+   + E+     R+ A     
Sbjct: 162 PEVIDLLTVSVEAGLGFEGALTRVVEKMDG---PLPQEICRALQEIRVGRPRREALREMA 218

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  ++ + +   A+I +++ G S+   LR+   E R  R  +A++ A     K+ +P++
Sbjct: 219 QRIGVEELLSFVGAVIMAEQMGVSLARVLRLQSQEIRRRRRQQAQEAAFKAPVKMLLPLV 278

Query: 304 IFFLPVLILVIIGPAILSII 323
           +   P   +V++GPA+L I+
Sbjct: 279 LCIFPATFVVLLGPAVLRIM 298


>gi|299069494|emb|CBJ40763.1| Type II secretion system protein [Ralstonia solanacearum CMR15]
          Length = 324

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 102/247 (41%), Gaps = 26/247 (10%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L   +V E     L   G+  E +  +    R+++P    ++G+++   + + L     
Sbjct: 89  GLGHRIVTEEDRKLLEECGYYGEQARTVFGGTRILLPPFLCVVGVLYAASFREAL----- 143

Query: 148 LRVGAVILIGYVGFC----APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
                  L G+ GF     AP   ++     R+  +    P  +D+L +    G+SIDQ+
Sbjct: 144 -------LCGFAGFALGYLAPKWLLARRKASRRHRLDDELPVMVDMLRLLQGVGLSIDQS 196

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           L+ +A +  G    L++E      + +    R+            + ++     L Q DR
Sbjct: 197 LQVIANEFHGMLPVLADEFGRANQQFASGRPREQTLLRISRLFDNEDLKGLITLLTQVDR 256

Query: 264 YGTSIGDSLR---VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           +G ++ + LR   + + E R  RL E          KLTV M +  +  L+++  GP  +
Sbjct: 257 FGGAVQEPLRQFGLRLQENRRSRLKERVG-------KLTVKMTVVMVLTLLIITAGPGFM 309

Query: 321 SIIDTMK 327
           S+  ++ 
Sbjct: 310 SVTRSLH 316


>gi|187923649|ref|YP_001895291.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187714843|gb|ACD16067.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 336

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 104/227 (45%), Gaps = 9/227 (3%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLIL-GIIWIFGYDKLLEYPFQLRVGAVILIGYV- 159
           L   GF    +  + L+ RLV  ++  +L G +     D         R GA++++  + 
Sbjct: 112 LEQCGFVDTRTRGLFLLARLVGALVLPVLAGTLASTHLDGS-------RYGALVIVAVMA 164

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P + +     KR+ ++    P  +DLL +    G+S+DQ+L+ V  D  G    L+
Sbjct: 165 GFMLPKLVLRRRAGKRRHAVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFRGMLPVLA 224

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E+ +   + +    R+ +     +    + +R   + L+Q D +G ++ + L+      
Sbjct: 225 GELEIAQRQFAAGRTREQSLNRLASSYDNEDLRAVVRLLVQVDLHGGAVQEPLKQFGDRL 284

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           R  R     ++   L  K+T  MI+  LP L++V  GP +L++  ++
Sbjct: 285 REARRAMLRERIGRLAVKMTGVMIVTLLPALMIVTAGPGVLAVQHSL 331


>gi|254451819|ref|ZP_05065256.1| type II/IV secretion system protein, TadC subfamily [Octadecabacter
           antarcticus 238]
 gi|198266225|gb|EDY90495.1| type II/IV secretion system protein, TadC subfamily [Octadecabacter
           antarcticus 238]
          Length = 122

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 62/117 (52%)

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           + RVA+++   +  +SEE L+  AE+    +R+ A  +   R  ++ V +    + QS  
Sbjct: 1   MTRVAQNLSMVNPAISEEFLMCQAEILAGRHREQALVDMAERIGVEEVNSFVALISQSME 60

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           YGTSI  S+     E R  R ++A++KA  L  +++  M    LP L L+ +GP I+
Sbjct: 61  YGTSISASMNAYAIEMRDAREIKAQEKANKLPVQMSGVMASMMLPALFLITLGPTII 117


>gi|284045232|ref|YP_003395572.1| type II secretion system F domain protein [Conexibacter woesei DSM
           14684]
 gi|283949453|gb|ADB52197.1| Type II secretion system F domain protein [Conexibacter woesei DSM
           14684]
          Length = 275

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 77/170 (45%), Gaps = 5/170 (2%)

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +LG+        LL     L V  V+ +G  GF AP +W+    + R   ++   PD LD
Sbjct: 85  VLGLALTLPLGALLPGRLPLVVPFVLPLG--GFVAPDLWLRRRARARGREMEAELPDLLD 142

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL + + +G+ +++A+  VA+   G    L+ E      E+     R+ A      R   
Sbjct: 143 LLRVALGAGLPLERAVGDVADRATGL---LAREWRTVAVEIGLGMPRERALVALAERCPT 199

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
             V    + L ++ R+G  +G++L     E RS R    +++AA   PK+
Sbjct: 200 PGVGVLVRTLERAARHGAPLGEALAAQAREARSTRARRLDEQAARAAPKI 249


>gi|304320651|ref|YP_003854294.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
 gi|303299553|gb|ADM09152.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
          Length = 330

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 129/279 (46%), Gaps = 33/279 (11%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVA-----VEREILRKQQITSLQKDSASSRLRTRD 76
           V+I  L +A+ +   G G   KR++S++      +R+   K+Q    +K  + S  +  D
Sbjct: 16  VAIVGLAFAL-LGFDGGGATNKRVQSLSGNAKQAKRKTSAKEQTRDRRKTISDSLKKIED 74

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
            +   N  KK++L  ++           AGF  ++S+        +V ++  ++GI ++ 
Sbjct: 75  KQKEANQKKKVSLDKLI---------EQAGF--DFSVRDFWTASAIVAVV--MIGIGYVS 121

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCA-PSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           G + L+          ++ +G VG    P  ++    +KRQ   +  + +A+D+++  V+
Sbjct: 122 GQNALV----------ILAMGIVGGLGIPRWFLYQTRRKRQKKFENEFSNAIDVIVRGVK 171

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG+ +++ L+ ++ D   QS P+ EE  L +         + + E  YNR  +  V    
Sbjct: 172 SGLPVNECLKIISRD--AQS-PVKEEFQLLVEGQRIGLTLEQSLERLYNRMPISDVNFFA 228

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
             L+   + G ++ D+L  L +  RS + M  +  A S+
Sbjct: 229 IVLVIQQQTGGNLADALGNLSTVLRSRKTMLGKIAALSM 267


>gi|254483289|ref|ZP_05096521.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
 gi|214036512|gb|EEB77187.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
          Length = 296

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 11/162 (6%)

Query: 154 ILIGYVGFCAPSVWI------SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           +L+G  G    ++WI      SN  Q R   I R  P ALDL ++ +E+G ++ + L   
Sbjct: 122 LLLGTAGGVLWAMWIKPSMLDSNATQ-RSRLIYRRIPYALDLSVLVLETGGTLREGL--- 177

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            E+I  Q+ PL+EE+ +T+ E+     +  A      R  ++ +     A+ + +  G  
Sbjct: 178 -EEISLQNDPLAEELRITLLEMDSGSTQAAALRGMGQRVGLESLETILTAINRGEETGAP 236

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
           +  +L       R  RL E EK A     K+T P ++  + V
Sbjct: 237 MVATLITQAEMFRERRLQEIEKMAVEAPTKMTFPNMMIMVSV 278


>gi|296133931|ref|YP_003641178.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032509|gb|ADG83277.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 294

 Score = 53.5 bits (127), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 75/161 (46%), Gaps = 7/161 (4%)

Query: 167 WISNLVQKRQSSIKRA----WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
           W+   ++K+    KR      P  ++ L + + +G+    A+ +V  D      PL +EM
Sbjct: 134 WVDKDLEKKLKMKKRQILIELPGFINTLALLINAGLPFSSAVHKVVHD-SDPDRPLYKEM 192

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS-DRYGTSIGDSLRVLVSETRS 281
              +A++        A+E+F  R ++  +      +IQ+ +R    I   LR L  E   
Sbjct: 193 NYVLADIGAGKPIHQAYEDFARRCRIPEITRFVSTIIQNLNRGNGDIVYVLRTLAQEAWE 252

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +R   A K+      KL  PM++ F+ V I+V + PAI+++
Sbjct: 253 KRKDIARKQGEEASSKLVFPMVMVFIAVAIIV-LAPAIMTM 292


>gi|310640814|ref|YP_003945572.1| type ii secretion system f domain protein [Paenibacillus polymyxa
           SC2]
 gi|309245764|gb|ADO55331.1| Type II secretion system F domain protein [Paenibacillus polymyxa
           SC2]
          Length = 292

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 70/151 (46%), Gaps = 3/151 (1%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV-PLSEEMLLTIAELS 230
           VQKR   I    P+ L  +++ V +G ++ +AL    E  G  +V PL  E+L T+ E  
Sbjct: 139 VQKRDQQILMELPELLSKMMLLVGAGETVQRALLHCVERKGADTVHPLYRELLQTVGEWE 198

Query: 231 FLPNRQVAFENFYNRTQMDCVR-NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
              + Q AFE+   R  +  V    T  L+   R G+    +LR L     S+R   +  
Sbjct: 199 SGYSFQQAFEHLSKRCGIQEVTIFTTTVLLNMRRGGSDFVMALRELSQTLWSKRTSISRT 258

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           +      KL  PM +  L V++LV   PA++
Sbjct: 259 RGEQASSKLVFPMALILLTVIVLV-GAPALM 288


>gi|328545275|ref|YP_004305384.1| Bacterial type II secretion system protein F domain [polymorphum
           gilvum SL003B-26A1]
 gi|326415017|gb|ADZ72080.1| Bacterial type II secretion system protein F domain [Polymorphum
           gilvum SL003B-26A1]
          Length = 339

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 146/318 (45%), Gaps = 41/318 (12%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           T +AVA+  A SI  +IYA+  P L GS   E+R+  +A      R Q  +  +    + 
Sbjct: 13  TTIAVALLAAFSIGGVIYALFEPVLSGSKRREQRLGQIAA-----RPQAASDRRPVRDAE 67

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           + R      L+ F +K   +    +   + N+L  AG   ++     ++  +V  ++FLI
Sbjct: 68  KRRKSVQDQLKEFEEKQKARQKRANSLTLTNRLEQAGL--DWERKHFIIFSIVSGLVFLI 125

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           LG +       L   P  +   A+  +G +GF  P  +++   +KR  +     P+A+D+
Sbjct: 126 LGFL-------LTRSP--ILTLAIAFVGGLGF--PRWYLARRRRKRFDAFLNELPNAVDI 174

Query: 190 LLICVESGISIDQALRRVAED----IGGQSVPLSEE--MLLTIAE-LSFLPNR-QVAFEN 241
           ++  V++G+ +   ++ VA +    + G+   + E   M LT+ E +  LP+R  +A  N
Sbjct: 175 IVRGVKAGLPLGDCIKIVASEARDPVAGEFRKIVEAQVMGLTLTEAVGRLPDRVPLAEAN 234

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           F+          A    IQ  + G  + ++L  L    R  + ++ + +A S   K +  
Sbjct: 235 FF----------AIVVAIQ-QQAGGGLSEALGNLGKVLRGRKTLKGKIRALSSEAKSSAA 283

Query: 302 MI--IFFLPVLILVIIGP 317
           +I  + F+  LIL +I P
Sbjct: 284 IIGSLPFIVSLILYLIAP 301


>gi|85711971|ref|ZP_01043025.1| Flp pilus assembly protein TadC [Idiomarina baltica OS145]
 gi|85694157|gb|EAQ32101.1| Flp pilus assembly protein TadC [Idiomarina baltica OS145]
          Length = 264

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 6/152 (3%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRV--AEDIGGQSVPLSEEMLLTIAELS 230
           + +Q+ I R  PD  DLL + + SG+ +  AL RV  A  +G     L+ E+     ++ 
Sbjct: 112 RSKQARIYRELPDFSDLLAMMLASGLPLIPALDRVSKASSMG----YLANEISYVGQQIR 167

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
              +   AF    +  +++ +    + L +  + G S+ ++L     + R E+L  AEKK
Sbjct: 168 RGRDLTSAFTGLADLYRVNALSEWCKLLNRGYQQGNSLTEALLFFSEQLRDEQLNLAEKK 227

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           A     KL +P++  F PV  LVI+GP  + +
Sbjct: 228 AQEAPVKLLLPLLSCFFPVNFLVILGPIFIQL 259


>gi|315652230|ref|ZP_07905225.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315485536|gb|EFU75923.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 284

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 75/149 (50%), Gaps = 4/149 (2%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +++ +  R+  + R +P  L  L + + +G+ I +A  +VA    G    L +EM  T  
Sbjct: 131 LNDKINARRDELLRDYPGMLSKLTLLINAGMPIREAWIKVANTNEG---ILYQEMKNTAM 187

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS-IGDSLRVLVSETRSERLME 286
           EL        A++ F  R  +  +R  +  +IQ+ + G++ + + LR + +E   E+  E
Sbjct: 188 ELYNGMQEAEAYKTFGERCSIKSLRKFSTMMIQNLQKGSNEVVEFLRDMSTEAWEEKKHE 247

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVII 315
            ++K      KL +P+ + F  VLIL+I+
Sbjct: 248 VKRKGEKASNKLLLPIGLIFAGVLILIIV 276


>gi|289675688|ref|ZP_06496578.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           FF5]
          Length = 252

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 108/238 (45%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+    + K ++ P
Sbjct: 14  RIGQRSISLDSETQILLNRIGWRRASKRSLFAACQVGVPVGLMVVAILGQMLFFKGIQQP 73

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           F   +  +  +G  G+  P   ++ + ++RQ  +       + LL I  ESG++++QALR
Sbjct: 74  F---IAPIFALG-AGYLLPKRILATVARRRQKQVVVEISTFIPLLRILFESGMAVEQALR 129

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 130 VLSNE-GKDLLPVLSEEIRVVLMRVDSGLELGEELRKTAALLDVDELSDTCVILNQLIHQ 188

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 189 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 246


>gi|15599496|ref|NP_252990.1| TadC [Pseudomonas aeruginosa PAO1]
 gi|107100116|ref|ZP_01364034.1| hypothetical protein PaerPA_01001137 [Pseudomonas aeruginosa PACS2]
 gi|116052334|ref|YP_792645.1| hypothetical protein PA14_55860 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893392|ref|YP_002442261.1| TadC [Pseudomonas aeruginosa LESB58]
 gi|254239030|ref|ZP_04932353.1| hypothetical protein PACG_05207 [Pseudomonas aeruginosa C3719]
 gi|254244889|ref|ZP_04938211.1| hypothetical protein PA2G_05762 [Pseudomonas aeruginosa 2192]
 gi|9950522|gb|AAG07688.1|AE004846_5 TadC [Pseudomonas aeruginosa PAO1]
 gi|115587555|gb|ABJ13570.1| putative pilus assembly protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170961|gb|EAZ56472.1| hypothetical protein PACG_05207 [Pseudomonas aeruginosa C3719]
 gi|126198267|gb|EAZ62330.1| hypothetical protein PA2G_05762 [Pseudomonas aeruginosa 2192]
 gi|218773620|emb|CAW29434.1| TadC [Pseudomonas aeruginosa LESB58]
          Length = 303

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 77/168 (45%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   + +  + R++ I       + L+ I  ++G++++Q LR V  +  G +  L
Sbjct: 132 IGFLLPKQVLKHFAKARRALIADEMILFVQLIRILFDAGLTVEQTLRVVCLEGRGITPQL 191

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L +       +     E    R Q+D + +    L Q  R G S   +L  L   
Sbjct: 192 ARELDLALTRADNGIDLAEELEALARRLQVDPLNDCCGVLRQMLRQGGSARSTLLTLKQL 251

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               RL   +++   L  K+++ M++   P L++V+ GP +++I   +
Sbjct: 252 FEDRRLTTLQERIGKLSAKMSLVMMVLLFPALLIVLAGPGVIAITKAL 299


>gi|49084732|gb|AAT51226.1| PA4300 [synthetic construct]
          Length = 304

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 77/168 (45%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   + +  + R++ I       + L+ I  ++G++++Q LR V  +  G +  L
Sbjct: 132 IGFLLPKQVLKHFAKARRALIADEMILFVQLIRILFDAGLTVEQTLRVVCLEGRGITPQL 191

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L +       +     E    R Q+D + +    L Q  R G S   +L  L   
Sbjct: 192 ARELDLALTRADNGIDLAEELEALARRLQVDPLNDCCGVLRQMLRQGGSARSTLLTLKQL 251

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               RL   +++   L  K+++ M++   P L++V+ GP +++I   +
Sbjct: 252 FEDRRLTTLQERIGKLSAKMSLVMMVLLFPALLIVLAGPGVIAITKAL 299


>gi|156975614|ref|YP_001446521.1| hypothetical protein VIBHAR_03347 [Vibrio harveyi ATCC BAA-1116]
 gi|156527208|gb|ABU72294.1| hypothetical protein VIBHAR_03347 [Vibrio harveyi ATCC BAA-1116]
          Length = 187

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 73/144 (50%), Gaps = 1/144 (0%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           + +  P  LD++ +CV++ ++I+ +   +A+++      L  ++  T +E   +   + A
Sbjct: 36  VSKNLPYVLDIMSVCVQTCMTIEASFAYLAQELKIFDKDLCYQINKT-SEAGKVHGIEKA 94

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
             +   R     + +    +IQ+  YG S+ + L  L  + R  +L+E E+K   L  K+
Sbjct: 95  LHDLSVRLPAPEINSFVLTIIQNLHYGASVANVLSDLAEDMRRIKLLEIEEKMGKLSAKM 154

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           +VP+I+  +  +++ I+ P  L I
Sbjct: 155 SVPLILLIMFPIVIFILAPGFLQI 178


>gi|311111713|ref|YP_003982935.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
 gi|310943207|gb|ADP39501.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
          Length = 310

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 121/295 (41%), Gaps = 28/295 (9%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P+ G   +  +M+SV++   + R+ Q++      A         +S    V+    +   
Sbjct: 28  PNFGE-RIAPQMRSVSIRESLHRENQVSGTSVLDALYSFLEPMMQSFLGRVRSTESR--- 83

Query: 94  VDENIVNKLRAAG-------FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
            DE +  +LR AG       FR+E    IL  V  V      +LG++ + G   LLE   
Sbjct: 84  -DEALAARLRRAGSDQTVSAFRAE---QILWAVSSVA-----LLGVLSVIG---LLENQL 131

Query: 147 QLRVGAVILI--GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
            L  G +++I  G  GF A   W+  ++ +R+  +   +P   +++ + V +G S   +L
Sbjct: 132 SLWSGLMLIILGGVTGFLARDWWLGQIIVRREKQLIAEFPALAEMMALSVAAGESALASL 191

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            R+     G+   L+ E    +A+     +   A   F   TQ+  +      +  +   
Sbjct: 192 ERICRTSRGE---LAREFNDILAQTRAGSSLLAALNEFAQSTQIPALSRFVDGVAVAIER 248

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           GT + D LR    + R     E  + A      +  P++   LP+ ++  I P +
Sbjct: 249 GTPLADVLRAQAQDVRDNAKRELLEVAGKKEIAMLAPVVFLILPLTVVFAIFPGL 303


>gi|188592036|ref|YP_001796634.1| type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938410|emb|CAP63397.1| Type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 356

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/238 (20%), Positives = 100/238 (42%), Gaps = 17/238 (7%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
           D+ ++ +    G ++     +L   RL +P+    L ++W  G              AV+
Sbjct: 127 DQQLLEQCGWYGLQARVVFGVL---RLGLPMALSALAMLWHLGASGF----------AVV 173

Query: 155 LIGY----VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
             G+    V + AP  ++     +R   +    P  +D+L +    G+SIDQ+L+ +  +
Sbjct: 174 AWGFGTFAVAYLAPKWYLRRRAAERLRRVDDELPVLIDMLRLLQGVGLSIDQSLQVIVAE 233

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
            G     L  E+     + +   +R+            + +++    L Q D++G ++ +
Sbjct: 234 FGSMLRVLGPELARANQQFASGRSREQTLLRIGRLFDSEDLKSLITLLTQVDKHGGAVQE 293

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            LR      +  R    + +   L  K+T  M++  LPVL+++  GP  L +I  + +
Sbjct: 294 PLRQFGLRMQEARKSRMKDEIGRLTVKMTAVMVVSLLPVLLILTAGPGFLGVIRMLAN 351


>gi|198284409|ref|YP_002220730.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665047|ref|YP_002427077.1| tight adherence protein TadC [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248930|gb|ACH84523.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517260|gb|ACK77846.1| tight adherence protein TadC [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 312

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 3/184 (1%)

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
            +L+  F + + AV ++GY+    P   + +  + R  ++    P  +D+L +    G+S
Sbjct: 125 HMLKLTFWMSLLAVAIVGYL---LPKFILESKAKSRGDAVNAEIPFFVDMLALLQGVGLS 181

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           ++Q+L  +A+        L+ EM      ++    R  A +    +            L 
Sbjct: 182 LEQSLASLAQTSEAGIPLLAGEMREMGKHIAIGRPRVEAMQKLAEQLGDPDFEELVNMLR 241

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q +R+G  +   LR      + +R M   ++   L  K+T  M +  LP L+L+  GPA+
Sbjct: 242 QIERFGGDVAQPLRDFAGRLQEKRQMALRERVGKLNVKMTAVMTLTMLPALLLITAGPAV 301

Query: 320 LSII 323
           L+++
Sbjct: 302 LALL 305


>gi|225572862|ref|ZP_03781617.1| hypothetical protein RUMHYD_01053 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039788|gb|EEG50034.1| hypothetical protein RUMHYD_01053 [Blautia hydrogenotrophica DSM
           10507]
          Length = 337

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV---PLSEEMLLT 225
            N  +KR+  +   +P  +    + +++G+S+  A ++++ED   ++    P  EE+  T
Sbjct: 178 ENSRKKREEELIMDYPGLVTKFTLLIQAGMSVRGAFQKISEDCETKTKDRRPGYEEVRRT 237

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERL 284
             E+    +++ A++NF  R      +  +  L+Q+ R G  ++ D L    +E   ER 
Sbjct: 238 CIEMDSGVSQKEAYQNFGQRCAQAKYKTFSTLLVQNLRSGNRNLVDMLERESTEAWEERK 297

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             A     +   KL VPMI+    VL L++I PA LS 
Sbjct: 298 RRARIHGETAATKLLVPMILMLGVVLALLMI-PACLSF 334


>gi|222111306|ref|YP_002553570.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221730750|gb|ACM33570.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 279

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 74/151 (49%), Gaps = 4/151 (2%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           F  P +    L ++R++ +    PDAL++L   + SG S+  A+  VA +      P S+
Sbjct: 86  FVLPRMAYGYLKRRREAKLIEQMPDALNMLAGSLRSGASLAIAMDLVATE---TPPPFSQ 142

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ L + E     + + AFE+F  R  ++ V     A+  S   G ++ + L  L S  R
Sbjct: 143 ELSLVLREQKLGVSLEDAFESFAKRVNLEDVNLLVSAITISKDVGGNLSEVLERLASTLR 202

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           ++  ME + +A +   KL   +++  LPV +
Sbjct: 203 AKAAMEGKIRALTSQGKLQ-GIVVGLLPVFL 232


>gi|330873645|gb|EGH07794.1| hypothetical protein PSYMP_04415 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963434|gb|EGH63694.1| hypothetical protein PSYAC_02052 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 294

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 107/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VPI  + + I+    + K +E P
Sbjct: 56  RIGQRSISLDSETQVLLNRIGWRRATKRSLFAACQVGVPIALMSMVILAQVLFFKEIEQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           F   +  +  +G +G+  P   ++   Q+RQ  +       + LL I  ESG++++QALR
Sbjct: 116 F---IAPIFALG-IGYLLPKRVLAAAAQRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LS+E+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSNE-GKDLLPVLSDEIRVVLTRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFIAI 288


>gi|116620535|ref|YP_822691.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223697|gb|ABJ82406.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 323

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 8/188 (4%)

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           FG   ++ + F     AV+L    G  AP V +     KR ++++  +P++LD L   + 
Sbjct: 106 FGLGLMMPFLFNAPTTAVVLALLFG-SAPYVVVRQKRSKRLATLEEQFPESLDFLARSMR 164

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G +   +L  + E++     PL +E      E +       A  NF  R  +  VR  T
Sbjct: 165 AGHAFSISLEMLGEELAD---PLGQEFRALFNEQNLGAPLDTALRNFTTRVPLLDVRFFT 221

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV---LIL 312
            +++   + G ++ + L  L    R    ++ + KAAS   +LT   I+  LPV   L L
Sbjct: 222 SSVLLQKQTGGNLSEILARLAYVIRERFRLKGQVKAASAHGRLTA-TILTLLPVGTMLAL 280

Query: 313 VIIGPAIL 320
           +++ P  L
Sbjct: 281 LVVAPGYL 288


>gi|187926431|ref|YP_001892776.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|241665918|ref|YP_002984277.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|187728185|gb|ACD29349.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|240867945|gb|ACS65605.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 329

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/261 (18%), Positives = 113/261 (43%), Gaps = 15/261 (5%)

Query: 74  TRDSKSLRNFVKKLNLKAI-------LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
           +R+++ L+  + K+  + I       +V E     L   G+  E++  +    R+++P +
Sbjct: 72  SREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDRKLLEECGYYGEHARTVFGGTRILLPPL 131

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             + G +       L  + F     A+      G+ AP   +    + R+  +    P  
Sbjct: 132 LAVFGAL--HASSALFVFVFGFVGFAL------GYLAPKWLLGRRKESRRRRMDDELPVM 183

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +   +R+          
Sbjct: 184 VDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRANQQFASGRSREQTLLRIARLF 243

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
             + ++     L Q DR+G ++ + LR      +  R    +++   L  ++T+ M++  
Sbjct: 244 DNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRRARLKERVGKLTVQMTMIMVMTL 303

Query: 307 LPVLILVIIGPAILSIIDTMK 327
           LP L+++  GP  + ++ +++
Sbjct: 304 LPALLIITAGPGFMGVMRSLQ 324


>gi|221066735|ref|ZP_03542840.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220711758|gb|EED67126.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 338

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 79/163 (48%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   +S    +R+  +    P  +DLL +    G+SIDQ+L+ ++++ G     LS E+ 
Sbjct: 170 PKWLVSYKSSQRREQVVEELPLFVDLLRLLQGVGLSIDQSLQILSQEFGSVLPVLSSELA 229

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           +     +   +R  + +   + +    +      L+Q DR+G ++   L+      R +R
Sbjct: 230 MANQLYASGRSRDQSLQRLTHLSDDQDMTAVVNLLVQVDRHGGAVQGPLQDFGIRLREKR 289

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               ++K  ++  K+T  M++  LP L+++  GP  +++I ++
Sbjct: 290 QARFKEKIGAITVKMTGVMVLTLLPALMVITAGPGFMAVIRSL 332


>gi|28871970|ref|NP_794589.1| hypothetical protein PSPTO_4855 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968012|ref|ZP_03396158.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|301383672|ref|ZP_07232090.1| hypothetical protein PsyrptM_13608 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059959|ref|ZP_07251500.1| hypothetical protein PsyrptK_08205 [Pseudomonas syringae pv. tomato
           K40]
 gi|302131625|ref|ZP_07257615.1| hypothetical protein PsyrptN_09542 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855223|gb|AAO58284.1| membrane protein, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927355|gb|EEB60904.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|331014704|gb|EGH94760.1| hypothetical protein PLA106_02330 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 294

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 107/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VPI  + + I+    + K +E P
Sbjct: 56  RIGQRSISLDSETQVLLNRIGWRRATKRSLFAACQVGVPIALMSMVILAQVLFFKDIEQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           F   +  +  +G +G+  P   ++   Q+RQ  +       + LL I  ESG++++QALR
Sbjct: 116 F---IAPIFALG-IGYLLPKRVLAAAAQRRQKKVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LS+E+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSNE-GKDLLPVLSDEIRVVLTRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFIAI 288


>gi|227875850|ref|ZP_03993976.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269977485|ref|ZP_06184457.1| type II secretion system protein [Mobiluncus mulieris 28-1]
 gi|306819131|ref|ZP_07452845.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
 gi|307700029|ref|ZP_07637078.1| type II secretion system F domain protein [Mobiluncus mulieris
           FB024-16]
 gi|227843598|gb|EEJ53781.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269934401|gb|EEZ90963.1| type II secretion system protein [Mobiluncus mulieris 28-1]
 gi|304648107|gb|EFM45418.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
 gi|307614790|gb|EFN94010.1| type II secretion system F domain protein [Mobiluncus mulieris
           FB024-16]
          Length = 297

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 87/175 (49%), Gaps = 11/175 (6%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A+++   +G   P   +S   ++RQ  + +  PDA++LL + V +G S+  AL RVA   
Sbjct: 124 AILVFPLMGVVYPDYRLSAGAKQRQMQLNQELPDAIELLALAVGAGESLYMALERVASRC 183

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
              +    EE+   +AEL       ++  ++  RT+ + + +   A++ +   G+ +   
Sbjct: 184 TQVT---GEELTRLMAELKQGEALSMSLTSWRTRTESEVLSHLVDAVVSALERGSPLAQV 240

Query: 272 LRVLVSETRS----ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           LR  V+++RS    + L +  KK       + +P++   LP+ ++  + P ++++
Sbjct: 241 LREQVADSRSAARNQLLAQGGKKEV----WMMIPVVFLILPLTVVFALYPGLVAL 291


>gi|84498180|ref|ZP_00996977.1| putative membrane protein [Janibacter sp. HTCC2649]
 gi|84381680|gb|EAP97563.1| putative membrane protein [Janibacter sp. HTCC2649]
          Length = 654

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 12/189 (6%)

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
           +L  P+   V   I +GY  F  P+  +  L  +R    ++  PD L L+   + SG S+
Sbjct: 444 VLAMPWWFTVPIGIALGY--FL-PAAVLRMLAGRRAKKFEQMLPDILMLVATTLASGFSL 500

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL-I 259
            QAL  VA D    + P  +E   T+AE     +   A EN   R   + +R  T A+ I
Sbjct: 501 TQALDAVARD---SAQPAGKEFSRTLAETRIGADVSDALENMSVRMDSEAMRWTTMAIRI 557

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG--- 316
           Q D  G ++ D+LR      R    ++ +  + S   +L+   I+  LP+L+ V +    
Sbjct: 558 QRD-VGGNLADTLRTTAHTLRERESLKRQVNSLSAEGRLSA-YILLGLPILLFVYMAWSN 615

Query: 317 PAILSIIDT 325
           PA  S++ T
Sbjct: 616 PAYTSLLWT 624


>gi|300741822|ref|ZP_07071843.1| putative type II secretion system protein F domain protein [Rothia
           dentocariosa M567]
 gi|300381007|gb|EFJ77569.1| putative type II secretion system protein F domain protein [Rothia
           dentocariosa M567]
          Length = 310

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 98/234 (41%), Gaps = 23/234 (9%)

Query: 95  DENIVNKLRAAG-------FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           DE +  +LR AG       FR+E    IL  V  V      +LG++ + G   LLE    
Sbjct: 84  DEALAARLRRAGSDQTVSAFRAE---QILWAVSSVA-----LLGVLSVIG---LLENQLS 132

Query: 148 LRVGAVILI--GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
           L  G +++I  G  GF A   W+  ++ +R+  +   +P   +++ + V +G S   +L 
Sbjct: 133 LWSGLMLIILGGVTGFLARDWWLGQIIVRREKQLIAEFPALAEMMALSVAAGESALASLE 192

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           R+     G+   L+ E    +A+     +   A   F   TQ+  +      +  +   G
Sbjct: 193 RICRTSRGE---LAREFNDILAQTRAGSSLLAALNEFAQSTQIPALSRFVDGVAVAIERG 249

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           T + D LR    + R     E  + A      +  P++   LP+ ++  I P +
Sbjct: 250 TPLADVLRAQAQDVRDNAKRELLEVAGKKEIAMLAPVVFLILPLTVVFAIFPGL 303


>gi|296390999|ref|ZP_06880474.1| TadC [Pseudomonas aeruginosa PAb1]
 gi|313106819|ref|ZP_07793031.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
 gi|310879533|gb|EFQ38127.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
          Length = 303

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 77/168 (45%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P   + +  + R++ I       + L+ I  ++G++++Q LR V  +  G +  L
Sbjct: 132 IGFLLPKQVLKHFAKARRALIADEMILFVQLIRILFDAGLTVEQTLRVVCLEGRGITPQL 191

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L +       +     +    R Q+D + +    L Q  R G S   +L  L   
Sbjct: 192 ARELDLALTRADNGIDLAEELDALARRLQVDPLNDCCGVLRQMLRQGGSARSTLLTLKQL 251

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
               RL   +++   L  K+++ M++   P L++V+ GP +++I   +
Sbjct: 252 FEDRRLTTLQERIGKLSAKMSLVMMVLLFPALLIVLAGPGVIAITKAL 299


>gi|254426916|ref|ZP_05040623.1| Bacterial type II secretion system protein F domain [Alcanivorax
           sp. DG881]
 gi|196193085|gb|EDX88044.1| Bacterial type II secretion system protein F domain [Alcanivorax
           sp. DG881]
          Length = 291

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 105/235 (44%), Gaps = 21/235 (8%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E+I   L+  G   E S  I L+   ++P++   +G ++ FG            +G  +L
Sbjct: 72  EDIRLALKGMGKTREQSQVIYLLSCWLLPVLVAAIGFLF-FGA-----------LGG-LL 118

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
           +   GF  P   I  +  + +        +   +  + +E+G+S+++ LR     IG Q 
Sbjct: 119 MSAAGFILPRRTIRGMGAQAEMRQNLEAVELCHMTRMLMEAGLSLERVLR----IIGVQG 174

Query: 216 VPLSEEMLLTIAELSFL----PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            PL   ++  I   + L      R  A +      ++  +R+    + QS + G  +  S
Sbjct: 175 RPLLPILIARIDRFNRLMKSGAERTQALDELGENKRIPVLRSYVVLMKQSSQLGAGVSHS 234

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           L  ++ E ++       ++   +G K+TV M+ F LP L ++I GPA++SI + +
Sbjct: 235 LDQIIDEAQNVERNRIREETNRIGAKMTVIMMAFMLPALFILIGGPAVVSIAEAL 289


>gi|160893699|ref|ZP_02074483.1| hypothetical protein CLOL250_01253 [Clostridium sp. L2-50]
 gi|156864684|gb|EDO58115.1| hypothetical protein CLOL250_01253 [Clostridium sp. L2-50]
          Length = 434

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 84/170 (49%), Gaps = 10/170 (5%)

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
           IG +  C     +    QKR   + +A+P  +DLL + + +G+++  AL ++       S
Sbjct: 270 IGVLLVCKGYSDLHKAGQKRNQELMQAYPSFVDLLSLYMGAGLTVKGALLKIV--TMTDS 327

Query: 216 VPLSEEMLLTIAEL-SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             LSEE+  T+ E+ S +P  +  +    NR ++         L Q+ R GT   D L +
Sbjct: 328 RILSEEINYTLNEIRSGIPETE-GYYRLGNRLELPVYLKMMTLLSQNIRKGTR--DILNM 384

Query: 275 LVSETRSERLME---AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           L  E  S   ++   A+KK    G +L  PMI+  L V+++++I PA++ 
Sbjct: 385 LAEEELSALQLKRELAKKKGEEAGTRLLFPMIL-QLGVVMIIVIAPALMG 433


>gi|260768630|ref|ZP_05877564.1| type II secretion system protein [Vibrio furnissii CIP 102972]
 gi|260616660|gb|EEX41845.1| type II secretion system protein [Vibrio furnissii CIP 102972]
          Length = 296

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 101/232 (43%), Gaps = 14/232 (6%)

Query: 97  NIVNKLRAAGFRS-EYSLNILLVVRLVVPIIFLIL-GIIWIFGYD---KLLEYPFQLRVG 151
            +V  +R AG+ S    +  L  + LV   +FLIL G  ++F        L Y   + +G
Sbjct: 69  QVVLNMRQAGYISGRQQILCLFKMFLVWSGLFLILTGQQYLFSSSIERTFLYYALFMAIG 128

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A++ I          WI     +R   I      A+ ++ I  + G+S+++ L+   ++ 
Sbjct: 129 ALVSI---------RWIRMQANRRAKIIDEEMLTAVHMMAILWQVGLSLERLLKTYHQEA 179

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
              +  +++++ L IA +    NR+  F +    T     ++    L Q    G  +  S
Sbjct: 180 SDLTPEMNKDIALIIARIDAGQNREWVFRDMATLTLSTGFQDLLSMLSQGSETGGGLKKS 239

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + L       + +  ++K   +  K++V M+    P L +++ GPA L+++
Sbjct: 240 FQSLADLLYERKRVALQEKVTKMSGKISVTMMALMFPALFIILGGPAALALM 291


>gi|325111218|ref|YP_004272286.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324971486|gb|ADY62264.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 286

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 9/164 (5%)

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L  +VGF  P   +  +  +RQ  I R  P  +D L     +G S+DQ L  VA D    
Sbjct: 85  LAAFVGFVIPLGILMTMRSRRQGQILRQLPPMIDELARAARTGRSLDQCLEMVATDT--- 141

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
             PL +EM  ++ +L        A      RT ++ +R    AL    + G   GD +RV
Sbjct: 142 PAPLGDEMERSVRKLQMGVTMNEALYELPERTGVNGLRILATALSVHQQTG---GDLVRV 198

Query: 275 LVSETRSER---LMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           L    R+ R   +     +A + G + T  ++I   P +++  I
Sbjct: 199 LERLARTLRDRGMFLGRLRAITAGSRATALLMILLPPAILVFFI 242


>gi|307293453|ref|ZP_07573299.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881519|gb|EFN12735.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 332

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 127/311 (40%), Gaps = 46/311 (14%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +AV +TT + + ++ +A   P     +  KR           R + I     DSA + L 
Sbjct: 8   MAVLLTTMLGLIAMAFAGPSPD----KARKR-----------RMELIRGRHSDSADAILE 52

Query: 74  TRDSKSLRNFVKKLNLKAILVD-----ENIVNKLRAAGFR---SEYSLNILLVVRLVVPI 125
            R  K++ N         +LV      EN+  ++R  G +   S+Y  +          +
Sbjct: 53  ARMRKAISNRPTGAE-STMLVSLVPNPENLAKRIRMTGKKWTVSQYMTS--------CAV 103

Query: 126 IFLIL-GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           IFL+L  ++ + G+  L          AV+L    G   P +W+S L+ KR       +P
Sbjct: 104 IFLVLCALLMLRGFAPLF---------AVMLGLAAGLGLPHMWVSRLINKRVQQFTAKFP 154

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DAL+LL   + SG+ I + L  V+ ++ G   P+ EE  L    +        A +   +
Sbjct: 155 DALELLTRGLRSGLPIAETLGVVSSEVPG---PVGEEFKLITERIKIGKTMDQALQETAD 211

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R      +    +L      G ++ ++L  L +  R    M+ + +A S   K +   II
Sbjct: 212 RLGTAEFQFFVISLAIQRETGGNLAETLSNLATVLRQRSQMKLKIRAMSSESKASA-YII 270

Query: 305 FFLPVLILVII 315
             LP  +  +I
Sbjct: 271 GVLPFTVFGLI 281


>gi|220913151|ref|YP_002488460.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860029|gb|ACL40371.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 312

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A+I  G  GF     W+   V++R+  +   +P   +L+ + V +G S   AL RV    
Sbjct: 141 AIIGSGISGFIVRDYWLGVQVRRREERMMAEFPSLAELMALAVGAGESATGALDRVCRSA 200

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G+   LS+E    +AE         A + F  RT +  +      ++ +   GT + D 
Sbjct: 201 RGE---LSKEFSTILAETRAGKPLVNALQEFSARTDLAPLVRFVDGIVVAVERGTPLADV 257

Query: 272 LRVL---VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           LR     V +T    LMEA  K       + VP++   LP+ ++  + P I +I
Sbjct: 258 LRAQAQDVRDTAKRDLMEAAGKKEI---AMMVPLVFGVLPLTVVFAVFPGISAI 308


>gi|254505024|ref|ZP_05117175.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222441095|gb|EEE47774.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 339

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 153/328 (46%), Gaps = 45/328 (13%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAV--EREILRK-QQITSLQKDS 67
           T  AVAI    S+  +IY + +PSL G+ + + RM +V+   + E  RK  + T+ +K S
Sbjct: 13  TGAAVAILVMFSVGGIIYGLFLPSLSGTKKRDARMSAVSARPQSETQRKTMRDTNRRKKS 72

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
              +L+  + +      K+ N+        +  K+  AG   E+ +  L++  +V  I+F
Sbjct: 73  IQDQLKDFEERQKAKHEKQKNVP-------LKVKIEQAGL--EWEMRHLVLFSVVSAILF 123

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            ++ +I       LL         A   +G +GF  P  +I N  ++R ++     P+ +
Sbjct: 124 FVISLI---ASGNLLI------AAAFTFVGGIGF--PRWYIGNKRKRRFNAFLNELPNGI 172

Query: 188 DLLLICVESGISIDQALRRVA----EDIGGQSVPLSEE--MLLTIAE-LSFLPNRQVAFE 240
           D+++  V++G+ +   ++ VA    E +  +   ++E   M +++AE LS +P+R    E
Sbjct: 173 DIIVRGVKAGLPLSDCVKVVAREAREPVATEFRKVTETQVMGVSLAEALSKMPDRVPLPE 232

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
             +    +   + A   L +      ++G+  RVL    R  + M+A+ KA S   K + 
Sbjct: 233 TNFLAIVVSIQQKAGGGLAE------ALGNLSRVL----RQRKAMKAKIKALSSEAKSSA 282

Query: 301 PMIIFFLPVL---ILVIIGPAILSIIDT 325
             II  LP +   IL  I P  + I+ T
Sbjct: 283 A-IIGALPFVVGGILFFIAPDYMMILFT 309


>gi|309778765|ref|ZP_07673538.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308922473|gb|EFP68097.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 329

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 114/269 (42%), Gaps = 31/269 (11%)

Query: 74  TRDSKSLRNFVKKLNLKAI-------LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
           +R+++ L+  + K+  + I       +V E     L   G+  E++  +    R+++P +
Sbjct: 72  SREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDRKLLEECGYYGEHARTVFGGTRILLPPL 131

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             + G +       +L       VG  +     G+ AP   +    + R+  +    P  
Sbjct: 132 LAVFGALHA---SSVLFVFVFGFVGFAL-----GYLAPKWLLGRRKESRRRRMDDELPVM 183

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +D+L +    G+SIDQ+L+ +A +  G        ML  +A      N+Q A      +T
Sbjct: 184 VDMLRLLQGVGLSIDQSLQVIANEFHG--------MLPVLAGEFGRANQQFASGRPREQT 235

Query: 247 QMDCVR--------NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            +   R             L Q DR+G ++ + LR      +  R    +++   L  ++
Sbjct: 236 LLRIARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRRARLKERVGKLTVQM 295

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           T+ M++  LP L+++  GP  + ++ +++
Sbjct: 296 TMIMVMTLLPALLIITAGPGFMGVMRSLQ 324


>gi|325958171|ref|YP_004289637.1| type ii secretion system F domain-containing protein
           [Methanobacterium sp. AL-21]
 gi|325329603|gb|ADZ08665.1| Type II secretion system F domain protein [Methanobacterium sp.
           AL-21]
          Length = 310

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 83/171 (48%), Gaps = 13/171 (7%)

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY-VGFCAPSV----WISNLVQKRQSSIK 180
           + LI GII  FG   LL +     +G   ++G+ VGF  PS     W+   +++R  +I+
Sbjct: 46  LMLIAGII--FGLIGLLSFSL---IGITPILGFLVGFLTPSFIVLGWLFFSMERRVDAIE 100

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           +  PD L  +   + +G+ I+ AL  +++  GG   PL+ E+   + E+    +   A  
Sbjct: 101 QTTPDFLRQISSLLRAGVGIETALEDISKQGGG---PLNAELKRAVIEIKIGSSFDEALL 157

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
           +   R +   +    + +++  R G S+ D +  +  + R+   ++ E++A
Sbjct: 158 SMGERLKSKTLDRTFRMILEGKRVGGSLSDVIETVAEDLRAVLALKRERRA 208


>gi|283778971|ref|YP_003369726.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437424|gb|ADB15866.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 309

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 13/170 (7%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +IL+G      P++ ++   QKR   I++  P  L+LL    E+G+  D A++R+     
Sbjct: 128 IILLGLSAL--PALVVNRSRQKRVEMIEQDLPLTLELLATLSEAGLGFDAAMQRI----- 180

Query: 213 GQSV-----PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            QS      PL+ E     A+L     R  +     +R Q+  +     AL+Q+++ G  
Sbjct: 181 -QSTRLAVRPLASEFRSYQADLLAGRPRTQSLRRLSSRIQVPAISIFVSALVQAEQLGMG 239

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           I   LR    + R  R   A   A SL  K  +P+++ FLP L +  +GP
Sbjct: 240 IAQVLRRQADDMRDRRRERANAFAMSLTVKRVIPLVVCFLPGLFVWTLGP 289


>gi|167760287|ref|ZP_02432414.1| hypothetical protein CLOSCI_02660 [Clostridium scindens ATCC 35704]
 gi|167662170|gb|EDS06300.1| hypothetical protein CLOSCI_02660 [Clostridium scindens ATCC 35704]
          Length = 382

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 87/191 (45%), Gaps = 7/191 (3%)

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
           Y K ++Y   + +   ILI  + +      I    ++++  +   +P+ ++ L + + +G
Sbjct: 191 YYKKMDYRGLVLIVMAILIAILLYALKQQNIRKEGEEKKRQMMLDYPEIVNKLALFLGAG 250

Query: 198 ISIDQALRRVAED-----IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           +++ +A R+V ED       G +    EEM     E+        ++ENF  R  +    
Sbjct: 251 MTVKRAWRKVVEDYERHKTDGNARHAYEEMKKACYEMESGVMETESYENFGRRCNVQSYI 310

Query: 253 NATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
                L Q+ R GT  +   LR+   +   ER   A++     G KL +PM +    VLI
Sbjct: 311 RLGALLSQNLRKGTKGLTHLLRLESIQAFEERKARAKRLGEEAGTKLLLPMFLMLAIVLI 370

Query: 312 LVIIGPAILSI 322
           +VI+ PA LSI
Sbjct: 371 IVIV-PAFLSI 380


>gi|237798377|ref|ZP_04586838.1| type II secretion system protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021229|gb|EGI01286.1| type II secretion system protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 295

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 105/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VPI  + +  +    + K +E P
Sbjct: 56  RIGQRSISLDSETQVLLNRIGWRRARKRSLFAACQIGVPIGLMCVVALGQLLFFKNIEQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  V  +G  G+  P   ++ + ++RQ  I       + LL I  ESG++++QALR
Sbjct: 116 L---IAPVFALG-AGYLLPKRALAAVAKRRQKQIVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            V  + G   +P LSEE+ + +A +                  +D + +    L Q    
Sbjct: 172 -VLSNEGKDLLPVLSEEIRVVLARVDSGLELGEELRKMAALLDVDELSDTCIILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K+++ M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSMVMMVFLFPALLIVLAGPGFIAI 288


>gi|71733529|ref|YP_276554.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483343|ref|ZP_05637384.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298488955|ref|ZP_07006978.1| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|71554082|gb|AAZ33293.1| type II secretion system protein F domain protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298156453|gb|EFH97550.1| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320322734|gb|EFW78827.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330481|gb|EFW86460.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330887979|gb|EGH20640.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330989172|gb|EGH87275.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012562|gb|EGH92618.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 294

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 107/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+      K +E P
Sbjct: 56  RIGQRSISLDSETQMLLNRIGWRRASKRSLFAACQVGVPVGLMVVVIVAQLLLFKGVEQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  V  +G +G+  P   ++ + Q+RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPVFALG-IGYLLPKRILAAVAQRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSLE-GKDLLPVLSEEIRVVLVRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFIAI 288


>gi|295395216|ref|ZP_06805424.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971978|gb|EFG47845.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 312

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 81/171 (47%), Gaps = 10/171 (5%)

Query: 153 VILIGYVGFCAPSVWI-SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           +I++G VG    + W+ +  V+KR+  I   +P   +LL + + +G     AL RV    
Sbjct: 141 LIVLGGVGGHFLNDWLLTQAVKKREERILAEFPTIAELLALSITAGEGTVDALNRVCHTA 200

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G+   LS+E+ + +A+     +   A +    RT +  +      L  +   GT + + 
Sbjct: 201 TGE---LSDELRIALAQARTGTSLVDALDAMARRTNIQSLIQFVDGLAIALSRGTPLSEV 257

Query: 272 LRVLVSETRSE---RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           LR   ++ R E   +LME   K       + VP+++F LP+ +L  + P++
Sbjct: 258 LRAQAADVREEGRRKLMELSGKKEV---GMLVPVVLFVLPITVLFAVYPSL 305


>gi|168069635|ref|XP_001786522.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162661100|gb|EDQ48667.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 200

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 152 AVILIGYVGFCAPSVWISNL---VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
            +I+ G + F  P+  I +L   V KR   I     + L+ +++ V +G ++ +A+ R A
Sbjct: 24  GLIIGGLLAFLLPAATIKDLHTKVDKRDQDITIELAELLNKIVLLVGAGETVQKAITRCA 83

Query: 209 EDIGGQ-SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA-LIQSDRYGT 266
                Q   PL +E++  I +L    + Q +FENF  R  +  V   T A L+   R G+
Sbjct: 84  RQKEAQRDHPLYKELIRMIDDLEGGYSFQQSFENFSKRCAVQEVSAFTTAVLLNLRRGGS 143

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               +L  L      +R      +      KL  PM++ F+ V++LV
Sbjct: 144 DFAMALNDLSRGLWEKRKAITRTRGEQASSKLVFPMMVIFMIVIVLV 190


>gi|292655192|ref|YP_003535089.1| type IV pilus biogenesis complex membrane subunit [Haloferax
           volcanii DS2]
 gi|291371902|gb|ADE04129.1| type IV pilus biogenesis complex membrane subunit [Haloferax
           volcanii DS2]
          Length = 707

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 97/214 (45%), Gaps = 23/214 (10%)

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           + + +R  +P    ILG+      D + E+  +  +G+++++              L ++
Sbjct: 437 VWVALRATIPADPTILGVA-----DAVDEHVVEAAIGSLVVVSA---------FHELRKR 482

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRV-AEDIGGQSVPLSEEMLLTIAELSFLP 233
           R  +I+R+ PD LD L    E+G+++ Q+LRRV A D+G    PL +E+   + ++ +  
Sbjct: 483 RIRAIERSMPDFLDRLASVNEAGLTVVQSLRRVSASDLG----PLGDEVERAVRDIDWGA 538

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           + Q A      RT    V  +   +  +      +   LR+  +E +  R +  E+    
Sbjct: 539 DAQTALRRMDRRTASPMVSRSVTLITNAMSASGDLAPVLRIAANEAQDSRRLARERNQ-- 596

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
               LT  ++I+   ++ L II    +S I  ++
Sbjct: 597 --EMLTYLLVIYISFLVFLGIIAALTVSFIPAVE 628


>gi|218516697|ref|ZP_03513537.1| pilus component protein [Rhizobium etli 8C-3]
          Length = 108

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 14 LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR-- 71
          + +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++   +  D  + +  
Sbjct: 14 MLIAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARERARMNADPGAGKAS 73

Query: 72 LRTRDSKS 79
          LR+++++S
Sbjct: 74 LRSQNNRS 81


>gi|255327037|ref|ZP_05368113.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
 gi|255296254|gb|EET75595.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
          Length = 310

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 73/168 (43%), Gaps = 5/168 (2%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V++ G  GF A   W+   V KR+  +   +P   +++ + V +G S   AL R+     
Sbjct: 140 VLVSGLSGFLARDWWLGEAVTKREKQLVAEFPALAEMMALSVTAGESALAALERICLTSR 199

Query: 213 GQ-SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G+ +   SE +  T   +S L     A + F  RT++  +    + +  +   GT + D 
Sbjct: 200 GELAREFSEILAQTRTGVSLLS----ALQEFAERTRVPALSRFVEGIAVAIERGTPLADV 255

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           LR    + R     E  + A      +  P++ F LP+ ++  + P +
Sbjct: 256 LRAQAQDVRDNAKRELMETAGKKEIAMLAPVVFFILPLTVIFAVFPGL 303


>gi|282863647|ref|ZP_06272705.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282561348|gb|EFB66892.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 272

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P   DLL  C+ +G     A   V E +GG   P+ + ++ T AE+        A+  F 
Sbjct: 132 PLVADLLAACLSAGAGPRDAAEAVGESLGG---PVGDRLVRTAAEIRLGGEPSEAWGRF- 187

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
              ++       + L ++   G    D +  +  E R+ER   A  +A   G  +T P+ 
Sbjct: 188 --GEIPGAARLARCLERAGATGAPAADPVSRVADEMRAERASAAVARAQRAGVLITAPVG 245

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           + FLP  + V + P ++ +   +
Sbjct: 246 LCFLPAFLAVGVAPVVIGLATGL 268


>gi|94497257|ref|ZP_01303829.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
 gi|94423362|gb|EAT08391.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
          Length = 332

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 116/270 (42%), Gaps = 24/270 (8%)

Query: 53  EILRKQQITSL---QKDSASSRLRTRDSKSLRNFVKKLNLKAILV----DENIVNKLRAA 105
           E  RK+++ ++     +SA + L  R  +++ N       K ++      +N+  +++  
Sbjct: 29  EKARKRRVATIRGRHGESAEALLEARMRRAISNRPTGAEAKMLVSLVPNPDNLTKRIKMT 88

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPS 165
           G   +++L+  +    +  I  LI  ++ + G+     + F + VGA       G   P 
Sbjct: 89  G--KKWTLSQYMTACAI--IFLLITALLALRGFP----FFFAMLVGAA-----AGLGLPH 135

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
            W+  L+ KR S     +PDAL+LL   + SG+ I + L  V+ +I G   P+ EE  L 
Sbjct: 136 WWVGRLITKRVSQFNAKFPDALELLTRGLRSGLPIAETLGVVSNEIPG---PVGEEFKLI 192

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
              +      + A +   +R      +     L      G ++ ++L  L +  R    M
Sbjct: 193 TERIKIGRTMEQALQETADRLGTAEFQFFVITLSIQRETGGNLAETLSNLATVLRQRSQM 252

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           + + +A S   K +   II  LP L+  +I
Sbjct: 253 KLKIRAMSSESKASA-YIIGVLPFLVFGMI 281


>gi|194366101|ref|YP_002028711.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348905|gb|ACF52028.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 311

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 89/186 (47%), Gaps = 22/186 (11%)

Query: 153 VILIGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           +++IG +  G   P   +S+ V++R+ ++ +  P  +DLL +    G S+DQ+L+ + + 
Sbjct: 130 MVVIGALAAGLLLPKFVLSSWVKRRRRAVDKELPLLIDLLRLLQGVGFSMDQSLQTLGDK 189

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM----------DCVRNATQALIQ 260
           +      L  E          L    VA+ +   R Q           D + +  Q ++Q
Sbjct: 190 LRDALPVLGGE----------LQEANVAYTHGRTRAQSLRRLSEVYADDDLSSLMQLILQ 239

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
              +G ++ + LR      R +R    ++K   L  K+TV M++  LP L+LV+ GPA++
Sbjct: 240 VHAHGGAVQEPLRQFSIRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPALV 299

Query: 321 SIIDTM 326
           ++  TM
Sbjct: 300 ALATTM 305


>gi|253576286|ref|ZP_04853617.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844413|gb|EES72430.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 291

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 8/147 (5%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALR----RVAEDIGGQSVPLSEEMLLTIA 227
           VQ+R+ ++    P+ L+ +++ V +G ++ QA++    R  E IG    PL  E+L    
Sbjct: 138 VQRREQAVLLELPELLNKIVLLVGAGSTVQQAMKLCLERKREQIGH---PLYRELLQMQK 194

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQA-LIQSDRYGTSIGDSLRVLVSETRSERLME 286
           E     + Q A E F  R  +  V   T A L+   R G     +LR L      +R   
Sbjct: 195 EWEGGDSFQQAMEGFSKRCGIQEVSAFTTAVLLNYRRGGEDFALALRDLSHSLWEKRKAV 254

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILV 313
                     KL  PM++ F+ VLILV
Sbjct: 255 GRTLGEQASSKLVFPMVLLFMAVLILV 281


>gi|330976793|gb|EGH76829.1| type II secretion system protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 294

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 106/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+    + K ++ P
Sbjct: 56  RIGQRSISLDSETQILLNRIGWRRASKRSLFAACQVGVPVGLMVIVILGQLLFFKGIQQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  +  +G  G+  P   ++ + ++RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPIFALG-AGYLLPKRILATVARRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            V  + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 -VLSNEGKDLLPVLSEEIRVVLMRVDSGLELGEELRKTAALLDVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 288


>gi|238755456|ref|ZP_04616796.1| hypothetical protein yruck0001_3330 [Yersinia ruckeri ATCC 29473]
 gi|238706297|gb|EEP98674.1| hypothetical protein yruck0001_3330 [Yersinia ruckeri ATCC 29473]
          Length = 268

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 76/147 (51%), Gaps = 9/147 (6%)

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE--EMLLTIAELSFLPN--RQ 236
            A P  +D++  C+++G++I+ AL   A++    +  LS     ++  +E+  L    ++
Sbjct: 122 EAIPLFIDMVAACIQAGMTIESALTHTAKNFESINRDLSMLFNKIMKKSEIIGLEKSIKE 181

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
           V+        +M C       L  S  +G+++ + L  L +E +  +L+ AE+  + L  
Sbjct: 182 VSIVAPSTEIKMFC-----STLQYSLSFGSTVYEQLNTLSAEIKKMQLLIAEEILSKLST 236

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSII 323
           KLT+P+ +F +   I++I+ P+IL  I
Sbjct: 237 KLTLPLFLFMVIPFIVLILSPSILGFI 263


>gi|110626527|gb|ABG79011.1| TadC [Yersinia ruckeri]
          Length = 277

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 76/147 (51%), Gaps = 9/147 (6%)

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE--EMLLTIAELSFLPN--RQ 236
            A P  +D++  C+++G++I+ AL   A++    +  LS     ++  +E+  L    ++
Sbjct: 131 EAIPLFIDMVAACIQAGMTIESALTHTAKNFESINRDLSMLFNKIMKKSEIIGLEKSIKE 190

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
           V+        +M C       L  S  +G+++ + L  L +E +  +L+ AE+  + L  
Sbjct: 191 VSIVAPSTEIKMFC-----STLQYSLSFGSTVYEQLNTLSAEIKKMQLLIAEEILSKLST 245

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSII 323
           KLT+P+ +F +   I++I+ P+IL  I
Sbjct: 246 KLTLPLFLFMVIPFIVLILSPSILGFI 272


>gi|315497461|ref|YP_004086265.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415473|gb|ADU12114.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 63/134 (47%), Gaps = 3/134 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G+ AP  W+S L ++R +     + DA+D+L+  ++SG+ +   L+ +A+++     PL 
Sbjct: 132 GYGAPRWWLSFLAKRRTTKFTANFADAIDILVRGIKSGLPVHDGLKIIAKEL---PAPLG 188

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E       +S      ++ E    R     +R  T  +    + G ++ ++L  L    
Sbjct: 189 PEFQRLNENISIGMGLDMSLEKMCERMPTPELRFFTIVIAIQQKTGGNLAEALGNLSHVL 248

Query: 280 RSERLMEAEKKAAS 293
           RS R+M  + KA S
Sbjct: 249 RSRRMMREKIKALS 262


>gi|302185193|ref|ZP_07261866.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           642]
          Length = 294

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 105/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  + + I+    + K ++ P
Sbjct: 56  RIGQRSITLDSETQMLLNRIGWRRASKRSLFAACQVGVPVGLMAMVILGQLLFFKGIQQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  +  +G  G+  P   ++ + ++RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPIFALG-AGYLLPKRILAAVARRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            V  + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 -VLSNEGKDLLPVLSEEIRVVLMRVDSGLELGEELRKTAALLDVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 288


>gi|163857687|ref|YP_001631985.1| putative Flp pilus assembly protein [Bordetella petrii DSM 12804]
 gi|163261415|emb|CAP43717.1| putative Flp pilus assembly protein [Bordetella petrii]
          Length = 332

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 1/172 (0%)

Query: 153 VILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            + IG+ VG+  P   +   V+ R+    +  P  +DLL +    G+S+DQ+L  +  D 
Sbjct: 151 TLFIGFAVGYLLPKWMLVRRVKARKKQAGKELPLLVDLLRLLQGVGLSVDQSLSVIVNDF 210

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 L  E  ++ A  +    R+ +          D +    + L+Q DR+G ++ + 
Sbjct: 211 TPVLPVLGHEFGVSTAVYARGRTREQSLARLSQGFDDDDLAAICRLLVQVDRHGGAVQEP 270

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           L       R +R  E ++K   L  K+T  MI+  LP L++V  G  ILS++
Sbjct: 271 LNRFAQRIRDKRRFELKEKIGRLTVKMTGVMIVTLLPALLIVTGGMGILSVL 322


>gi|66047622|ref|YP_237463.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258329|gb|AAY39425.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 294

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 106/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+    + K ++ P
Sbjct: 56  RIGQRSISLDSETQILLNRIGWRRASKRSLFAACQVGVPVGLMVIVILGQLLFFKGIQQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  +  +G  G+  P   ++ + ++RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPIFALG-AGYLLPKRILAAVARRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            V  + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 -VLSNEGKDLLPVLSEEIRVVLMRVDSGLELGEELRKTAALLDVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 288


>gi|254521552|ref|ZP_05133607.1| type II secretion system protein [Stenotrophomonas sp. SKA14]
 gi|219719143|gb|EED37668.1| type II secretion system protein [Stenotrophomonas sp. SKA14]
          Length = 311

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 86/176 (48%), Gaps = 2/176 (1%)

Query: 153 VILIGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           +++IG +  G   P   +S  V++R+ +++   P  +DLL +    G S+DQ+L+ + + 
Sbjct: 130 MVVIGALAAGLLLPKFALSAWVKRRRRAVENELPLLIDLLRLLQGVGFSMDQSLQTLGDK 189

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +      L  E+       +    R  +     +    D + +  Q ++Q   +G ++ +
Sbjct: 190 LRDALPILGGELQEANVAYTHGRTRAQSLRRLSDVYGDDDLSSLVQLILQVHAHGGAVQE 249

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            LR      R +R    ++K   L  K+TV M++  LP L+LV+ GPA++++  TM
Sbjct: 250 PLRQFSIRLREQRRNSLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPALVALAATM 305


>gi|283457757|ref|YP_003362345.1| Flp pilus assembly protein TadC [Rothia mucilaginosa DY-18]
 gi|283133760|dbj|BAI64525.1| Flp pilus assembly protein TadC [Rothia mucilaginosa DY-18]
          Length = 310

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 70/164 (42%), Gaps = 5/164 (3%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ-S 215
           G  GF A   W+   V KR+  +   +P   +++ + V +G S   AL R+     G+ +
Sbjct: 144 GLSGFLARDWWLGEAVTKREKQLVAEFPALAEMMALSVTAGESALAALERICLTSRGELA 203

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
              SE +  T   +S L     A + F  RT++  +    + +  +   GT + D LR  
Sbjct: 204 REFSEILAQTRTGVSLLS----ALQEFAERTRVPALSRFVEGIAVAIERGTPLADVLRAQ 259

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
             + R     E  + A      +  P++ F LP+ ++  + P +
Sbjct: 260 AQDVRDNAKRELMETAGKKEIAMLAPVVFFILPLTVIFAVFPGL 303


>gi|70734195|ref|YP_257835.1| type II secretion system protein F subunit [Pseudomonas fluorescens
           Pf-5]
 gi|68348494|gb|AAY96100.1| type II secretion system protein F domain [Pseudomonas fluorescens
           Pf-5]
          Length = 294

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 124/268 (46%), Gaps = 38/268 (14%)

Query: 74  TRDSKSLRNFVK-----KLNLKAILVD---ENIVNKL--RAAGFRSEYSLNILLVVRLVV 123
           TRDS+ L N+++     +   +A+ +D   + ++N+L  R A  RS ++ + +    L V
Sbjct: 40  TRDSR-LGNWLRLLGDSRFGQRAVSMDSETQTLLNRLGWRRARERSLFAASQIATPVLAV 98

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            ++  I  + +     K L  P  L +GA       G+  P   ++   ++RQ  I    
Sbjct: 99  CLVIFIQEVAFAQAQSKWL-VPM-LALGA-------GYLLPKRALAYAAKRRQKHIALEI 149

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA------ELSFLPNRQ- 236
              + LL I  ESG++++QALR ++ +       L++E+ L +A      EL    N+  
Sbjct: 150 STFIPLLRILFESGMAVEQALRVLSSEAQKLLPELTQELRLILARVDSGLELGHELNQTA 209

Query: 237 --VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
             +A + F +     CV    Q LI           +L+ L+ + R  RL E   K   +
Sbjct: 210 TLLAVDEFTD----TCV--ILQQLILQGGGAMKSLQALKQLLDDRRLTRLQEYISK---M 260

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSI 322
             K++V M++F  P L++V+ GP   +I
Sbjct: 261 SAKMSVVMMLFLFPALLIVLAGPGFTAI 288


>gi|303241710|ref|ZP_07328207.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590711|gb|EFL60462.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 327

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 96/206 (46%), Gaps = 7/206 (3%)

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK---LLEYPFQLRVGAVILIGYVGFC 162
           G++ +  L +     L+ P  ++ + II  F +     +L     L +   I+ G +G+ 
Sbjct: 76  GYKKKIQLELQRAHILLKPEEYITVSIILFFAFGTFMFVLASSSSLAILVAIVGGVIGWV 135

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            PS++I   ++KR   +     DA+ L+   +++G S  QA+  V++++ G   P++EE 
Sbjct: 136 LPSLYIKIKIKKRLRILNDQLNDAIVLISNSLKAGYSFFQAVDIVSKEMTG---PMAEEF 192

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
                E++F    + A EN   R   D +     A++   + G ++ + L  + +  R  
Sbjct: 193 AQLQKEVNFGTTTEKALENLVTRVTSDDLELVVTAVLIQRQVGGNLSEVLDNISTTIRER 252

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLP 308
             ++ E K  +   +++  MII  LP
Sbjct: 253 IRIKGEVKTVTAQGRMS-GMIIAALP 277


>gi|190574783|ref|YP_001972628.1| putative transmembrane type II secretion protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012705|emb|CAQ46333.1| putative transmembrane type II secretion protein [Stenotrophomonas
           maltophilia K279a]
          Length = 311

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 88/186 (47%), Gaps = 22/186 (11%)

Query: 153 VILIGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           +++IG +  G   P   +S+ V++R+ ++    P  +DLL +    G S+DQ+L+ + + 
Sbjct: 130 MVVIGALAAGLLLPKFILSSWVKRRRRAVDNELPLLIDLLRLLQGVGFSMDQSLQTLGDK 189

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM----------DCVRNATQALIQ 260
           +      L  E          L    VA+ +   R Q           D + +  Q ++Q
Sbjct: 190 LRDALPVLGGE----------LQEANVAYTHGRTRAQSLRRLSEVYADDDLTSLMQLILQ 239

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
              +G ++ + LR      R +R    ++K   L  K+TV M++  LP L+LV+ GPA++
Sbjct: 240 VHAHGGAVQEPLRQFSIRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPALV 299

Query: 321 SIIDTM 326
           ++  TM
Sbjct: 300 ALATTM 305


>gi|325963896|ref|YP_004241802.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469983|gb|ADX73668.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 313

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 11/176 (6%)

Query: 152 AVILIGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           AV ++G    GF     W+   V++R++ +   +P   +L+ + V +G S   AL RV  
Sbjct: 140 AVAVMGSAVGGFILRDYWLGAQVKRRETRMMAEFPSLAELMALAVSAGESATGALDRVCR 199

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              G+   LS E    +AE         A + F  RT +  +      ++ +   GT + 
Sbjct: 200 SAKGE---LSREFSNILAETRAGKPLVQALQEFSARTDLAPLVRFVDGIVVAVERGTPLA 256

Query: 270 DSLRVL---VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           D LR     V +T    LMEA  K       + VP++   LP+ ++  + P + +I
Sbjct: 257 DVLRAQAQDVRDTAKRDLMEAAGKKEI---AMMVPLVFGVLPLTVVFAVFPGLAAI 309


>gi|117928944|ref|YP_873495.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
 gi|117649407|gb|ABK53509.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
          Length = 311

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           ++    G  A  V +S   Q+R   +   +P   +LL + V +G S   AL RV     G
Sbjct: 142 VIAACCGAIARDVTLSREAQRRSRRMLAEFPTVAELLALAVGAGESPAAALERVVRVCRG 201

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           +   LS E    ++E     +   A EN   R  +D +      +I + + GT + D LR
Sbjct: 202 E---LSVEFARALSEARTGGSLVTALENLAARNPLDIMSRFVDGMIVAMQRGTPLADVLR 258

Query: 274 VLVSETRSERLMEAEKKAA-SLGPK----LTVPMIIFFLPVLILVIIGPAILSI 322
              S+ R     EA K++   +G +    + VP++   LP+ +L  + P+ +S+
Sbjct: 259 AQASDVR-----EAAKRSLLDIGGRKEIGMMVPVVFLILPITLLFALFPSFVSL 307


>gi|238793626|ref|ZP_04637249.1| Type II secretion system protein [Yersinia intermedia ATCC 29909]
 gi|238727041|gb|EEQ18572.1| Type II secretion system protein [Yersinia intermedia ATCC 29909]
          Length = 194

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 76/158 (48%), Gaps = 15/158 (9%)

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           L +G  +LI  +    P   I N++ K+   +  + P  +D+   CV+SG++ID AL   
Sbjct: 33  LMIGLFMLITTIYL--PKFIIRNILNKKIKCLLNSLPFFIDITAACVQSGMTIDSALSYT 90

Query: 208 AEDIGGQSVPLSEEMLLTI------AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
           A+      + ++ ++ L +      AE++ L +    F+     T+   ++    AL  S
Sbjct: 91  AKKF----ILINPDLSLIVTKITKRAEINGLESAIKEFQQLSTETE---IKMFCSALQYS 143

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
             +G+++ D L  L  + R  +L+  E+K + L  KLT
Sbjct: 144 ISFGSTVYDQLIKLAQDMREMQLLVTEEKNSKLSTKLT 181


>gi|296129086|ref|YP_003636336.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
 gi|296020901|gb|ADG74137.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
          Length = 309

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 71/160 (44%), Gaps = 9/160 (5%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P  ++   V +R++ +    P   +LL + V +G     AL RV     G+   L++E+ 
Sbjct: 150 PDWYLGRQVARREARLLAEMPTVTELLALAVSAGEGATGALERVVRQTRGE---LADELA 206

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE- 282
            T+AE         A +   +RT +  +    + +  +   G+ + D LR    + R E 
Sbjct: 207 RTLAEARAGAPLTTALQTLADRTGLPALARFAEGVAVAVERGSPLADVLRAQAQDVREEG 266

Query: 283 --RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
              LM+   +   L   + VP++   LPV +L  + P+++
Sbjct: 267 RRALMQTGGRKEVL---MMVPVVFLILPVTVLFAVFPSVV 303


>gi|307328261|ref|ZP_07607439.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306886095|gb|EFN17103.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 272

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 14/143 (9%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P A DLL  C+ +G    +A   V   +GG   P+ E +  T AEL      ++  E  +
Sbjct: 131 PLAADLLTACLAAGAGPRKAAEAVGGSLGG---PVGERLAQTAAEL------RLGAEPAH 181

Query: 244 NRTQMDCVRNATQALIQS-DRYGTSIGDSLRV---LVSETRSERLMEAEKKAASLGPKLT 299
              ++  +  A Q L ++ +R GT+   ++     L +E R+E+   A K+A   G  + 
Sbjct: 182 AWGRIGALPGA-QGLARALERAGTTGAPAVEPVSRLAAECRAEQGRAAMKRADRTGVLVN 240

Query: 300 VPMIIFFLPVLILVIIGPAILSI 322
            P+   FLP  +LV + P ++ +
Sbjct: 241 APLAGCFLPAFLLVGLAPVMIGL 263


>gi|297193033|ref|ZP_06910431.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197719837|gb|EDY63745.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 262

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P A DL+  C+ +G S  +A   V E +GG   P+   +  T A+L        A+  F 
Sbjct: 122 PLAADLMAACISAGASPREAAEAVGESLGG---PVGAGLARTAAQLRLGAEPSPAWGCF- 177

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
              ++       + L ++D  G    D +  L    R+ER      +       +T P+ 
Sbjct: 178 --GEIPGAEPLARCLERADSAGAPAADPVSRLAGRLRAERARAVAGRGRRAQVLITAPVG 235

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           + FLP  + V + P ++ +   +
Sbjct: 236 LCFLPAFLAVGVAPVVIGLAGGL 258


>gi|294012436|ref|YP_003545896.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675766|dbj|BAI97284.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 332

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 102/251 (40%), Gaps = 31/251 (12%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVD-----ENIVNKLRAAGFRSE 110
           R + I     DS  + L  R  K++ N     N  ++LV      EN+  ++R  G +  
Sbjct: 35  RMELIRGRHSDSTDAILEARMRKAISNRPAG-NEASMLVSLVPNPENLAKRIRMTGKKWT 93

Query: 111 YSLNILLVVRLVVPIIFLIL-GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
            S  +         +IFL L  ++ + G+  L          AV+L    G   P +W+S
Sbjct: 94  VSQYMT-----ACAVIFLALCALLMLRGFPPLF---------AVMLGLAAGLGLPHMWVS 139

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
            L++ R       +PDAL+LL   + SG+ I + L  V+ ++ G   P+ EE  L    +
Sbjct: 140 RLIKGRVLKFNAKFPDALELLTRGLRSGLPIAETLNVVSNEVPG---PVGEEFKLITERI 196

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE------- 282
                   A +   +R      +    +L      G ++ ++L  L +  R         
Sbjct: 197 KIGKTMDQALQETADRLGTPEFQFFVISLAIQRETGGNLAETLSNLATVLRQRAQMKLKI 256

Query: 283 RLMEAEKKAAS 293
           R M +E KA++
Sbjct: 257 RAMSSESKASA 267


>gi|325264274|ref|ZP_08131005.1| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. D5]
 gi|324030345|gb|EGB91629.1| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. D5]
          Length = 410

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 93/215 (43%), Gaps = 25/215 (11%)

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWI------SNLVQK 174
           LV+P       I+W        +YP + R   + ++G V   A +V+         ++  
Sbjct: 206 LVLPDSLDGSKIVW--------KYPAESRAAGLFVLGIV--AAGAVFFLDRQKHKQVLAD 255

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAE------DIGGQSVPLSEEMLLTIAE 228
           R+  +   +P  +    + + +G+S+ +A  ++AE      D  G  +   EEM  T+ E
Sbjct: 256 RKKQLAADYPQLISQFTLFLGAGMSVRRAWFKMAEEYEKRRDRKGPRIAY-EEMSYTMHE 314

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEA 287
           +    +    +E F +R  +   R     L Q+ R G   + + LR   ++   +R  +A
Sbjct: 315 IQGGVSEGECYERFGSRCGLPAYRRFGALLSQNLRKGGRGLNELLRKEAADAFEDRKKQA 374

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            K     G KL  PM +    VLI++++ PA  SI
Sbjct: 375 RKLGEEAGTKLLGPMFLMLAVVLIIIVV-PAFFSI 408


>gi|91775991|ref|YP_545747.1| type II secretion system protein [Methylobacillus flagellatus KT]
 gi|91709978|gb|ABE49906.1| type II secretion system protein [Methylobacillus flagellatus KT]
          Length = 300

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 74/165 (44%), Gaps = 3/165 (1%)

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           YVG      W   L  +R+  I +     L +L++  +SG+S++ +LR + E        
Sbjct: 131 YVGIRYLLRW---LAARRRKMISKEITTFLYMLVMLFDSGLSLEHSLRIMVEQASDIMPH 187

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           L++E+   +A +    ++  A  +      +  +  A   L Q  + G ++ DS+    +
Sbjct: 188 LAQELERVLARIRAGQDQGKALMSMSQMLDIPELSEAVAMLKQVAQQGGNVRDSIMRYAA 247

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
                +     ++ + L  K+T+ M+IF  P L++ I GP  + +
Sbjct: 248 LIEERQFSHLRERVSKLSAKMTIVMMIFMFPALMIFIAGPGFIGL 292


>gi|291303312|ref|YP_003514590.1| type II secretion system protein [Stackebrandtia nassauensis DSM
           44728]
 gi|290572532|gb|ADD45497.1| type II secretion system protein [Stackebrandtia nassauensis DSM
           44728]
          Length = 220

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 6/141 (4%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P ALD+   C+ SG  +D+AL   AE +             ++   + L      F++  
Sbjct: 80  PFALDVFAACLHSGAPLDRALSTCAEAVNPALANRFRRAARSLTLGATLAEALTEFDSLA 139

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           +  ++       Q + +S   G  + DSL +L  E R +R   A   A   G  + +P+ 
Sbjct: 140 DGHRL------VQTIGRSADTGARLADSLHLLAKELRFDREQAALSHAHRAGVWMVLPLC 193

Query: 304 IFFLPVLILVIIGPAILSIID 324
           + FLP  I   + P ++S +D
Sbjct: 194 LCFLPAFIAAGLLPVVISSLD 214


>gi|240139030|ref|YP_002963505.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
 gi|240009002|gb|ACS40228.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
          Length = 323

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 135/314 (42%), Gaps = 38/314 (12%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           LAV +  AV+  SL Y  ++P+L SGE     +     R+ L + Q    ++ +A+SR R
Sbjct: 8   LAVGLV-AVAAGSLAYVFLMPAL-SGERRAEQR-----RKALGQPQAVLAERGAAASR-R 59

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGF---RSEYSLNILLVVRLVVPIIFLIL 130
            + +KSL+    K +   + ++     +L  AG    R +Y        R+V  I  ++L
Sbjct: 60  EQVAKSLKELEAKKDKTKVTLEL----RLARAGLDWSRQKY--------RVVSVITAVVL 107

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++       ++     L VG        GF  P+ W+    ++R  +     P+A+D++
Sbjct: 108 ALVAFLASHNVIVAGLALFVG--------GFGLPAWWLKRRQKRRVEAFIEELPNAMDVV 159

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +  + SGI +   LR +A +      PL  E  +T+   +   +   A    Y R  +  
Sbjct: 160 VRGLRSGIPLGDCLRMIARE---AKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTE 216

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V   +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP  
Sbjct: 217 VNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALP-- 273

Query: 311 ILVIIGPAILSIID 324
             V+ G   LS  D
Sbjct: 274 -FVVGGGTYLSSPD 286


>gi|289625308|ref|ZP_06458262.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647833|ref|ZP_06479176.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330867142|gb|EGH01851.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330871030|gb|EGH05739.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
          Length = 294

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 106/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+      K +  P
Sbjct: 56  RIGQRSISLDSETQMLLNRIGWRRASKRSLFAACQVGVPVGLMVVVIVAQLLLFKGVGQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  V  +G +G+  P   ++ + Q+RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPVFALG-IGYLLPKRILAAVAQRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSLE-GKDLLPVLSEEIRVVLVRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFIAI 288


>gi|254561625|ref|YP_003068720.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
 gi|254268903|emb|CAX24864.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
          Length = 323

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 138/316 (43%), Gaps = 42/316 (13%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGE--LEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           LAV +  AV+  SL Y  ++P+L SGE   E+R K++   + +L        ++ +A+SR
Sbjct: 8   LAVGLV-AVAAGSLAYVFLMPAL-SGERRAEQRRKALGQPKAVL-------AERGAAASR 58

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGF---RSEYSLNILLVVRLVVPIIFL 128
            R + +KSL+    K +   + ++     +L  AG    R +Y        R+V  I  +
Sbjct: 59  -REQVAKSLKELEAKKDKTKVTLEL----RLARAGLDWSRQKY--------RVVSAITAV 105

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L +   F    ++     L VG        GF  P+ W+    ++R  +     P+A+D
Sbjct: 106 VLALAAFFVSHNVIVAGLALFVG--------GFGLPAWWLKRRQRRRVEAFIEELPNAMD 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  + SGI +   LR +A +      PL  E  +T+   +   +   A    Y R  +
Sbjct: 158 VVVRGLRSGIPLGDCLRMIARE---AKEPLRSEFRVTMESQALGLSMSDAILRMYERVPV 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             V   +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP
Sbjct: 215 TEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALP 273

Query: 309 VLILVIIGPAILSIID 324
               V+ G   LS  D
Sbjct: 274 ---FVVGGGTYLSSPD 286


>gi|297159257|gb|ADI08969.1| hypothetical protein SBI_05849 [Streptomyces bingchenggensis BCW-1]
          Length = 268

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 6/134 (4%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P A DLL  C+E+G    +A   V   +GG   P+ E +    AEL        A+    
Sbjct: 128 PLAADLLTACLEAGAGPYKAAEAVGRSLGG---PIGERLAQAAAELRLGGEPSAAWGRM- 183

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
               +       +AL ++   G    +S+  L ++ R+E+  +A+K+        T P+ 
Sbjct: 184 --GALPGAHGLARALERAGTTGAPAVESMSRLAADCRAEQGRQADKRVERATVLATAPLG 241

Query: 304 IFFLPVLILVIIGP 317
             +LP  +L+ + P
Sbjct: 242 ACYLPAFLLIGVAP 255


>gi|229588191|ref|YP_002870310.1| hypothetical protein PFLU0643 [Pseudomonas fluorescens SBW25]
 gi|229360057|emb|CAY46911.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 298

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P   ++   + RQ +I +     + LL I  ESG++++Q+LR +  +       L
Sbjct: 128 IGYLLPKRVLAAAAKHRQQAIAKEISTFIPLLRILFESGMAVEQSLRVLGNEAQRLLPHL 187

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E+ L +A +              +  ++D   +    L Q  + G     SL  L   
Sbjct: 188 THELRLILARVDSGLELGEELGKTVHVLEVDEFTDTCIILQQLIQQGGGAMKSLLALKQL 247

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
               RL   ++  + +  K++V M++F  P L++V+ GPA + I
Sbjct: 248 LDDRRLTRLQEYISKMSAKMSVVMMVFLFPALLIVLGGPAFIGI 291


>gi|116694144|ref|YP_728355.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113528643|emb|CAJ94990.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 345

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 96/229 (41%), Gaps = 20/229 (8%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY--- 158
           L   G+    S  +  V+RL +P    +  ++W  G              A++  G+   
Sbjct: 120 LEQCGWYGPQSRMLFGVLRLGLPSALALAAMLWHVGAGAF----------AIVAWGFGTF 169

Query: 159 -VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            + + AP   +      R   +    P  +D+L +    G+SIDQ+L+ +  + G     
Sbjct: 170 ALAYLAPKWHLRRRAAARLRMVDDELPVLIDMLRLLQGVGLSIDQSLQVIVAEFGSMLRV 229

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR---V 274
           L  E+     + +   +R+            + +++    L Q D++G ++ + LR   +
Sbjct: 230 LGPELARANQQFASGRSREQTLLRIGRLFDSEDLKSLITLLTQVDKHGGAVQEPLRQFGL 289

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            + E R  RL   + +   L  K+T  M++  LPVL+++  GP  L +I
Sbjct: 290 RMQEARKSRL---KDEIGRLTVKMTAVMVVSLLPVLLILTAGPGFLGVI 335


>gi|331086801|ref|ZP_08335878.1| hypothetical protein HMPREF0987_02181 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330409967|gb|EGG89402.1| hypothetical protein HMPREF0987_02181 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 431

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 7/146 (4%)

Query: 183 WPDALDLLLICVESGISIDQALRRVAED-----IGGQSVPLSEEMLLTIAELSFLPNRQV 237
           +P+ L+  ++ + +G+++  A ++++ D     I G+     EEM  T+ E+    + + 
Sbjct: 285 YPEILNKFVLFLGAGMTVKAAWQKISSDYEKGKIMGKERFAYEEMAYTLREMQAGGSEKE 344

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            +E+F  R +  C       L Q+ + G+  + D LR+       ER   A+K    +G 
Sbjct: 345 CYEHFGKRCEAVCYMRFGALLSQNLKRGSKGLADLLRLEAVNAFEERKRAAKKAGEEVGT 404

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSI 322
           KL  PM  F L V+++++I PA LS+
Sbjct: 405 KLLAPMF-FMLTVVLVIVIVPAFLSM 429


>gi|308068034|ref|YP_003869639.1| hypothetical protein PPE_01259 [Paenibacillus polymyxa E681]
 gi|305857313|gb|ADM69101.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 290

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 68/151 (45%), Gaps = 3/151 (1%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS-VPLSEEMLLTIAELS 230
           VQKR   I    P+ L  +++ V +G ++ +AL    E  G  +  PL  E+  T+AE  
Sbjct: 137 VQKRDQQILMELPELLSKMMLLVGAGETVQRALLHCVERKGADTEHPLYRELRQTVAEWE 196

Query: 231 FLPNRQVAFENFYNRTQM-DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
              + Q AFE+   R  + +     T  L+   R G+    +LR L      +R   +  
Sbjct: 197 SGFSFQQAFEHLSKRCGIQEMTVFTTTVLLNMRRGGSDFVMALRELSQTLWGKRTSISRT 256

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           +      KL  PM +  L V++LV   PA++
Sbjct: 257 RGEQASSKLVFPMALILLTVIVLV-GAPALM 286


>gi|197302282|ref|ZP_03167341.1| hypothetical protein RUMLAC_01009 [Ruminococcus lactaris ATCC
           29176]
 gi|197298713|gb|EDY33254.1| hypothetical protein RUMLAC_01009 [Ruminococcus lactaris ATCC
           29176]
          Length = 410

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 66/150 (44%), Gaps = 7/150 (4%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS-----EEMLLTIAELSFLP 233
           ++R +P  ++   + + +G+S+  A +R+ ED              EEM+ T  ++    
Sbjct: 260 MRRDYPQIINRFSLYIGAGMSVRNAWQRITEDYRKNKERTGRRKAYEEMIYTENQMKNKA 319

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAEKKAA 292
                +E +  R  +   R     L Q+ R G+  + + L+    E   ER  +A K   
Sbjct: 320 AESECYEEYGIRCGLSVYRRFGTLLSQNLRKGSKGLSELLKRETGEMFEERKKQARKLGE 379

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             G KL +P+ +    V I+VI+ PA  +I
Sbjct: 380 EAGTKLMIPLFMMLAVVFIIVIV-PAFFTI 408


>gi|293189314|ref|ZP_06608037.1| type II secretion system protein [Actinomyces odontolyticus F0309]
 gi|292821777|gb|EFF80713.1| type II secretion system protein [Actinomyces odontolyticus F0309]
          Length = 298

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 74/172 (43%), Gaps = 4/172 (2%)

Query: 152 AVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A  L+G + G      +++     RQ +I  + PD  +LL + V +G SI  A+ RVA  
Sbjct: 126 ACALVGTLLGVAGMDRFLTMRANARQRAIDASVPDCSELLALAVAAGESIPAAIERVAGC 185

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
            GG   PL  E+ LT   +        A  +   RT+   +   ++ L  +   G+ +  
Sbjct: 186 AGG---PLGAELSLTAGHIRNGTPSVRALADLVERTESPALTRLSRTLTTAIERGSPLAS 242

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            L     + R   L    ++       + +P++   LPV ++  + P ++++
Sbjct: 243 VLHDQARDQRERSLAALMEEGGRREIAMLLPVVFLILPVTVMFALYPGLIAL 294


>gi|330938347|gb|EGH41975.1| type II secretion system protein [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 204

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 2/164 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP-L 218
           G+  P   ++ + ++RQ  +       + LL I  ESG++++QALR ++ + G   +P L
Sbjct: 36  GYLLPKRILATVARRRQKQVVVEISTFIPLLRILFESGMAVEQALRVLSNE-GKDLLPVL 94

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           SEE+ + +  +                  +D + +    L Q    G     SL  L   
Sbjct: 95  SEEIRVVLMRVDSGLELGEELRKTAALLDVDELSDTCVILNQLIHQGGGALKSLLTLKQL 154

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
               RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 155 IDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 198


>gi|33596973|ref|NP_884616.1| hypothetical protein BPP2380 [Bordetella parapertussis 12822]
 gi|33566424|emb|CAE37677.1| putative membrane protein [Bordetella parapertussis]
          Length = 328

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 81/184 (44%)

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
           E P      AV L   +G+  P   +   + +R+   +   P  +DLL +    G+S+DQ
Sbjct: 138 EMPLAYVACAVFLGFGLGWMVPKWMLLRRIARRRECAEAELPLFIDLLRLLQGVGLSVDQ 197

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSD 262
           ++  + +D       L  E+ +   + +    R+ +          D +    + ++Q D
Sbjct: 198 SMHVLIQDFRSVMPVLGGELKIAAEQYARGRTREQSLSRLAQGFDNDDLSAICRLIVQVD 257

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+G ++ D L       R  R +E + + A L  K+T  M++  LP L+++  G   +++
Sbjct: 258 RHGGAVQDPLARFAERVRERRRLELKARVARLTVKMTGVMVVTLLPALLIITGGSGFVAL 317

Query: 323 IDTM 326
           +  M
Sbjct: 318 LRGM 321


>gi|33600815|ref|NP_888375.1| hypothetical protein BB1830 [Bordetella bronchiseptica RB50]
 gi|33568415|emb|CAE32327.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 328

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 81/184 (44%)

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
           E P      AV L   +G+  P   +   + +R+   +   P  +DLL +    G+S+DQ
Sbjct: 138 EMPLAYVACAVFLGFGLGWMVPKWMLLRRIARRRECAEAELPLFIDLLRLLQGVGLSVDQ 197

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSD 262
           ++  + +D       L  E+ +   + +    R+ +          D +    + ++Q D
Sbjct: 198 SMHVLIQDFRSVMPVLGGELKIAAEQYARGRTREQSLSRLAQGFDNDDLSAICRLIVQVD 257

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+G ++ D L       R  R +E + + A L  K+T  M++  LP L+++  G   +++
Sbjct: 258 RHGGAVQDPLARFAERVRERRRLELKARVARLTVKMTGVMVVTLLPALLIITGGSGFVAL 317

Query: 323 IDTM 326
           +  M
Sbjct: 318 LRGM 321


>gi|257064723|ref|YP_003144395.1| Flp pilus assembly protein TadC [Slackia heliotrinireducens DSM
           20476]
 gi|256792376|gb|ACV23046.1| Flp pilus assembly protein TadC [Slackia heliotrinireducens DSM
           20476]
          Length = 205

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 78/160 (48%), Gaps = 16/160 (10%)

Query: 173 QKRQ----SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE 228
           ++RQ    ++I+R  P+ +D + + +++G+S D A        G       +E+    A+
Sbjct: 53  KRRQREASAAIERHVPEMMDAVALGMKAGLSFDSAF-------GLYHARFDDELARACAQ 105

Query: 229 L-----SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
                 S L +R+ A  +   R     +R     + ++ ++G+SI   L  L +E ++  
Sbjct: 106 AHTEWESGLVSREQALTDMAERFDSAPLRRFASNVSRNLKFGSSIVRVLGALSAEAQAAY 165

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
               E+K A +  ++ +P  +  LP +++V++GP +L ++
Sbjct: 166 RTRMEEKVAKVPVRMLMPTAMLILPAMLIVVLGPVMLELL 205


>gi|158317568|ref|YP_001510076.1| type II secretion system protein [Frankia sp. EAN1pec]
 gi|158112973|gb|ABW15170.1| type II secretion system protein [Frankia sp. EAN1pec]
          Length = 338

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 85/197 (43%), Gaps = 13/197 (6%)

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L+L +  +FG       P  + +  V+     G  A   W++  +++R+  +   +P   
Sbjct: 146 LVLAMRTLFGVGP----PALVGIALVVAGAAGGILARDWWLTRAIREREDRMLMEFPTVA 201

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           +LL + V +G S   AL RV+    G+   L  E+ L +A+     +   A E    RT 
Sbjct: 202 ELLALAVTAGESAIGALERVSRLTHGE---LGTELRLALADAHAGASLVQALEGIATRTS 258

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLR---VLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           +  +      +  +   GT + D LR   V V E    +L+EA  +       + +P++ 
Sbjct: 259 LPPLARFVDGMAVAIERGTPLADVLRAQAVDVREAGKRQLLEAGGRKEI---AMMIPVVF 315

Query: 305 FFLPVLILVIIGPAILS 321
             LP  ++    PA++S
Sbjct: 316 LILPTTVIFAFYPALVS 332


>gi|269926133|ref|YP_003322756.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789793|gb|ACZ41934.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 336

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 139/308 (45%), Gaps = 21/308 (6%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +F   E    +T A+ IF LI+  +   +     ++R+  +     I R  + TS  +D+
Sbjct: 7   IFTQPENLAGVTVALGIF-LIFLGLTLYIKHRRWQERLHQL-----IGRHLEATSSSQDT 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           +   L     K+L ++  +  LK +++      +L  AG     + +  ++VRL   ++ 
Sbjct: 61  SPEIL---PQKALLSWRIREKLKDLIITPKFRRELLTAGL--GIAADKFILVRLAGALLC 115

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             L ++ I G      YP   R  A I     G+  P  +++   ++R S+++R  P A+
Sbjct: 116 SFLVMLLIPG-----NYPL-FRTIAAIFGLIAGYQLPRAYLALRRKRRLSALERQLPGAI 169

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+L   +E+G S+ QA+   A ++   S P+S+E++  + +     +++ A      R  
Sbjct: 170 DVLAGALEAGSSLAQAMMLAAREM---SNPISDELIKVVRDQELGLSQEEALRRMLERCP 226

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +     A+    R G S+   L+ + +  R    ++ E K  +   +++   I+  +
Sbjct: 227 SEDLDMMITAINIQYRVGGSLAHVLKSISTTIRERLRIKGEIKVLTAQGRISA-YIVTAI 285

Query: 308 PVLILVII 315
           P L+  +I
Sbjct: 286 PFLLTAVI 293


>gi|78357407|ref|YP_388856.1| hypothetical protein Dde_2364 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219812|gb|ABB39161.1| membrane protein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 321

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           F + +LL   F L        GY+    P  WI +   +R +   R  PDALDL+   ++
Sbjct: 107 FAFIRLLTDNFWLCAVTPFAAGYL----PFAWILSRRTRRMNRFHRQLPDALDLIARALK 162

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +G +  Q +R VA++      P+  E  +T+ E++F  +   A      R  +DC
Sbjct: 163 AGHAFPQGMRMVADEFAD---PVGPEFQITLDEINFGVSPDAALHAMTRR--VDC 212


>gi|253580448|ref|ZP_04857713.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848178|gb|EES76143.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 348

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 73/155 (47%), Gaps = 6/155 (3%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV----PLSEEMLLTIA 227
           +QKR   +   +P  +    + V++G+++ +A ++++ D G +      P  EE+ +   
Sbjct: 190 LQKRYEELLMDYPGLIMKFTLLVQAGMTVRKAFQKISLDYGRKRKRNPRPAYEEIRIVCY 249

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLME 286
           E+    +   A+  F  R      +     LIQ+ + G+  + D L    +E   ER  +
Sbjct: 250 EMESGVSESEAYRRFGERCGQAKYKTFATLLIQNLQKGSRQMADMLERESTEAWEERKRK 309

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           A     +   KL VPMI+  + V+ +V+I PA +S
Sbjct: 310 ARVLGEAAATKLLVPMIMMLIVVMAIVMI-PAFMS 343


>gi|154507636|ref|ZP_02043278.1| hypothetical protein ACTODO_00117 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797270|gb|EDN79690.1| hypothetical protein ACTODO_00117 [Actinomyces odontolyticus ATCC
           17982]
          Length = 298

 Score = 45.8 bits (107), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 74/172 (43%), Gaps = 4/172 (2%)

Query: 152 AVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A  L+G + G      +++     RQ +I  + PD  +LL + V +G SI  A+ RVA  
Sbjct: 126 ACALVGTLLGVAGMDRFLTMRANARQRAIDASVPDCSELLALAVAAGESIPAAIERVAGC 185

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
            GG   PL  E+ LT   +        A  +   RT+   +   ++ L  +   G+ +  
Sbjct: 186 AGG---PLGVELSLTAGHIRNGTPSVRALADLVERTESPALTRLSRTLTTAIERGSPLAS 242

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            L     + R   L    ++       + +P++   LPV ++  + P ++++
Sbjct: 243 VLHDQARDQRERSLAALMEEGGRREIAMLLPVVFLILPVTVMFALYPGLIAL 294


>gi|187478773|ref|YP_786797.1| pilus assembly protein [Bordetella avium 197N]
 gi|115423359|emb|CAJ49893.1| putative pilus assembly protein [Bordetella avium 197N]
          Length = 283

 Score = 45.8 bits (107), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 8/146 (5%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVP---LSEEMLLTIAELSFLPNRQVAFE 240
           P  LD++ +C+E+G  +  A+      +  +  P   L+  +   + E+    +++ A  
Sbjct: 143 PFLLDVMTLCLEAGQGMVNAMY-----LAARHCPPGLLTTALRQALNEMRAGRSQREALL 197

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               R  +  V     AL Q+DR G   G  LR L S+ R E    AE+ A     K+  
Sbjct: 198 AMAARLDVAGVHAWVAALTQADRLGGGAGGVLRALASQLREEAFQRAEEAAMRAPVKMLF 257

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           P++    P   L++  P ++ +   +
Sbjct: 258 PLVTCMFPCTFLILAFPLVVDLAPAL 283


>gi|92113785|ref|YP_573713.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
 gi|91796875|gb|ABE59014.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
          Length = 297

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 98/225 (43%), Gaps = 4/225 (1%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           LR AGF    +   LL V  ++ +   +LG++W +   + +     L +    L G V +
Sbjct: 71  LRQAGFIGSRAQARLLAVLGILAVSVTLLGMLWGWEQGRGVAGSLFLGLALGALTGVVAW 130

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
                W+ N  ++R   +       L +  +  E+G++++  L+ + +++   +     E
Sbjct: 131 A----WLKNRRRRRTRVLDEEIGLVLQVTRMLWEAGMTLESVLQGLIDNLANTAPETVRE 186

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           +     ++     R+ A E        + + +  + L Q    G    DSLR L    R 
Sbjct: 187 LRSVTHKIEAGQAREEALEEVAGIQASEGLGDLLKLLAQVSASGGGARDSLRTLADLLRD 246

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            R    ++    L  K+++ M++F  P L++V+ GPA+L++   +
Sbjct: 247 RRRTRLQEAVTRLSGKMSLVMMVFLFPALLIVLAGPAVLNLAGAL 291


>gi|221067369|ref|ZP_03543474.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712392|gb|EED67760.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 329

 Score = 45.4 bits (106), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 4/140 (2%)

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L+LGI  +F    L    F L +  V+L G V  C P +++     +R   ++R  P+AL
Sbjct: 103 LLLGIGILFFLGALAASMFHLPMELVLLAGAVLGCLPWLYLQRKRNQRLGLLERQIPEAL 162

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+   + +G +    L+   E++   S P++ E  L   E+++  + Q A  N   R  
Sbjct: 163 DLIARALRAGHAFSAGLQMAGEEL---SEPIAGEFRLVHDEINYGTSLQQALNNLGERIP 219

Query: 248 MDCVRNATQA-LIQSDRYGT 266
           +  +R    A LIQ +  G 
Sbjct: 220 ITDLRYFIVAVLIQRESGGN 239


>gi|257069182|ref|YP_003155437.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
 gi|256560000|gb|ACU85847.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
          Length = 314

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 124/279 (44%), Gaps = 32/279 (11%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN-------KLRAAGFR 108
           R + ++      ++SRLR      L N +  + ++ + V E +         +LR AG R
Sbjct: 46  RSRSMSLFAAPRSTSRLRM----VLENLLGPVAVRVLGVLERLTGGNDQLERRLRLAGRR 101

Query: 109 SEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYV--GFCA-PS 165
           S  S +   V ++V   I L+LG++       L      LR G+  L+G V  GF A   
Sbjct: 102 S--STDSFRVEQVVFGAIGLVLGVV-------LAVMAIALR-GSSPLLGLVIVGFGALTG 151

Query: 166 VWISNL-----VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           V + +      +++R + + R +P   DLL + V +G S   A+ RVA    G    L +
Sbjct: 152 VLLRDYLLGVEIKRRATRMAREFPTVADLLALAVAAGESPIAAMERVARTSHGA---LPD 208

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E   T+A++    +   A  +   RT +D +    + +  +   GT + + LR    + R
Sbjct: 209 EFAATVADIRAGTSVSQALASLGTRTPLDSLGRFGEGVSIAIERGTPLAEVLRAQAQDAR 268

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            E   E  + A      + VP++ F LP++I+  I P +
Sbjct: 269 EESKRELMETAGQREILMLVPVVFFVLPLVIVFAIFPGL 307


>gi|261856882|ref|YP_003264165.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837351|gb|ACX97118.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 284

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 7/165 (4%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P  + + L Q+R   I++  PD L ++   + +G+    AL  +A D      PL++E  
Sbjct: 94  PKKFYAWLKQRRIDKIQQQLPDGLMMVSGSMRAGLGFTAALESLARD---TDPPLAQEFA 150

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L + E       + A  +F +R  +  V     A+  S   G ++ +SL  L S  R   
Sbjct: 151 LVLREQRMGVKLEDALLHFNDRVPVQDVTLFVSAVNISREVGGNLAESLTSLASTLRRRL 210

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           +ME + K+ +   +L   +++  +PV +L  +    L+  DTM D
Sbjct: 211 IMEGKVKSLTAQGRLQ-GIVMALMPVGLLTFL---TLAYPDTMHD 251


>gi|238923484|ref|YP_002937000.1| hypothetical protein EUBREC_1104 [Eubacterium rectale ATCC 33656]
 gi|238875159|gb|ACR74866.1| Hypothetical protein EUBREC_1104 [Eubacterium rectale ATCC 33656]
          Length = 289

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 79/172 (45%), Gaps = 14/172 (8%)

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           V   I+  +V F       S+ ++KR   +   + + +  L +   +G+ +  A   VA 
Sbjct: 118 VAIFIMFAFVAFYYYGTSASDKIKKRSEELLSDFSNVVSKLALLTNAGLIMRDAWADVAY 177

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           +    +  L +EM +++ E+    +   A  +F NR  +  ++     +IQ    G S  
Sbjct: 178 N---GNTTLYKEMQISVDEMKNGVSETEAIYHFGNRCIIPEIKKFASTIIQGIEKGNS-- 232

Query: 270 DSLRVLVSETRSE------RLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             L  L+ E  +E      +L++ E + AS   KL +PM + F+ +LI+VI+
Sbjct: 233 -ELTALLQEQSAETWNLKRQLVKREGEKAS--SKLLIPMFLMFMGILIMVIV 281


>gi|332382440|gb|AEE67287.1| hypothetical protein BPTD_1970 [Bordetella pertussis CS]
          Length = 328

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 81/178 (45%), Gaps = 1/178 (0%)

Query: 150 VGAVILIGY-VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           V   + +G+ +G+  P   +   + +R+   +   P  +DLL +    G+S+DQ++  + 
Sbjct: 144 VACAVFLGFGLGWMVPKWMLLRRIARRRECAEAELPLFIDLLRLLQGVGLSVDQSMHVLI 203

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +D       L  E+ +   + +    R+ +          D +    + ++Q DR+G ++
Sbjct: 204 QDFRSVMPVLGGELKIAAEQYARGRTREQSLSRLAQGFDNDDLSAICRLIVQVDRHGGAV 263

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            D L       R  R +E + + A L  K+T  M++  LP L+++  G   ++++  M
Sbjct: 264 QDPLARFAERVRERRRLELKARVARLTVKMTGVMVVTLLPALLIITGGSGFVALLRGM 321


>gi|295690794|ref|YP_003594487.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432697|gb|ADG11869.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 325

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 100/223 (44%), Gaps = 25/223 (11%)

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI---IWIFGYDKLLEYPFQLRVGAV 153
           +I  +++AAG      L  ++ + L V +I ++L +   +WI              +GA 
Sbjct: 81  SIAARMQAAGLGPNVRLFWMVSLGLAVGVILIVLALGQTVWI-------------ALGA- 126

Query: 154 ILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
              G+  G   P   +S L Q R      A+ DA+D+++  ++SG+ +   LR + ++  
Sbjct: 127 ---GFAAGLGLPRWLLSILAQGRIRKFTEAFSDAIDIIVRGIKSGLPLHDCLRIIGQE-- 181

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
               PL+ E  +    ++       A +  + R   + +R     L    + G ++ ++L
Sbjct: 182 -SPEPLAGEFRMLTENVAMGVPLDAALDKMHERMPTNELRFFAIVLAIQQKTGGNLAEAL 240

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             L +  RS ++M+ + KA S    +   +II  LP  ++V+I
Sbjct: 241 GNLSTVLRSRKMMKEKIKALS-AEAVASALIIGALPPGVIVLI 282


>gi|94312590|ref|YP_585799.1| type II secretion system protein, transmembrane [Cupriavidus
           metallidurans CH34]
 gi|93356442|gb|ABF10530.1| type II secretion system protein, transmembrane [Cupriavidus
           metallidurans CH34]
          Length = 369

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%)

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           S+    P  +D+L +    G+SIDQ+L+ +  + G     L  E+  +  + +   +R+ 
Sbjct: 214 SVADELPILIDMLRLLQGVGLSIDQSLQIIVTEFGSMLQVLGPELQRSNQQFASGRSREQ 273

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
                      + ++     L Q DR+G ++ + LR      +  R    + K   L  K
Sbjct: 274 TLLRIGKLFDDEDLKGLITLLTQVDRHGGAVQEPLRQFGERLQIARKARMKDKIGRLTVK 333

Query: 298 LTVPMIIFFLPVLILVIIGPAILSII 323
           +T  M++  LPVL+++  GP  L ++
Sbjct: 334 MTGVMVVSLLPVLLILTAGPGFLGVM 359


>gi|307721765|ref|YP_003892905.1| hypothetical protein Saut_1849 [Sulfurimonas autotrophica DSM
           16294]
 gi|306979858|gb|ADN09893.1| hypothetical protein Saut_1849 [Sulfurimonas autotrophica DSM
           16294]
          Length = 278

 Score = 45.1 bits (105), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 7/168 (4%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI IG   F  P +++   ++ R   I+   P  +DLL+I +E G  ++ A+ +V  +  
Sbjct: 105 VIGIGIAVFM-PYLYLQEQIKARIKRIENDLPIFIDLLIIILEGGGGLNNAIDKVTTE-- 161

Query: 213 GQSVPLSEEMLLTIAEL--SFLP-NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           G+SV L  ++L    +    F+  +  +A+ N  NRT  D +      +  S+  G  + 
Sbjct: 162 GESV-LGPDLLEESKKFKNEFITYSSDIAYTNLVNRTGSDSIATIVGFMRLSEETGIGVK 220

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
                   E +S  ++  EKKAA++   +T  M IF LP +I +I  P
Sbjct: 221 SIFENQAQELKSMEMLNIEKKAATMNIGITFVMFIFILPAVIAMIAFP 268


>gi|238897544|ref|YP_002923223.1| putative tight adherance operon protein C [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465301|gb|ACQ67075.1| putative tight adherance operon protein C [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 275

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 73/143 (51%), Gaps = 7/143 (4%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF    + I +++ ++   +  ++P  +D+   C+++G++I+ AL   AE+    +  +
Sbjct: 108 IGF--YQLLIKSIIFRKTRLMLSSFPFFIDMTAACIQAGMTIENALTYSAENFYKINEDI 165

Query: 219 SEEMLLTI--AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
           +  ++  +  AE+  L N   A +  Y       ++    A+  S  +G+S+ + L    
Sbjct: 166 ASLIIQVVRKAEVHGLQN---AMKTLYQDVSFLEIKMFCNAVQNSVDFGSSVYEHLMKFS 222

Query: 277 SETRSERLMEAEKKAASLGPKLT 299
           ++ R  +LME+E+K + L  KLT
Sbjct: 223 TDIREIQLMESEEKISKLSVKLT 245


>gi|304392380|ref|ZP_07374321.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295484|gb|EFL89843.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 332

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 130/296 (43%), Gaps = 37/296 (12%)

Query: 29  YAVVIPSLGSGELEK-RMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL 87
           YA++  S+ S +  K RM+ + ++++   K ++ S + D    R ++R++ +L+N   + 
Sbjct: 22  YALLYNSIASDKKSKERMQRLQMDKKT--KMKVESRKMDEKQRR-KSREA-ALKNVDDQK 77

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           +       E     L  AGF    SL    VV  V+ I+F  + ++++            
Sbjct: 78  SKGKTAGKETFREILEQAGF--TISLGKFYVVSAVIGILFFFIALVFM------------ 123

Query: 148 LRVGAVILIGYVGFC-----APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
              GA + I           AP  W+    +KR ++  + +P+A+D+++  ++SG+ ++ 
Sbjct: 124 ---GATLPIAGGVGFVMGFGAPRWWVKRKRKKRFAAFTKTFPNAIDVIVRGIKSGLPLND 180

Query: 203 ALRRVAEDIGGQSVPLSEEM--LLTIAELSF-LPNRQVAFENFYNRTQMDCVRNATQALI 259
            LR +A D      P+  E   L+  A++   +P    A E  Y           +  + 
Sbjct: 181 CLRIIATD---SDEPVRGEFRKLIEAAQMGIPVPE---ACERLYKSIPTSETNFFSIVIA 234

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
                G ++ ++L  L    R  R M  + +A S   K T  MII  LP ++ +++
Sbjct: 235 IQSSAGGNLSEALGNLSKVLRERRKMADKIQAFSSEAK-TSTMIIGALPFVVAIMV 289


>gi|14521588|ref|NP_127064.1| hypothetical protein PAB1458 [Pyrococcus abyssi GE5]
 gi|5458807|emb|CAB50294.1| Hypothetical protein [Pyrococcus abyssi GE5]
          Length = 355

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 103/216 (47%), Gaps = 22/216 (10%)

Query: 111 YSLNILLVVRLVVPIIFLILGII---WIFGYDKLLEYP--FQLRVG-AVILIG--YVGFC 162
           Y  NI++   L V ++ L +G+I   + F +  ++E P    L +G A  L+G  Y+ F 
Sbjct: 109 YRANIMMSKELYVALM-LAVGLISGVFAFLFGIIIEMPIDMSLLIGVAGFLLGFMYMRFY 167

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
             SVW     ++R   ++RA P  L  +   + +GI + + +  VA+   G    +SEE 
Sbjct: 168 PKSVW-----RRRVEEVERALPYVLRHMASLLNAGIGLAETMVSVAKSDYGV---ISEEF 219

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            + + E+    + + A  +F  + + D V    + ++++ ++G ++ D L  +  E   E
Sbjct: 220 RMMVQEMHKGSSFEDALASFEEKMKSDMVSRVVKQILRALKFGGNLADILYKMADEFSFE 279

Query: 283 ---RLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
              +LM+  +K    G       +   +P L++V+I
Sbjct: 280 YRIKLMDYVQKIN--GISFVYMFMTVVMPTLLIVVI 313


>gi|84489955|ref|YP_448187.1| type II secretion protein F [Methanosphaera stadtmanae DSM 3091]
 gi|84373274|gb|ABC57544.1| predicted type II secretion protein F [Methanosphaera stadtmanae
           DSM 3091]
          Length = 277

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 71/152 (46%), Gaps = 15/152 (9%)

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
            I +  P  L  L I +++GI +  A+  V+    GQ   LS+E  +T+ E+ +  N   
Sbjct: 100 DILKVIPYVLRELSIELKAGIGLFDAIEEVSNGNYGQ---LSKEFKITLNEIKYGTNYIE 156

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS---- 293
           AFEN   R  +  +      + ++   G ++ D+L +L +E  + R M+ + K  S    
Sbjct: 157 AFENLSKRINLPIMEKIVSHMNRTIINGGNLADTLNILANE--NSRNMQIKYKEYSEKLN 214

Query: 294 ------LGPKLTVPMIIFFLPVLILVIIGPAI 319
                 +   + +P+I+F + +    +IGP +
Sbjct: 215 SLMILYMFTTVVIPVILFIMIIAATTVIGPIV 246


>gi|289641000|ref|ZP_06473169.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
 gi|289509120|gb|EFD30050.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
          Length = 315

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 9/159 (5%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++  +++R+  I   +P   +LL + V +G S   AL RV+    G+   L  E+ L +
Sbjct: 158 WLTRAIREREERILIEFPTVAELLALAVTAGESPVGALERVSRLSHGE---LGRELRLAL 214

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR---VLVSETRSER 283
           A+         A E    RT +  +      +  +   GT + + LR   V V E    +
Sbjct: 215 ADARAGATLVQALEGMATRTTVPSLARFVDGMAVAIERGTPLAEVLRAQAVDVREAGKRQ 274

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L+EA  +       + VP++ F LP  ++    PA++S+
Sbjct: 275 LLEAGGRKEI---AMMVPVVFFVLPTTVIFAFYPALVSL 310


>gi|296268209|ref|YP_003650841.1| type II secretion system protein [Thermobispora bispora DSM 43833]
 gi|296090996|gb|ADG86948.1| type II secretion system protein [Thermobispora bispora DSM 43833]
          Length = 260

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 65/140 (46%), Gaps = 6/140 (4%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P A+DLL+ C+ +G  +D+A+   A+ IGG   PL+E M     +L    +   A+    
Sbjct: 121 PFAIDLLVACLRAGQPVDRAVEVTADAIGG---PLAERMSWVAVQLRLGADPGTAWAGLA 177

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           +           + +I++ + G  + D L  L  + R      +   A  +G ++  P+ 
Sbjct: 178 DEPPAAPF---ARTMIRAAKGGAPVADVLVRLADDARQAARAASSAAARKVGVQVVAPLG 234

Query: 304 IFFLPVLILVIIGPAILSII 323
           + FLP  +L+ I P I  +I
Sbjct: 235 LCFLPAFVLLGIIPMIAGLI 254


>gi|325663219|ref|ZP_08151669.1| hypothetical protein HMPREF0490_02410 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470673|gb|EGC73903.1| hypothetical protein HMPREF0490_02410 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 394

 Score = 44.7 bits (104), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 73/146 (50%), Gaps = 7/146 (4%)

Query: 183 WPDALDLLLICVESGISIDQALRRVAED-----IGGQSVPLSEEMLLTIAELSFLPNRQV 237
           +P+ L+  ++ + +G++   A ++++ D     I G+     EEM  T+ E+    + + 
Sbjct: 248 YPEILNKFVLFLGAGMTAKAAWQKISSDYEKGKIMGKERFAYEEMAYTLREMQAGGSEKE 307

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            +E+F  R +  C       L Q+ + G+  + D LR+       ER   A+K    +G 
Sbjct: 308 CYEHFGKRCEAVCYMRFGALLSQNLKRGSKGLADLLRLEAVNAFEERKRAAKKAGEEVGT 367

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSI 322
           KL  PM  F L V+++++I PA LS+
Sbjct: 368 KLLAPMF-FMLTVVLVIVIVPAFLSM 392


>gi|212635450|ref|YP_002311975.1| Tight adherence TadB-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556934|gb|ACJ29388.1| Tight adherence TadB-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 325

 Score = 44.7 bits (104), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 51/95 (53%), Gaps = 4/95 (4%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
            KR   I+ ++PDALD+L   +++G S   A++ V E++ G   PL++E  L  A +++ 
Sbjct: 144 NKRMDKIEESFPDALDVLRRALQAGYSFSDAVKLVTEEMEG---PLAKEFSLMFANINYS 200

Query: 233 PNRQVAFENFYNRT-QMDCVRNATQALIQSDRYGT 266
            + + A  +F  R   +  +  A+  ++Q +  G 
Sbjct: 201 KDTKRALLSFIERVPSVSAMAFASAVMVQKETGGN 235


>gi|167648148|ref|YP_001685811.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350578|gb|ABZ73313.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 325

 Score = 44.7 bits (104), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 72/156 (46%), Gaps = 4/156 (2%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P   +  + + R      A+ DA+D+++  ++SG+ ++  L+ + ++      PL+
Sbjct: 131 GFGLPRWVVGMMAKARTKKFTEAFSDAIDIIVRGIKSGLPVNDCLKIIGKEC---PEPLA 187

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E  + +       +   A E  Y R   + +R  T  L    + G ++ ++L  L +  
Sbjct: 188 GEFRVLVENTGMGMSMDQALERMYERMPTNELRFFTIVLTIQAKTGGNLAEALGNLSTVL 247

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           R+ +LM  + KA S    +    II  LP  ++++I
Sbjct: 248 RARKLMGEKIKALS-AEAVASAFIIGALPPGVVILI 282


>gi|163851907|ref|YP_001639950.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|163663512|gb|ABY30879.1| type II secretion system protein [Methylobacterium extorquens PA1]
          Length = 323

 Score = 44.7 bits (104), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 130/307 (42%), Gaps = 37/307 (12%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           AV+  SL Y  ++P+L SGE     +     R+ L + Q    ++ +A+SR R + +KSL
Sbjct: 14  AVAAGSLAYVFLMPAL-SGERRAEQR-----RKALGQPQAVLAERGAAASR-REQVAKSL 66

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGF---RSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           +    K +   + ++     +L  AG    R +Y        R+V  I  ++L +     
Sbjct: 67  KELEAKKDKTKVTLEL----RLARAGLDWSRQKY--------RVVSAITAVVLALAAFLV 114

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              ++     L VG        GF  P+ W+    ++R  +     P+A+D+++  + SG
Sbjct: 115 SHNVIVAGLALFVG--------GFGLPAWWLKRRQKRRVEAFIEELPNAMDVVVRGLRSG 166

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           I +   LR +A +      PL  E  +T+   +   +   A    Y R  +  V   +  
Sbjct: 167 IPLGDCLRMIARE---AKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTEVNFFSIV 223

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP    V+ G 
Sbjct: 224 IGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALP---FVVGGG 279

Query: 318 AILSIID 324
             LS  D
Sbjct: 280 TYLSSPD 286


>gi|320009994|gb|ADW04844.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 270

 Score = 44.7 bits (104), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 61/149 (40%), Gaps = 6/149 (4%)

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I R  P   DLL  C+ +G    +A   V E + G   P+ E +  T A +        A
Sbjct: 125 IARQLPITADLLASCLSAGAGPREAAEAVGESVAG---PVGERLARTAAVILLGGEPDEA 181

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           +  F    ++       + + ++   G    + +  L  E R+ER   A  +A   G  +
Sbjct: 182 WRRF---GELPGAAPLARCMARASSTGAPAAEPVSGLADEIRAERASAAVARAQRAGVLI 238

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           T P+ + FLP  + V + P ++ +   + 
Sbjct: 239 TAPVGLCFLPAFLAVGVAPVVIGLATGLS 267


>gi|317124421|ref|YP_004098533.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315588509|gb|ADU47806.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 314

 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 68/155 (43%), Gaps = 9/155 (5%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +S   ++R+  +   +P   +LL + V +G     AL RV     G+   L++E+   +A
Sbjct: 159 LSRAARRREQRMLAEFPTVAELLALAVSAGEGATGALERVCRLSDGE---LADELRRCLA 215

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER---L 284
           +     N   A +   +RT +  +      ++ +   GT + D LR    + R +    L
Sbjct: 216 DARAGANLPTALQGLADRTGLPSLSRFVDGIVVAVERGTPLADVLRAQAQDVREDGRRVL 275

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           ME   K   +   + VP++   LPV +L  I P +
Sbjct: 276 MEQGGKREIV---MMVPVVFLILPVTVLFAIYPGL 307


>gi|84494453|ref|ZP_00993572.1| hypothetical protein JNB_06644 [Janibacter sp. HTCC2649]
 gi|84383946|gb|EAP99826.1| hypothetical protein JNB_06644 [Janibacter sp. HTCC2649]
          Length = 310

 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 69/162 (42%), Gaps = 9/162 (5%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G  A  V++S    +R+  +   +P   +LL + V +G     AL RV     G+   LS
Sbjct: 147 GVVAADVFLSRRANQREERMLAEFPTVAELLALAVGAGEGAVGALERVCRLSRGE---LS 203

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           +E+   + +     +  VA     +RT +  +      ++ +   GT + D LR    + 
Sbjct: 204 DELRRCLGDARAGASLPVALHGLADRTGLMSLTRFVDGIVIAVERGTPLADVLRAQAQDV 263

Query: 280 RSE---RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           R E    +MEA  K       + +P++   LP+ +L  I P 
Sbjct: 264 REEGRRAIMEAGGKKEI---AMMIPVVFLVLPITVLFAIFPG 302


>gi|157961841|ref|YP_001501875.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846841|gb|ABV87340.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 325

 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           KR   I+ ++PDALD+L   +++G S   A++ V E++ G   PL++E  L  A +++  
Sbjct: 145 KRMDKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMDG---PLAKEFSLMFANINYSK 201

Query: 234 NRQVAFENFYNRT-QMDCVRNATQALIQSDRYGT 266
           + + A   F  R   +  +  A+  ++Q +  G 
Sbjct: 202 DTKRALLGFIERVPSVSAMAFASAVMVQKETGGN 235


>gi|254293218|ref|YP_003059241.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041749|gb|ACT58544.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 331

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 128/282 (45%), Gaps = 36/282 (12%)

Query: 35  SLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILV 94
           ++G+G   K  K+ +V+  ++R++Q+    +DS  + LR R++K  ++   +        
Sbjct: 42  AVGAGSGGK--KNSSVDATLMRRKQM----QDSMKT-LRERENKRRKDTRGR-------- 86

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
              I +KL  AG+  E ++    V+  V  ++  + GI ++ G   L+          + 
Sbjct: 87  --TIKDKLAQAGWTIEPAM--FWVLSAVTGVV--VAGITFVLGQTPLI----------IA 130

Query: 155 LIGYVGFCAPSVWISNL-VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
             G+ G      W+  + +  RQ    + + D +D+++  V+SG+ + + LR +A +   
Sbjct: 131 GAGFAGALGLPRWVVGMGISARQKKFTQQFSDGIDVIVRGVKSGLPLIECLRIIASE--- 187

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
              PL  E    I  +      + +  N YNR  +  V      +    + G ++ ++L 
Sbjct: 188 SPAPLGTEFKRVIDAIQMGTTVEKSLSNMYNRMPLPEVNFFGIVIGIQQQSGGNLSEALG 247

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            L    RS +++  + KA S   K +  MII  LP+ +++++
Sbjct: 248 NLSEVLRSRKMLAEKVKALSSEAKASA-MIIGALPIAVMILV 288


>gi|167624198|ref|YP_001674492.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354220|gb|ABZ76833.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 325

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           KR   I+ ++PDALD+L   +++G S   A++ V E++ G   PL++E  L  A +++  
Sbjct: 145 KRMEKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMEG---PLAKEFSLMFANINYSK 201

Query: 234 NRQVAFENFYNRT-QMDCVRNATQALIQSDRYGT 266
           + + A   F  R   +  +  A+  ++Q +  G 
Sbjct: 202 DTKRALLGFIERVPSVSAMAFASAVMVQKETGGN 235


>gi|218887823|ref|YP_002437144.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758777|gb|ACL09676.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 321

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 9/95 (9%)

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
           +GY     P +W+      R    +R  PDALDL+   +++G + +Q +R VA++     
Sbjct: 127 LGYT----PFLWVQRKRNARMGRFQRQLPDALDLIARALKAGHAFNQGMRMVADEFAD-- 180

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            P+  E   T+ E++F      A  N   R  +DC
Sbjct: 181 -PIGPEFQKTLDEINFGIPADAALYNLTRR--VDC 212


>gi|15887569|ref|NP_353250.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155106|gb|AAK86035.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 334

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 146/348 (41%), Gaps = 77/348 (22%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D T + +A+  A+S  +L YA +   +   E+EK+  S        R +++ + + D  +
Sbjct: 2   DPTIVLLAVLVAISAGALAYAFLFQQI---EVEKKTTS--------RFKRVQAAETDHTN 50

Query: 70  -----------SRLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFRSEYSLNILL 117
                      S+ R     SLR+  KK N KA      ++ +KL  AG         LL
Sbjct: 51  IKAARDRVQELSKRRKSMQDSLRDMEKKQNEKAKKAKNVSLRDKLVQAGLTISVRQFHLL 110

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
                    F+ L    I+G   L   P       + ++  +G   P   ++ L+++RQ 
Sbjct: 111 SAGAAACAAFISL----IYGLSLLTALP-------IAVVAALGL--PRWVLAFLLKRRQK 157

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAED------------IGGQSVPLS-----E 220
                +P+ALD++   ++SG+ ++ A+R +A D            +  Q V +      E
Sbjct: 158 KFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGIGIPQGIE 217

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
            M+LT      +P  +V+F +     Q     N ++AL           +  RVL    R
Sbjct: 218 RMMLT------MPLFEVSFFSIVINIQAQAGGNLSEAL----------SNLSRVL----R 257

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
             R M A+  A S+  K +  +II  LP ++++++    P  LSI+ T
Sbjct: 258 DRRKMRAKVNALSMEAKASA-VIIGALPFIVMLLVHFTSPDYLSILFT 304


>gi|330953057|gb|EGH53317.1| type II secretion system protein [Pseudomonas syringae Cit 7]
          Length = 294

 Score = 44.3 bits (103), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 108/238 (45%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  +++ I+    + K ++ P
Sbjct: 56  RIGQRSISLDSETQILLNRIGWRRASKRSLFAACQVGVPVGLMVMVILGQLLFFKGVQQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  +  +G VG+  P   ++   ++RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPIFALG-VGYLLPKRILAAAARRRQKQVVVEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G   +P LSEE+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSNE-GKDLLPVLSEEIRVVLVRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL +L       RL   ++  + L  K++V M++F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLMLKQLIDDRRLTRLQEYISKLSAKMSVVMMVFLFPALLIVLAGPGFMAI 288


>gi|269955831|ref|YP_003325620.1| type II secretion system protein [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304512|gb|ACZ30062.1| type II secretion system protein [Xylanimonas cellulosilytica DSM
           15894]
          Length = 312

 Score = 44.3 bits (103), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 82/173 (47%), Gaps = 9/173 (5%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V++ G  GF A    ++  + +R+  +   +P   +LL + V +G +   AL RVA    
Sbjct: 142 VLISGACGFAACDQVLTRQISQREERMVAEFPTIAELLALAVTAGEAPISALERVAATAR 201

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G+   LS E+  T+A++       +A  +  +RT +  +    + +  +   GT + + L
Sbjct: 202 GE---LSVEIRRTLADVRAGAPIALALTDMADRTGLPSLTRFAEGVAVALERGTPLAEVL 258

Query: 273 RVL---VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R     V E+    LMEA  +   +   + VP++   LP+ ++  I P++ ++
Sbjct: 259 RAQAQDVRESGRRALMEAGGRKEVV---MLVPVVFLILPITVVFAIYPSLATL 308


>gi|85707699|ref|ZP_01038765.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
 gi|85689233|gb|EAQ29236.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
          Length = 323

 Score = 44.3 bits (103), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 108/253 (42%), Gaps = 30/253 (11%)

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL--------VV 123
           LR R S+S    V+    KAI   +   +K+  +G R+E      L VRL        V 
Sbjct: 40  LRYRHSESTDAKVESQFKKAIAARKPKAHKVAGSGSRTE-----ALEVRLDRTGKGWTVS 94

Query: 124 PIIFLILGIIWIFGYDKLLEY--PF-QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
             +++ LGII + G    ++   PF  L  GA     +VG   P + +S  ++KR +   
Sbjct: 95  QYLYVTLGIILVVGVLLYIQTGAPFLSLAAGA-----FVGLGLPHLVVSFFIKKRTNDFN 149

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
             + D ++LL+  + SG+ + + L  VA+++ G   P+  E    +  +      + + +
Sbjct: 150 AKFADGIELLVRGLRSGLPVTETLAVVAQEVPG---PVGLEFKGIVERIKIGKTMEDSLQ 206

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL-- 298
              +R  +      T  L      G ++ ++L  L    R    M+ + KA S   K   
Sbjct: 207 ETADRLGIPEFNFFTITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIKAMSSESKASA 266

Query: 299 ----TVPMIIFFL 307
               ++P I+F L
Sbjct: 267 YIVGSLPFIVFGL 279


>gi|159039934|ref|YP_001539187.1| type II secretion system protein [Salinispora arenicola CNS-205]
 gi|157918769|gb|ABW00197.1| type II secretion system protein [Salinispora arenicola CNS-205]
          Length = 255

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 10/142 (7%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT--IAELSFLPNRQVAFEN 241
           P A DLL   + +G  +D+++  VAE + G   PL+E + L   +  L   P      E 
Sbjct: 118 PLAADLLASVMRAGAPVDRSVLAVAEALDG---PLAERLALVGRLLRLGAEPA-----EA 169

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           +     +        A ++S   G ++  +L  L  + R++R  E E KA   G  + +P
Sbjct: 170 WSTLAAVPGAERLIAAALRSAASGATLAGALTRLADDLRADRATEVEAKARRSGVLIVLP 229

Query: 302 MIIFFLPVLILVIIGPAILSII 323
           + + FLP  IL  + P I++++
Sbjct: 230 LGLCFLPAFILAGLMPVIVAVL 251


>gi|258651872|ref|YP_003201028.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
 gi|258555097|gb|ACV78039.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
          Length = 311

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 74/159 (46%), Gaps = 9/159 (5%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++  V K++  I   +P   ++L + V +G S   AL RV +   G   PL  ++   +
Sbjct: 154 WLTQAVSKQEEEIIAEFPVIAEMLALSVTAGESPTGALDRVTKLAHG---PLVSQLSGVL 210

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS---ER 283
           AE         A  +  +RT+++ +      +  +   GT + D LR   ++ R+    +
Sbjct: 211 AETRAGTPFLTALTHLRDRTRLEPLARFLDGMAVAIERGTPLADVLRAQAADVRALSKRQ 270

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           L+E+  +       + VP++   LP+ IL  + P +L+I
Sbjct: 271 LLESGGRKEI---AMMVPVVFLVLPITILFALYPGLLAI 306


>gi|218675030|ref|ZP_03524699.1| putative tadC pilus assembly protein [Rhizobium etli GR56]
          Length = 76

 Score = 44.3 bits (103), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%)

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           QS+  GTS+  +LRV     R  R++ AE+KA +L  K+ +P+  F  PV +++++ P +
Sbjct: 3   QSEELGTSVTQTLRVYSKGMRDLRIVRAEEKANALPVKMLLPLGAFLFPVSLIIVLVPIV 62

Query: 320 LSIIDTM 326
           + ++  +
Sbjct: 63  IRVVSLL 69


>gi|239814536|ref|YP_002943446.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801113|gb|ACS18180.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 330

 Score = 43.9 bits (102), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G+++ F    L   P  +     +L+   G   P +++++   +R + ++R  PDALDL+
Sbjct: 111 GMLFFFAMTSLANQPAWI----ALLVSAAGAAVPLLYLNHRRSRRLAHLERQLPDALDLV 166

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
              + +G S   +++ + +++   S P++ E  +   E+ F  + Q A  N   R  +  
Sbjct: 167 TRALRAGHSFASSVQMIGDEM---SEPIAGEFRMVADEVGFGVSLQQALTNMSERVPLTD 223

Query: 251 VRN-ATQALIQSDRYGT 266
           +R      LIQ D  G 
Sbjct: 224 LRYFVVSVLIQRDSGGN 240


>gi|157375502|ref|YP_001474102.1| Flp pilus assembly protein TadB [Shewanella sediminis HAW-EB3]
 gi|157317876|gb|ABV36974.1| conserved hypothetical Flp pilus assembly protein TadB [Shewanella
           sediminis HAW-EB3]
          Length = 325

 Score = 43.9 bits (102), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 123/270 (45%), Gaps = 33/270 (12%)

Query: 55  LRKQQITSLQKDSASSRLRT---RDSKSLRNFVKKLN-----LKAILVDENIVNKLRAAG 106
           L ++++  L K+S  S   T   R SK     ++KLN     L+ I   EN+  +L  A 
Sbjct: 37  LVRKRLKQLSKNSDDSEFETSLLRKSK-----LQKLNRFGRALEKIEFIENLSYRLELAD 91

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           ++       LL   LV  II  +L   W F  + ++     + V AV L+ +       +
Sbjct: 92  YKMMGHHFFLLA--LVTSIITGLL--TWQFTREPII----TVFVMAVTLMLF------HI 137

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
            +S    KR  +I+ ++PDALD++   +++G S   A++   E++ G   P+++E  L  
Sbjct: 138 KLSRDTNKRMDAIEASFPDALDVVRRALQAGYSFSDAIKLATEELEG---PIAKEFKLMF 194

Query: 227 AELSFLPNRQVAFENFYNRT-QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           A +++  + + A   F  R   +  +  A+  ++Q +  G ++ +++  L    R     
Sbjct: 195 ANINYTKDVKRALLGFIERVPSISAMAFASAVMVQKET-GGNLAENIESLSRVIRERFTF 253

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVII 315
               K  S   +L+   I+  LP ++  +I
Sbjct: 254 RRRVKTLSAEGRLSA-WILILLPFVLFAVI 282


>gi|332158910|ref|YP_004424189.1| hypothetical protein PNA2_1270 [Pyrococcus sp. NA2]
 gi|331034373|gb|AEC52185.1| hypothetical protein PNA2_1270 [Pyrococcus sp. NA2]
          Length = 355

 Score = 43.9 bits (102), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 94/210 (44%), Gaps = 16/210 (7%)

Query: 109 SEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWI 168
            E  + ++L V ++  I+   LGII     D  L       VG ++   Y+ F   SVW 
Sbjct: 117 KEKYVALMLAVGIIAGIMGFFLGIITEMSMDMNLALGI---VGFLLGFVYMRFYPKSVW- 172

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAE 228
               ++R   ++R+ P  L  +   + +GI + + +  VA+   G    +SEE  + I E
Sbjct: 173 ----RRRVEEVERSLPYVLRHMASLLSAGIGLAETMVSVAKSDYGV---ISEEFRMVIQE 225

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE---RLM 285
           +    + + A   F  + + D V    + ++++ ++G ++ D L  +  E   E   +LM
Sbjct: 226 MHKGSSFEDALTKFEEKMKSDMVSRVVKQILRALKFGGNLSDILYKMADEFSFEYRIKLM 285

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           +  +K    G       +   +P L++V+I
Sbjct: 286 DYVQKIN--GISFVYMFMTVVMPTLLIVVI 313


>gi|261402163|ref|YP_003246387.1| Type II secretion system F domain protein [Methanocaldococcus
           vulcanius M7]
 gi|261369156|gb|ACX71905.1| Type II secretion system F domain protein [Methanocaldococcus
           vulcanius M7]
          Length = 301

 Score = 43.9 bits (102), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 23/144 (15%)

Query: 151 GAVILIG-YVG--FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           G +I I  YVG     PS+   N ++  +++I    P AL ++++ +ESG SI++AL  V
Sbjct: 58  GMIIAIALYVGALISLPSILYENKMETLENNI----PQALYIMILTLESGRSINEALEEV 113

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE-------NFYNRTQMDCVRNATQALIQ 260
            ++       + E   +    L  +  ++++FE       N Y+      ++   + +I+
Sbjct: 114 VKN------NIKEVSNVFKKVLYLMEKQKISFEEAMTIVSNLYDS---KVLKMLARIMIE 164

Query: 261 SDRYGTSIGDSLRVLVSETRSERL 284
           + +YG ++ DSLRVL       RL
Sbjct: 165 NRKYGGNLADSLRVLAKTLEDFRL 188


>gi|325291655|ref|YP_004277519.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059508|gb|ADY63199.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 334

 Score = 43.9 bits (102), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 84/357 (23%), Positives = 151/357 (42%), Gaps = 84/357 (23%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T L +A   A+S  +L YA +   +   E+EK+  S        R +++ + + D A
Sbjct: 1   MDPTILLLAALVAISAGALAYAFLFQQI---EVEKKTTS--------RVKRVKAAETDHA 49

Query: 69  S-----------SRLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFR-SEYSLNI 115
           +            + R     SLR   KK + KA       +  KL  AG + S    ++
Sbjct: 50  NIKAARDRVQELGKRRKSMQDSLREMEKKQSEKAKKAKNVGLREKLVQAGLQLSVRQFHL 109

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
           L        ++  +L     +G   L+     L +GAV+ +G      P   +  ++++R
Sbjct: 110 LSAGAAAFSVVIALL-----YGLSLLIA----LLIGAVVALGL-----PRWVLGFILKRR 155

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAED------------IGGQSVPLS---- 219
           Q      +P+ALD++   ++SG+ ++ A+R +A D            +  Q V +     
Sbjct: 156 QKKFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGIGIPQG 215

Query: 220 -EEMLLTIA--ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            E M+LT+   E+SF       F    N              IQ+ + G ++ ++L  L 
Sbjct: 216 IERMMLTVPLFEVSF-------FSTVIN--------------IQA-QAGGNLSEALSNLS 253

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT-MKDH 329
              R  R M A+  A S+  K +  +II  LP ++++++    P  LS++ T M+ H
Sbjct: 254 KVLRERRKMRAKVNALSMEAKASA-VIIGALPFIVMLLVHFTSPDYLSVLFTDMRGH 309


>gi|288919650|ref|ZP_06413978.1| type II secretion system protein [Frankia sp. EUN1f]
 gi|288348939|gb|EFC83188.1| type II secretion system protein [Frankia sp. EUN1f]
          Length = 367

 Score = 43.9 bits (102), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 9/165 (5%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           G  A   W++  +++R+  +   +P   +LL + V +G S   AL RV+    G+   L 
Sbjct: 203 GILARDWWLTRAIREREDRMLMEFPTVAELLALAVTAGESAIGALERVSRLTRGE---LG 259

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR---VLV 276
            E+ L +A+         A E    RT +  +      +  +   GT + D LR   V V
Sbjct: 260 TELRLALADARAGATLVQALEGIAARTSLPPLTRFVDGMAVAIERGTPLADVLRAQAVDV 319

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            E    +L+EA  +       + +P++   LP  ++    PA++S
Sbjct: 320 REAGKRQLLEAGGRKEI---AMMIPVVFLILPTTVIFAFYPALVS 361


>gi|227494922|ref|ZP_03925238.1| type II secretion system protein [Actinomyces coleocanis DSM 15436]
 gi|226831374|gb|EEH63757.1| type II secretion system protein [Actinomyces coleocanis DSM 15436]
          Length = 293

 Score = 43.9 bits (102), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 86/199 (43%), Gaps = 13/199 (6%)

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW---- 183
           L++G+  IFG          L V   +LI  + F   +V    L+  R ++  +      
Sbjct: 102 LLIGLAIIFGKAG------NLTVLQWLLITSISFTLITVGWDKLLTYRVNTFSKKLNSQV 155

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
            DA +LL + + +G S+  AL RVA+  G Q     E  L  IA+ + +     A +   
Sbjct: 156 ADAAELLALVISAGESVPGALNRVAKVSGPQMASQLESALTQIAQGTAVSK---ALKTLA 212

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
           N+T    ++     L+     G+S+ + LR    + R E L    +        + +P++
Sbjct: 213 NKTPSVQLQRLLNTLVSGMERGSSLSEILRHQAKDLREESLRNLLESGGRKEIAMLIPVV 272

Query: 304 IFFLPVLILVIIGPAILSI 322
              LPV ++  + P ++++
Sbjct: 273 FLILPVTVIFALYPGLIAL 291


>gi|312199821|ref|YP_004019882.1| type II secretion system F [Frankia sp. EuI1c]
 gi|311231157|gb|ADP84012.1| Type II secretion system F domain protein [Frankia sp. EuI1c]
          Length = 323

 Score = 43.9 bits (102), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 9/158 (5%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++  ++ R+  +   +P   +LL + V +G S   AL RVA    G+   L  E+ L +
Sbjct: 166 WLTRAIRAREDRMLMEFPTIAELLALAVTAGESPVGALERVARLTHGE---LGYELRLAL 222

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR---VLVSETRSER 283
           A+         A E    RT +  +      +  +   GT + D LR   V V E    +
Sbjct: 223 ADARAGATLVQALEGIATRTTLGSLARFVDGMAVAIERGTPLADVLRAQAVDVREAGRRQ 282

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           L+E+  +       + VP++   LP  ++    PA++S
Sbjct: 283 LLESGGRKEI---AMMVPVVFLVLPTTVIFAFYPALVS 317


>gi|209886534|ref|YP_002290391.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874730|gb|ACI94526.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score = 43.5 bits (101), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 139/318 (43%), Gaps = 34/318 (10%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           LA+A  +AV++  L +  + P+L G  + EKR  S+A    I R+ +    +    S R 
Sbjct: 6   LAIAFMSAVTLGGLAWVFLYPALSGERQAEKRRASLARPENIARRVE----RNPQRSRRE 61

Query: 73  RTRDS-KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI-IFLIL 130
           +  D+ K + N  K+    A  V  NI  +L  AG    ++    ++   V+ I  FL+ 
Sbjct: 62  QVEDTLKDVENRAKQ----AKKVPLNI--RLEQAGV--NWTKRQFMIGSAVLGIATFLLF 113

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR-QSSIKRAWPDALDL 189
            I+         +  F   +  +   G  GF  P  W+ N ++KR +     A PDA+D+
Sbjct: 114 YIV---------DANF---LATIAFAGAAGFGLPR-WVLNFLKKRREKKFLDALPDAVDV 160

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  V++G+ +  +L+ V  D      PL  E    I   S       A    Y R  + 
Sbjct: 161 IVRGVKAGLPLFDSLKVVVND---SPEPLRSEFRAIIETQSIGMPLGEACMRLYERMPLP 217

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
                   +    + G ++ ++L  L    R  + M+A+ +A S+  K +  +I    P 
Sbjct: 218 EANFFGIVVGIQMKSGGNLSEALGNLSKVLRDRKKMKAKIQAMSMEAKASAGIIGSLPPA 277

Query: 310 LILVI--IGPAILSIIDT 325
           +++++  + P  +S++ T
Sbjct: 278 VMMIVYFMSPDYISLLWT 295


>gi|283769335|ref|ZP_06342234.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
 gi|283103992|gb|EFC05376.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
          Length = 294

 Score = 43.5 bits (101), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 4/143 (2%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           +KR +   +  P+AL ++  C+ SG +   AL RV+ED+     P+SEE+   I E+++ 
Sbjct: 113 KKRLALFNKQLPEALVIIGNCLRSGFTFRHALARVSEDLPN---PISEELKRVIREVNYG 169

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
              + +     +RT    +     A+    R G ++ + +   V+ET ++R+    +   
Sbjct: 170 RKLEESLGELASRTNSAELEMINSAVTIQQRSGGNLAEIVEK-VTETINDRINIRNQIRV 228

Query: 293 SLGPKLTVPMIIFFLPVLILVII 315
                    M+I  LPV +L+I+
Sbjct: 229 LTTQGRYSGMLIGLLPVFLLIIL 251


>gi|313126950|ref|YP_004037220.1| archaeal flagella assembly protein j [Halogeometricum borinquense
           DSM 11551]
 gi|312293315|gb|ADQ67775.1| archaeal flagella assembly protein J [Halogeometricum borinquense
           DSM 11551]
          Length = 719

 Score = 43.5 bits (101), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE-DIGGQSVPLSEEMLLTIAE 228
            L ++R  +I+R  PD LD +    E+G+++ ++L R+A+ D+G    P+SEE+  T  +
Sbjct: 489 ELRKRRLKAIEREMPDFLDRMASVNEAGVTVVKSLHRLAQSDLG----PISEELRRTWRD 544

Query: 229 LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           + +  + + A   F  R Q+  V  A   ++ +      +   LR+  +E +
Sbjct: 545 IQWGASLRNALRGFDRRAQVPMVSRAVTLIMNAVAASGEVAPVLRIAANEAQ 596


>gi|330959999|gb|EGH60259.1| hypothetical protein PMA4326_15689 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 294

 Score = 43.1 bits (100), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 105/238 (44%), Gaps = 6/238 (2%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           ++  ++I +D      L   G+R     ++    ++ VP+  + +  +    + K +E P
Sbjct: 56  RVGQRSISLDSETQILLNRIGWRRASKRSLFAACQIGVPVGLMCVVALVQLLFFKNIEQP 115

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  V  +G VG+  P   ++   ++RQ  +       + LL I  ESG++++QALR
Sbjct: 116 L---IAPVFALG-VGYLLPKRVLAVAAKRRQKQVVLEISTFIPLLRILFESGMAVEQALR 171

Query: 206 RVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            ++ + G + +P LS+E+ + +  +                  +D + +    L Q    
Sbjct: 172 VLSSE-GKELLPVLSDEIRVVLTRVDSGLELGEELRKTAALLAVDELSDTCVILNQLIHQ 230

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           G     SL  L       RL   ++  + L  K+++ M+ F  P L++V+ GP  ++I
Sbjct: 231 GGGALKSLLTLKQLIDDRRLTRLQEYISKLSAKMSMVMMAFLFPALLIVLAGPGFIAI 288


>gi|51245381|ref|YP_065265.1| TadB [Desulfotalea psychrophila LSv54]
 gi|50876418|emb|CAG36258.1| related to TadB [Desulfotalea psychrophila LSv54]
          Length = 317

 Score = 43.1 bits (100), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 69/139 (49%), Gaps = 4/139 (2%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++R+ + +  +PDALDL+   +++G SI  +L+ V+E++     P++EE  + + E++F 
Sbjct: 136 RQRRINFEEHFPDALDLMGYAMKAGHSIMASLKMVSEEMPA---PINEEFAIVVEEINFG 192

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +      NF  R     +R    ++I     G ++ + L  + +  R +       +A 
Sbjct: 193 KSIDSTLRNFAKRVDSTELRYFVTSVIVQRETGGNLVEILEKISAIIRKKFRFRERVRAL 252

Query: 293 SLGPKLTVPMIIFFLPVLI 311
           S   KL+  +I+  LP  I
Sbjct: 253 SAEGKLSA-IILVALPFCI 270


>gi|225376647|ref|ZP_03753868.1| hypothetical protein ROSEINA2194_02289 [Roseburia inulinivorans DSM
           16841]
 gi|225211530|gb|EEG93884.1| hypothetical protein ROSEINA2194_02289 [Roseburia inulinivorans DSM
           16841]
          Length = 344

 Score = 43.1 bits (100), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 31/212 (14%)

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG     ++N+ +   L+  +IF+I G                       L+GY+    P
Sbjct: 155 AGIAIGLAMNMGMRSFLIGIVIFVIFG-----------------------LLGYI----P 187

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
              ++ +V KRQ  I+R +P  +  + +   +G+ + QA R  +    G    L +EM  
Sbjct: 188 YDSVNAVVSKRQEDIEREFPQVISKMTLLTVAGMEVSQAWRLASASGEG---TLYKEMKR 244

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS-IGDSLRVLVSETRSER 283
            + +     +   A+  F +R           A+IQ+   G S I    R L  E+  E 
Sbjct: 245 VLVDFDNNVSPVEAYSKFISRCSNTYTTKLATAIIQNISKGNSEIVTLFRQLNDESWLEH 304

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
              A +    +  KL +P ++ F  ++IL+I+
Sbjct: 305 KHNARRMGEKIQSKLLLPTMLMFGGIIILIIV 336


>gi|325109818|ref|YP_004270886.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970086|gb|ADY60864.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 319

 Score = 43.1 bits (100), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 3/149 (2%)

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +W  G   LL  P  L       +    FC PSV+      +R ++++   P+  DL+  
Sbjct: 101 LWSAGLVALLVIPLHLGTAWSAGLSLAAFCIPSVYAVQRRNQRINTLRDQLPETFDLMSR 160

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            +ESG +I  A + V+   GG   P+++E      + +     ++   +   RT +  ++
Sbjct: 161 AIESGQTISGAFQLVSTQCGG---PIAKEFQHCCQQQNLGLPYEITLRDLARRTGVMELQ 217

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRS 281
               ALI   + G    D L+ L    R+
Sbjct: 218 MFAVALIVQRQAGGDPSDVLKNLAEAVRN 246


>gi|296134294|ref|YP_003641541.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032872|gb|ADG83640.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 320

 Score = 43.1 bits (100), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 75/167 (44%), Gaps = 7/167 (4%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF  P   +    QKR +       DAL ++   + +G S  QA+  V++++     P+S
Sbjct: 126 GFIVPKYVVKAAKQKRVARFNAQIGDALIIMANSLRAGFSFLQAMELVSKEM---PAPIS 182

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E    + E++     + A +N  NR + + +     A++   + G ++   L  +    
Sbjct: 183 VEFARALREMNLGTATEEALQNLCNRVESEDLDLVITAVLIQRQVGGNLSQILEGISHTI 242

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPV---LILVIIGPAILSII 323
           R    ++ E K  +   +++  MI+  LPV   LIL +I P  + I+
Sbjct: 243 RERVRIKGEIKTLTAQGRIS-GMIVGALPVGMGLILAVINPGYIGIL 288


>gi|218132581|ref|ZP_03461385.1| hypothetical protein BACPEC_00440 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992307|gb|EEC58310.1| hypothetical protein BACPEC_00440 [Bacteroides pectinophilus ATCC
           43243]
          Length = 444

 Score = 42.7 bits (99), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 18/163 (11%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG--QSVP------LSEEML 223
           V+ R   ++  + + +  L +   +G+S+ +A  ++A D     + +P      + EEM+
Sbjct: 284 VRLRNKQLQYDYTEIVSKLTLLTGAGMSVRRAWEKIALDYNNKMKDMPKEKYHAVYEEMM 343

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ ++    +  +A+  F  R  +   R     L Q+ R GT     L VL+ E  SE 
Sbjct: 344 TTLRQMQSGMSENIAYAEFGRRCGIKEYRKLGTLLEQNVRKGTR---GLSVLL-EQESEE 399

Query: 284 LMEAEKKAA-----SLGPKLTVPMIIFFLPVLILVIIGPAILS 321
             E  K  A       G KL +PMI+    V+++V++ PA++S
Sbjct: 400 AFEQRKNLAKQLGEEAGTKLLLPMILMLAVVMVIVMV-PAMMS 441


>gi|134291850|ref|YP_001115619.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135039|gb|ABO59364.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 325

 Score = 42.7 bits (99), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           AV+ +     C P+++++   ++R   ++R  PD  D++   + SG S   AL  V E+ 
Sbjct: 123 AVLPVALFAGCIPTLYVTRHRRRRMLKLERQLPDVCDMIARALRSGHSFTSALGMVGEEF 182

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA-LIQSDRYGT--SI 268
                P+S E  +T  E+++  +   A  N   R   + +R    A LIQ +  G    +
Sbjct: 183 ---PEPMSGEFRITFDEINYGVSLHDALVNLATRVPANDLRYFVIAVLIQRETGGNLAEL 239

Query: 269 GDSLRVLVSE 278
            DS+  LV E
Sbjct: 240 LDSIAALVRE 249


>gi|297627214|ref|YP_003688977.1| hypothetical protein PFREUD_20690 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296922979|emb|CBL57561.1| Hypothetical membrane protein [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 247

 Score = 42.7 bits (99), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 71/156 (45%), Gaps = 10/156 (6%)

Query: 169 SNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI-A 227
           S   + R+ ++    P+ LDL+    E+G      LRR A ++   +   S  +L  + A
Sbjct: 94  SGATRARREALLGQQPEVLDLIAAAQEAG----SPLRRAAGEVAALAPEPSASVLREVDA 149

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNAT-QALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            L    +   A+++  +    D V  +T + L +S R G ++ D++ +  + TR      
Sbjct: 150 HLRVGFSEAEAWQSLAD----DPVWGSTARDLARSARTGEAVADTIHLHATRTREAHRDH 205

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             KKA ++  K   PM+  FLP  IL  + P  + I
Sbjct: 206 LNKKARTVAVKSVGPMMACFLPAFILAGVVPIFVGI 241


>gi|187921508|ref|YP_001890540.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719946|gb|ACD21169.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 282

 Score = 42.7 bits (99), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 83/194 (42%), Gaps = 29/194 (14%)

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPII-FLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           VN+ RAA +   + + +        PII FL+ G I I     LL  P            
Sbjct: 51  VNRQRAAAWSMVFMIGL--------PIIAFLLTGSILI----ALLAVP------------ 86

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
            +    P  +++ + +KR  ++++  PDAL ++   + +G S   AL  V  +    + P
Sbjct: 87  -IAMTLPKKYLARMRKKRIGTLEKQLPDALLMMSGALRAGASFPSALEAVVHE---TTPP 142

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +S+E  L + E+    +  +A  N   R  +      T A+  +   G ++ ++L  +  
Sbjct: 143 ISQEFDLLMREIRLGIDMDIAMRNVEKRIPIPDFLMMTAAVTIAREVGGNLAEALESVAR 202

Query: 278 ETRSERLMEAEKKA 291
             R +  ME + KA
Sbjct: 203 TLREKLQMEGKIKA 216


>gi|312136703|ref|YP_004004040.1| type ii secretion system f domain protein [Methanothermus fervidus
           DSM 2088]
 gi|311224422|gb|ADP77278.1| Type II secretion system F domain protein [Methanothermus fervidus
           DSM 2088]
          Length = 355

 Score = 42.7 bits (99), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R   I R  P AL  +   + +G+    A++ VA    G    LSEE   T+ E+ +  +
Sbjct: 174 RADEISRELPYALRQMATELRAGLGFHDAMKSVATSGYGA---LSEEFARTLEEIKYGES 230

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
              A  N   R     ++ A Q +++S   G  +  +L ++  +   E  M    K    
Sbjct: 231 TTRALMNLSVRVPSPGLKRAIQQIVRSLESGGDVAKALEIIAEDIAYELRM----KFRDY 286

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSII 323
             KL   M+I+    + + I+GPA+L I+
Sbjct: 287 SQKLNSFMMIY----MFIGIVGPAVLPIL 311


>gi|298345274|ref|YP_003717961.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
 gi|298235335|gb|ADI66467.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
          Length = 303

 Score = 42.7 bits (99), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 21/172 (12%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE---DIGGQSV 216
           G   P   ++   ++RQ S+ +  PD ++LL + V +G  +  AL RV+    D+ GQ +
Sbjct: 142 GLLVPDYRLTGAARRRQLSLNQELPDVIELLALAVGAGEPLYGALHRVSARCTDVAGQEL 201

Query: 217 PLSEEMLLTIAEL--SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
               E +L  A+   S  P+   A      R   + + +   A++ +   G+ +   LR 
Sbjct: 202 ----EKILAAADNGDSLAPSLTAA----RARNDSEILAHLIDAIVSALERGSPLAGVLRS 253

Query: 275 LVSET----RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            V+++    R++ L E  KK       + VP++   LP+ ++  + P ++++
Sbjct: 254 QVADSRAVARTQLLTEGGKKEV----LMMVPVVFLILPLTVVFALYPGLVAL 301


>gi|166033071|ref|ZP_02235900.1| hypothetical protein DORFOR_02793 [Dorea formicigenerans ATCC
           27755]
 gi|166027428|gb|EDR46185.1| hypothetical protein DORFOR_02793 [Dorea formicigenerans ATCC
           27755]
          Length = 397

 Score = 42.7 bits (99), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 7/156 (4%)

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ-----SVPLSEEMLLTIA 227
           Q RQ  +   +P+ +  L + + +G+++ +A  ++  D   +        + EEM  T  
Sbjct: 241 QARQKQMCLDYPEVISKLTLLLGAGMTVRKAWIKIVNDYDSRIKQQGKRAVYEEMKYTCR 300

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLME 286
           ++         +E F  R            L Q+ R GT  + D LR+   ++  ER   
Sbjct: 301 QMDGGVPEAECYEKFGRRCGTQEYMRFGALLSQNLRKGTKGLNDLLRLEAIQSFEERKAR 360

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           A +     G KL +PM +    VL++V++ PA  ++
Sbjct: 361 ARRLGEEAGTKLLLPMFLMLAEVLVIVVV-PAFFTV 395


>gi|302037433|ref|YP_003797755.1| pilus assembly protein TadB [Candidatus Nitrospira defluvii]
 gi|300605497|emb|CBK41830.1| Pilus assembly protein TadB [Candidatus Nitrospira defluvii]
          Length = 313

 Score = 42.7 bits (99), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 85/185 (45%), Gaps = 9/185 (4%)

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G    L +   L + A+++I  VG  A   ++S     R++  +R  PDALD++   + +
Sbjct: 96  GASVALAFVDALGMPAMLVIATVGSVATPAYLSWRAAARRAHFQRQLPDALDMMARSLRA 155

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR-NAT 255
           G +    ++ VAE+      P+  E    + E++F  +   A +    R     +    T
Sbjct: 156 GHAFLAGMKIVAEEF---PAPIGAEFRSVVEEVAFGVSVTEALQRLTARVDSPALNFFVT 212

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL---IL 312
             LIQ +  G ++ + L  +   TR    + A+ +A S   +L+  +I+F LP     +L
Sbjct: 213 SVLIQRES-GGNLAEILNTISRMTRKRFELAAKVRAVSAEGRLSA-VILFALPFALGGLL 270

Query: 313 VIIGP 317
           +II P
Sbjct: 271 LIINP 275


>gi|184200572|ref|YP_001854779.1| hypothetical protein KRH_09260 [Kocuria rhizophila DC2201]
 gi|183580802|dbj|BAG29273.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 314

 Score = 42.7 bits (99), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 152 AVILIGYVGFCAPSVWISN-----LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
           A++ +G V      VW+ N      +++R+  +   +P   +L+ + V +G S   AL R
Sbjct: 138 AIVAVGVVLGAGCGVWLRNNLLSRSIRRREKLMVAEFPAIAELMALAVGAGESTVGALER 197

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V     G+   LS E    +A+         A ++F  RT +  +      ++ +   GT
Sbjct: 198 VCRVAEGE---LSGEFRAVLAQTRAGSGLTTALQDFSARTDVVALGRFVDGIVVAIERGT 254

Query: 267 SIGDSLRVLVSETRSER---LME-AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            + + LR    + R      LME A KK  ++     VP++ F LP+ +   + P  L++
Sbjct: 255 PLAEVLRAQAQDVRDHDKRVLMEVAGKKEIAM----LVPVVFFILPLSVAFAVFPG-LAV 309

Query: 323 ID 324
           +D
Sbjct: 310 LD 311


>gi|304315118|ref|YP_003850265.1| hypothetical protein MTBMA_c13650 [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588577|gb|ADL58952.1| putative membrane protein [Methanothermobacter marburgensis str.
           Marburg]
          Length = 313

 Score = 42.7 bits (99), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 83/175 (47%), Gaps = 15/175 (8%)

Query: 153 VILIGYVGFCAPSV----WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
           VIL   VGF  PS+    +I  ++++R  +I+++ PD L  +   + +G+ ++ AL  V+
Sbjct: 69  VILAVIVGFFMPSILLGAYIFVMMERRVDAIEQSTPDFLRQIASLLRAGVGLESALEDVS 128

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +   G   PL +E+   + E+        A  +   R +   +    + +++  R G S+
Sbjct: 129 KQGEG---PLYDELKRAVIEIKIGRTFDDAILSMSERLKSQNLDRTFRMILEGRRAGGSL 185

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            D +  +  + R+   ++ E+KA        V M + FL ++  +I  P  L +I
Sbjct: 186 SDVIETVAEDLRAVLALKRERKA-------NVMMSVMFL-IVAAIIAAPFALGMI 232


>gi|86739494|ref|YP_479894.1| type II secretion system protein [Frankia sp. CcI3]
 gi|86566356|gb|ABD10165.1| type II secretion system protein [Frankia sp. CcI3]
          Length = 316

 Score = 42.7 bits (99), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 75/174 (43%), Gaps = 10/174 (5%)

Query: 152 AVILIGYVG-FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
           A+I+ G  G   A   W+S  + +R+  +   +P   +LL + V +G S   AL RV+  
Sbjct: 143 ALIVAGTAGGVVARDYWLSRAISEREDRMLLEFPTIAELLALAVTAGESAIGALERVSRL 202

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
             G+   L  E+ L +A+         A E    RT +  +      +  +   GT + D
Sbjct: 203 THGE---LGRELRLALADARAGATLVQALEGIAARTALAPLVRFVDGMAVAIERGTPLAD 259

Query: 271 SLRVLVSETRS---ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            LR    + R     +L+EA  +       + +P++   LP  ++    PA++S
Sbjct: 260 ILRAQAVDAREAGKRQLLEAGGRKEI---AMMIPVVFLVLPTTVIFAFYPALVS 310


>gi|315655694|ref|ZP_07908592.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
 gi|315489758|gb|EFU79385.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
          Length = 303

 Score = 42.7 bits (99), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 114/257 (44%), Gaps = 42/257 (16%)

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
           S S  +  ++L+L  +  D   V + R +  R   SL +L VV          L II  +
Sbjct: 76  SPSKESVERRLDLAGLPKD---VCEFRRSQLRWAASLGMLAVV----------LSIIGFW 122

Query: 137 GYDKLLEYPFQLRVGAVILIGYV--GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           G  + L  P       V+L  +V  G   P   ++   ++RQ  + +  PD ++LL + V
Sbjct: 123 G--RTLPIPGAF----VMLTCFVLAGLLVPDYRLTGAARRRQLRLNQELPDVIELLALAV 176

Query: 195 ESGISIDQALRRVAE---DIGGQSVPLSEEMLLTIAEL--SFLPNRQVAFENFYNRTQMD 249
            +G  +  AL RV+    D+ GQ +    E +L  A+   S  P+   A      R   +
Sbjct: 177 GAGEPLYGALHRVSARCTDVAGQEL----EKILAAADNGDSLAPSLTAA----RARNDSE 228

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSET----RSERLMEAEKKAASLGPKLTVPMIIF 305
            + +   A++ +   G+ +   LR  V+++    R++ L E  KK       + VP++  
Sbjct: 229 ILAHLIDAIVSALERGSPLASVLRSQVADSRAVARTQLLTEGGKKEV----LMMVPVVFL 284

Query: 306 FLPVLILVIIGPAILSI 322
            LP+ ++  + P ++++
Sbjct: 285 ILPLTVVFAMYPGLVAL 301


>gi|152981972|ref|YP_001355002.1| Flp pilus assembly protein TadC [Janthinobacterium sp. Marseille]
 gi|151282049|gb|ABR90459.1| Flp pilus assembly protein TadC [Janthinobacterium sp. Marseille]
          Length = 317

 Score = 42.7 bits (99), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 68/131 (51%), Gaps = 2/131 (1%)

Query: 197 GISIDQALRRVAEDIGGQSVP-LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           G+SIDQ+L  V E+    S+P L +E+ +   +      R+ +   F +  + + +    
Sbjct: 181 GMSIDQSLH-VVENEFSTSLPVLGKELQIAAQQYQNGRTREQSLRRFSSLFENEDMSAVA 239

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           + ++Q DRYG ++   L+      R +R ++ ++K   L  K+T  M++  LP L+++  
Sbjct: 240 RLIVQVDRYGGAVQQPLQQFSDRLREQRKLDMKEKVGKLTVKMTGVMVLALLPALLIITG 299

Query: 316 GPAILSIIDTM 326
           G   L+II T+
Sbjct: 300 GAGFLAIIRTL 310


>gi|308176986|ref|YP_003916392.1| type II secretion system protein F [Arthrobacter arilaitensis
           Re117]
 gi|307744449|emb|CBT75421.1| putative type II secretion system protein F [Arthrobacter
           arilaitensis Re117]
          Length = 313

 Score = 42.4 bits (98), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 68/163 (41%), Gaps = 3/163 (1%)

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
           G +G+     W+   + +R   I   +P   ++L + V +G S   A+ R++    G   
Sbjct: 147 GIIGYAMRGWWLGEQINRRARKILTQFPTVAEVLALTVGAGESTTGAIERISRICHGV-- 204

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            + +E   T+ ++        A ++  +R Q+  +     A++ +   GT +   LR   
Sbjct: 205 -IGDEFTKTLNDIHAGTPMVQAMQHMSDRMQVGAMTRFVDAIVVATERGTPLAQVLRDQA 263

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            + R     E  + A      + VP++   LP+ I+  + P +
Sbjct: 264 QDVRDASKRELMEVAGKREISMLVPVVFGILPLTIVFAVFPGL 306


>gi|148261009|ref|YP_001235136.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|326404409|ref|YP_004284491.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|146402690|gb|ABQ31217.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|325051271|dbj|BAJ81609.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 319

 Score = 42.4 bits (98), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 7/153 (4%)

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
           +R +++   +PDAL  ++ CV  GI + +ALR V++D+     P S E      +++   
Sbjct: 138 RRATALLNQFPDALATIVRCVRVGIPVQEALRVVSQDM---PAPTSREFGRIADQVAIGT 194

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
             ++A     +R  +        A+    RYG  +  +L  L    R    M+A   A +
Sbjct: 195 PLELALRQMADRAHLAEYGFFATAISLQARYGGGLAQTLEGLAEVIRKRVAMKARGYALA 254

Query: 294 LGPKLTVPMIIFFLPV---LILVIIGPAILSII 323
              + T  +I+  +P+   L + +I PA L ++
Sbjct: 255 SEAR-TSALILGIIPLVAALAIEVIQPAYLRVL 286


>gi|309777429|ref|ZP_07672387.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308914825|gb|EFP60607.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 201

 Score = 42.4 bits (98), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 80/165 (48%), Gaps = 8/165 (4%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           IL+ ++ F    + IS++++KR   I R  P  +  + + V +G+ + +A  +VA+    
Sbjct: 34  ILLEFLAFYYFQMQISDVMKKRDMEISRDLPSIISKITLLVNAGMVLREAWAQVAQT--- 90

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
               L +EM   + +++   +   A+ +F  R Q   VR     + Q+   G    D + 
Sbjct: 91  GDTTLYKEMQRAVEDMNNGMSEVDAYMDFSQRCQSAKVRKFISTVEQNVSKGNK--DLVA 148

Query: 274 VLVSETR---SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            L  +++   +E+     ++  +   K+ +P+ I F+ +LI+VI+
Sbjct: 149 YLKEQSQIAWTEKKEYVRQQGETASSKMLIPIGIMFVGILIMVIV 193


>gi|302864942|ref|YP_003833579.1| Type II secretion system F domain-containing protein
           [Micromonospora aurantiaca ATCC 27029]
 gi|302567801|gb|ADL44003.1| Type II secretion system F domain [Micromonospora aurantiaca ATCC
           27029]
          Length = 242

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           +D+++  VAE +GG   PL++ +      L    +   A+ +    T  + V     A +
Sbjct: 121 VDRSVLAVAEALGG---PLADRLGRVGRTLRLGGSPGEAWAHLEGVTGAEPV---AAAAV 174

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           +S   G ++  +L  L  + R+ER   AE  A   G  + +P+ + FLP  IL  + P I
Sbjct: 175 RSSNSGAALARALTRLADDLRAERSTSAEAAARRAGVLIVLPLGLCFLPAFILAGLVPVI 234

Query: 320 LSIID 324
           ++++ 
Sbjct: 235 VAVLG 239


>gi|319943384|ref|ZP_08017666.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
 gi|319743199|gb|EFV95604.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
          Length = 291

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 3/123 (2%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           PS+ I +L  +R+    R  PDA+ L+   V +G S+  ALR++A ++     P  +E  
Sbjct: 101 PSLLIRHLGAQRRKLFARQLPDAMMLIAGAVRAGASMTLALRQMASEL---PAPGGQEFE 157

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           L + EL        A  N   R   D +R    A+  ++  G ++ ++L  L    R + 
Sbjct: 158 LMLRELRLGVTLDDALLNLERRMGCDDLRLFGAAVRIANESGGNLAETLERLADTIRKKM 217

Query: 284 LME 286
            +E
Sbjct: 218 ALE 220


>gi|163733538|ref|ZP_02140981.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393326|gb|EDQ17652.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
          Length = 320

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 92/205 (44%), Gaps = 7/205 (3%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +I  +L ++   G     E    +R+  ++ IG +G  A   W+S+   KR + I+   P
Sbjct: 94  MIMGVLAVVAFLGLSVGTESSLPVRI--MMSIG-IGVGAVYFWVSSKANKRLAMIEEQLP 150

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DA++L++  +  G     A++ V++++     PL+ EM +   E ++  +   A +    
Sbjct: 151 DAVELMVRSLRVGHPFSSAVQIVSKEV---QDPLASEMGVIADESAYGRDVGDALKEMAE 207

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  M  +R    A+      G ++ + L  L    R+   +    KA +   K +   + 
Sbjct: 208 RLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVKAITAEAKWSGKFLS 267

Query: 305 FFLPVLILVIIGPAILSIIDTMKDH 329
            F PV+ L++I     +  D ++DH
Sbjct: 268 AF-PVVALIVINVGDPNYYDAVRDH 291


>gi|116671217|ref|YP_832150.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611326|gb|ABK04050.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 313

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 68/163 (41%), Gaps = 3/163 (1%)

Query: 160 GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLS 219
           GF      + + +++R+  +   +P   +L+ + V +G S   AL RV     G+   L+
Sbjct: 150 GFLFRDYCLGSQIKRREKLMMAEFPSLAELMALAVSAGESATGALDRVCRSSHGE---LA 206

Query: 220 EEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
            E  L + E         A + F  RT +  +      +I +   GT + D LR    + 
Sbjct: 207 REFELVLGETRAGKPLVEALQRFSARTDLGPLVRFVDGIIVAVERGTPLADVLRAQAQDV 266

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R     +  + A      + VP++   LP+ ++  + P + +I
Sbjct: 267 RDTAKRDLMESAGKKEIAMMVPLVFGVLPLTVIFAVFPGLAAI 309


>gi|91772494|ref|YP_565186.1| type II secretion system protein [Methanococcoides burtonii DSM
           6242]
 gi|91711509|gb|ABE51436.1| type II secretion system protein F domain [Methanococcoides
           burtonii DSM 6242]
          Length = 716

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 85/189 (44%), Gaps = 28/189 (14%)

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL----IGYVG-------FC 162
           N L  + + +PI  L+L I            PF   +G+++     IG++        F 
Sbjct: 436 NPLYSLAVTIPIAILVLVI------------PFWSNIGSLVTTAQKIGFIDDYIVLALFI 483

Query: 163 A--PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           A  P      ++ +++  ++R +PD L  L    E+G+++  +++ +A+   G    L  
Sbjct: 484 AIVPMALFHEIMSRKKKHLERNFPDFLKKLASTNETGMTLRDSIKLMAKSKSGH---LGN 540

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E+ +  A++S+  N   +   F NR +   +  +   + +++     +G+ L V   +  
Sbjct: 541 EIRMIWADISWGMNVNDSLIRFANRLRTQVIARSLTLITKANESSGDVGEVLLVAARDAA 600

Query: 281 SERLMEAEK 289
           SE+ M+ E+
Sbjct: 601 SEQSMKRER 609


>gi|254506705|ref|ZP_05118845.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
 gi|219550286|gb|EED27271.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
          Length = 322

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 126/291 (43%), Gaps = 31/291 (10%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           DAT   + +  AV   S   A+++P+ GS    K++     E +    ++  SL ++   
Sbjct: 4   DATLFYILLFFAVVFIS--QALILPAAGSKAKHKQLSQRLKESQAKLDEEARSLLQEHYM 61

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII-FL 128
             L   D    R  VK      + +  ++   +  +G+  ++SL   L V L++ +  FL
Sbjct: 62  KSLTPMD----RRLVK------VPLFSSLKKTIELSGY--DWSLGQTLAVTLILSVCAFL 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I+          LL  PF + + A + I ++ +     W++  +  R +S +   P+ALD
Sbjct: 110 IV---------LLLGQPFYIGLAASVGIWFILY----FWLNKRISDRLASFEEQLPEALD 156

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   +++G  + QA   V  ++     P+  E   T   L+F  + ++A      RT  
Sbjct: 157 IMRRMLQAGQPVTQAFNEVGNEMPD---PIGTEFKNTFNLLNFGYDMRMAIMQMAERTPT 213

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
             +   + A++     G ++ ++L  +    RS   ++ + K  S   +L+
Sbjct: 214 VSMLAFSSAVLLQKETGGNLSENLEKVSKVLRSRFKLQRKIKTLSAESRLS 264


>gi|114705451|ref|ZP_01438359.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540236|gb|EAU43356.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 335

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 85/179 (47%), Gaps = 21/179 (11%)

Query: 146 FQLRVGAVILIGYV-GFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
           F L + A + I  V G   P  ++SN  +KR +    ++P A+DL++  V++G+ ++  L
Sbjct: 126 FGLPILATLGIAVVAGLGLPRAFLSNRRKKRINDFSNSFPTAIDLIVRGVKAGLPLNDTL 185

Query: 205 RRVAEDIGG------QSVPLSEEMLLTIAELSFLPNRQVAF--ENFYNRTQMDCVRNATQ 256
           R V  D+        Q V  +++M +T+ +      +QV     NF+          A  
Sbjct: 186 RTVVSDVPDPVSSEFQKVVEAQQMGVTLGDACDRLYKQVPLPETNFF----------AIV 235

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             IQS + G ++ ++L  L    R  + M  + +A S+  K +   II  +PVL+  +I
Sbjct: 236 IAIQS-QAGGNLSEALGNLSRVLRERKKMRQKIQAVSMEAKASAS-IIGSIPVLVASMI 292


>gi|87199098|ref|YP_496355.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134779|gb|ABD25521.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 324

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 79/177 (44%), Gaps = 18/177 (10%)

Query: 148 LRVGAVIL-IG---YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
           LR GA +L +G   ++G   P + +   + KR  +     PDALDLL+  + SG+ + + 
Sbjct: 114 LRTGAPLLALGSGIFIGGGLPHMLVGRAINKRIDNFVTRLPDALDLLVRGLRSGLPVTET 173

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD-----CVRNATQAL 258
           L  VA ++ G   P+ EE  L    +      + A ++  +R  +      C+  A Q  
Sbjct: 174 LGVVAAELPG---PVGEEFKLVTDRIKVGRTMEEALQDTADRLNLPEFNFFCITLAIQ-- 228

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
                 G ++ ++L  L    R    M+ + KA S   K +   I+  LP ++  +I
Sbjct: 229 ---RETGGNLAETLSNLSDVLRKRAQMKLKIKAMSSESKASA-YIVGALPFIVFALI 281


>gi|315501227|ref|YP_004080114.1| type ii secretion system f domain protein [Micromonospora sp. L5]
 gi|315407846|gb|ADU05963.1| Type II secretion system F domain protein [Micromonospora sp. L5]
          Length = 242

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           +D+++  VAE +GG   PL++ +      L    +   A+ +    T  + V     A +
Sbjct: 121 VDRSVLAVAEALGG---PLADRLGRVGRTLRLGGSPGEAWAHLEGVTGAEPV---VAAAV 174

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           +S   G ++  +L  L  + R+ER   AE  A   G  + +P+ + FLP  IL  + P I
Sbjct: 175 RSSNSGAALARALTRLADDLRAERSTSAEAAARRAGVLIVLPLGLCFLPAFILAGLVPVI 234

Query: 320 LSIID 324
           ++++ 
Sbjct: 235 VAVLG 239


>gi|260439392|ref|ZP_05793208.1| putative bacterial type II secretion system protein F domain
           protein [Butyrivibrio crossotus DSM 2876]
 gi|292808188|gb|EFF67393.1| putative bacterial type II secretion system protein F domain
           protein [Butyrivibrio crossotus DSM 2876]
          Length = 388

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 12/195 (6%)

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           +I+     K+L Y F + +    LI Y     P +      +KR   +   +P+ +  L 
Sbjct: 200 VIFYEKKKKILPYFFAMFLIIAFLIYYYKIYNPKIT----KEKRDKLLIADYPELVSKLS 255

Query: 192 ICVESGISIDQALRRVAEDI--GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + + +G+S   A  ++ ED    G++ P  E +   +  +S       A+  F  R  + 
Sbjct: 256 LLMGAGMSTYNAFIKITEDYRKTGKTKPAYELLSECLNRISSGITETDAYMEFGKRCNVM 315

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETR---SERLMEAEKKAASLGPKLTVPMIIFF 306
           C       L Q+   GT   +  ++L  ET     +R   A+K     G KL +PM +  
Sbjct: 316 CYIKLGNLLAQNISKGTD--NIFQLLKEETEKAFEDRKALAKKLGEEAGTKLLLPMTMML 373

Query: 307 LPVLILVIIGPAILS 321
             VLI+++I PA +S
Sbjct: 374 SVVLIIIVI-PAFMS 387


>gi|255324192|ref|ZP_05365314.1| putative membrane protein [Corynebacterium tuberculostearicum
           SK141]
 gi|255298708|gb|EET78003.1| putative membrane protein [Corynebacterium tuberculostearicum
           SK141]
          Length = 198

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 66/137 (48%), Gaps = 8/137 (5%)

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP-NRQVAFENFYNR 245
           ++L   C+ +G+S+  A   VA     Q+    +E+  T+A L  +    Q A+ +  + 
Sbjct: 64  VELFAACLAAGLSVHGATTAVARTADAQT----KELWETVAALLGVGVPAQSAWGHMKSH 119

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             ++   +  Q +I S + G +I    + + +  R+E    A  +A   G  + +P+ + 
Sbjct: 120 AGLE---DLAQLVIMSGQSGATIAAGCQRICTSLRAEASAHATAQAERAGVFIALPLAVC 176

Query: 306 FLPVLILVIIGPAILSI 322
           FLP  I++ + P ++S+
Sbjct: 177 FLPAFIVLGLAPVVISL 193


>gi|329847257|ref|ZP_08262285.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842320|gb|EGF91889.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 337

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 79/180 (43%), Gaps = 17/180 (9%)

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY-VGFCAPSVWISNLVQ 173
           +L VV  VVP++ L              +  F LR+   +  G+ + + AP   +  +  
Sbjct: 110 VLGVVAFVVPLVLLG-------------KMDFMLRLLVALGAGFALSYGAPRWVLGMMAT 156

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            R       +P+A+D+L+  ++SG+ +   L+ ++++      PL  E L  +  +    
Sbjct: 157 GRLKKFTEEFPNAMDILVRGIKSGLPVHDGLKIISKE---SPAPLGPEFLRLVENVGVGM 213

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           + + A E    R     +R  T  +    + G ++ ++L  L +  R+ ++M  + KA S
Sbjct: 214 SVEGALEKMSERIPSPELRFFTIVIAIQAKTGGNLAEALNNLSTVLRARKMMREKIKALS 273


>gi|77919351|ref|YP_357166.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
 gi|77545434|gb|ABA88996.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
          Length = 325

 Score = 41.6 bits (96), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 71/162 (43%), Gaps = 15/162 (9%)

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
           K + Y F + +   ILI    FC P  ++        +  +   P+ALDLL   + SG +
Sbjct: 116 KFIPYTF-ITIALAILI----FCLPFAYLKLAENTYHARFQDQLPEALDLLARALRSGHA 170

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR-NATQAL 258
           +   L  VA ++     P+S E    + E++     Q AFEN   R     +R  A   +
Sbjct: 171 MTSGLEMVAAEM---DPPISSEFGAAVDEINLGLTFQEAFENLCERVPSTDLRFFAISVI 227

Query: 259 IQSDRYGT--SIGDSLRVLVSE----TRSERLMEAEKKAASL 294
           IQ +  G    I DS+  L+ E     R  + + AE + +++
Sbjct: 228 IQRETGGNVAEILDSISRLIRERIQFKRQVKALTAEGRLSAM 269


>gi|311741045|ref|ZP_07714870.1| membrane protein [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311303847|gb|EFQ79925.1| membrane protein [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 198

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP-NRQVAFENFYNR 245
           ++L   C+ +G+S+  A   VA     Q+    +E+  T+A L  +    Q A+ +    
Sbjct: 64  VELFAACLAAGLSVHGATTAVARTADAQT----KELWETVAALLGVGVPAQSAWGHMKGH 119

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             ++   +  Q +I S + G +I      + +  R+E    A  +A   G  + +P+ + 
Sbjct: 120 AGLE---DLAQLVIMSGQSGATIAAGCHRICTSLRAEASAHATAQAERAGVFIALPLAVC 176

Query: 306 FLPVLILVIIGPAILSI 322
           FLP  I++ + P ++S+
Sbjct: 177 FLPAFIVLGLAPVVISL 193


>gi|110679392|ref|YP_682399.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455508|gb|ABG31713.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 320

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 77/171 (45%), Gaps = 4/171 (2%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G  A   W+S+   KR + I+   PDA++L++  +  G     A++ V++++     PL
Sbjct: 125 IGVGAVYFWVSSKANKRLAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVSKEV---QDPL 181

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + EM +   E ++  +   A +    R  M  +R    A+      G ++ + L  L   
Sbjct: 182 ASEMGVIADESAYGRDVGDALKEMAERLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKV 241

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            R+   +    KA +   K +   +  F PV+ L++I     +  D ++DH
Sbjct: 242 IRARFRLFRRVKAITAEAKWSGKFLSAF-PVVALIVINVGDPNYYDAVRDH 291


>gi|239629080|ref|ZP_04672111.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239519226|gb|EEQ59092.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 418

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 76/157 (48%), Gaps = 9/157 (5%)

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI-----GGQSVP--LSEEMLLTI 226
           KR+  +   + + L  L+I + +G+SI  A  +VA D       G+  P    +EM  T 
Sbjct: 262 KRKHQLLLDYSEVLSRLIIFLGAGMSIRTAWDKVAFDYQKLVDDGKQKPRYAYQEMYETS 321

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLM 285
            ++        AF +F  R  +      +  L Q+ + G+ ++ D+L+V ++E   +R  
Sbjct: 322 CQMRGGVPEGRAFMDFGRRCGLQQYMKLSSLLEQNRKNGSKNLRDTLKVEMAEAFEQRKH 381

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +A +     G KL +P+ +  L V+++VI  PA++  
Sbjct: 382 QARRLGEEAGTKLLLPLFM-MLSVVMVVIAVPALMEF 417


>gi|289192868|ref|YP_003458809.1| Type II secretion system F domain protein [Methanocaldococcus sp.
           FS406-22]
 gi|288939318|gb|ADC70073.1| Type II secretion system F domain protein [Methanocaldococcus sp.
           FS406-22]
          Length = 299

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 67/130 (51%), Gaps = 21/130 (16%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI +G   F  PS+   N ++  +++I    P AL ++++ +ESG SI++AL  V +   
Sbjct: 62  VIYVGAALFI-PSILYENKIETLENNI----PQALYIMILALESGRSINEALLEVVKSNI 116

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFE-------NFYNRTQMDCVRNATQALIQSDRYG 265
            +   +  ++L        + N++++FE       N Y+      +R   + +I++ +YG
Sbjct: 117 KEVSDIFRKVLY------LMENQKLSFEESMTIVSNLYDS---KVLRMLARIMIENRKYG 167

Query: 266 TSIGDSLRVL 275
             + DSL++L
Sbjct: 168 GDLADSLKIL 177


>gi|292491526|ref|YP_003526965.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580121|gb|ADE14578.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 323

 Score = 41.2 bits (95), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 14/136 (10%)

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           ++W+     LL +          L+ +V F  P + I     KR    +   P+ALD++ 
Sbjct: 111 LVWVLARSPLLGF----------LVAFVSFIFPILRIRIERDKRIGKFEEQLPEALDIMS 160

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT-QMDC 250
             +++G    + L   +E++     PL++E   T A++++  N + AF +   R   M  
Sbjct: 161 RAMKAGYPFVETLHVASEEMRD---PLAKEFRTTFADINYGMNIKTAFLSLLQRVPSMSL 217

Query: 251 VRNATQALIQSDRYGT 266
           +   T  L+Q D  G 
Sbjct: 218 MAVVTGVLVQRDTGGN 233


>gi|302381752|ref|YP_003817575.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192380|gb|ADK99951.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 326

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 76/171 (44%), Gaps = 9/171 (5%)

Query: 159 VGFCAPSVWISNLVQKRQ-SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           VG   P  W+   + KR+       + +A+D+++  ++SG+ +    + +A +      P
Sbjct: 131 VGLGLPR-WVVGFIGKRRLKKFSLEFANAVDVIVRGIKSGLPVHDCFKIIARE---SPAP 186

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +  E    +  L        A E  Y R     +R  T  +    + G ++G++L  L +
Sbjct: 187 VGPEFQTLVEGLGVGLTLGQALEKMYERIPTPELRFFTIVIAIQQKTGGNLGEALSNLTT 246

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG---PAILSIIDT 325
             R+ R+M  + KA S     +   II  LP +++ ++G   PA + ++ T
Sbjct: 247 VLRARRMMGEKIKALSSEATASAG-IIGSLPPVVMTLVGLTTPAYMGLMFT 296


>gi|163745842|ref|ZP_02153201.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161380587|gb|EDQ04997.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 320

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 4/171 (2%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G  A   W+S+   KR S I+   PDA++L++  +  G     A+  V+++I     PL
Sbjct: 125 MGVGAVFFWVSHKAGKRMSMIEEQLPDAVELMVRSLRVGHPFSNAISIVSKEI---QDPL 181

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E  +   E ++  +   A ++   R  M  +R    A+    + G ++ + L  L   
Sbjct: 182 ASEFGVIADEAAYGRDLGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKV 241

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            R+   +    KA +   K +   +  F P+  LV+I        D ++DH
Sbjct: 242 IRARFRLFRRVKAITAEAKWSGKFLSGF-PLAALVVINLGDPHYYDEVRDH 291


>gi|319788659|ref|YP_004148134.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467171|gb|ADV28903.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 282

 Score = 41.2 bits (95), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 4/142 (2%)

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           L ++R   I+   PDAL +L   + +G+    A+  + +D  GQ  PL++E+ L + +  
Sbjct: 99  LRRRRLDRIQEQLPDALQMLASSLRAGVGFSPAMEVLVQD--GQP-PLAQELALVLRQQH 155

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
                  A E+F  R  +        A+  S   G ++ ++L  L    R   +ME + K
Sbjct: 156 MGVRADEALESFSKRVPIVDAELFVSAVNISREVGGNLAETLATLAETLRRRLIMEKKVK 215

Query: 291 AASLGPKLTVPMIIFFLPVLIL 312
           A +   KL   +++  LPV ++
Sbjct: 216 ALTAQGKLQ-GIVMALLPVFLV 236


>gi|127511577|ref|YP_001092774.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636872|gb|ABO22515.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 283

 Score = 41.2 bits (95), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 69/145 (47%), Gaps = 4/145 (2%)

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
           L ++R+       PDAL+++   ++SG ++  A+  +AE++     P+ +E  L + E  
Sbjct: 100 LHKRRRRKFVHQLPDALNMIASSMQSGANVSNAIEFMAEEM---EAPIKQEFQLFLREQR 156

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
                  A +N + R   +  +  T  +  S   G ++ + L+ L +  R +  ME +  
Sbjct: 157 LGVEFNTALDNMFKRIPEEEFQLVTAGMQISREVGGNLAEVLQRLSATLRKKIEMEGKID 216

Query: 291 AASLGPKLTVPMIIFFLPVLILVII 315
           A +   K+   +++  LPV I V++
Sbjct: 217 ALTSQGKMQ-GIVMTLLPVFIGVVL 240


>gi|221195413|ref|ZP_03568468.1| putative type II secretion system protein [Atopobium rimae ATCC
           49626]
 gi|221184600|gb|EEE16992.1| putative type II secretion system protein [Atopobium rimae ATCC
           49626]
          Length = 248

 Score = 40.8 bits (94), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 68/149 (45%), Gaps = 8/149 (5%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           +  ++++I +  P  LD+L + + SG+S D +L        G    LSE+M  + A LS+
Sbjct: 96  IAHQRNAIIKEMPRMLDVLTLGLSSGLSFDSSLDLYCNRCSGV---LSEKM--SQALLSW 150

Query: 232 ---LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAE 288
                 R  A E       +  + +    + +S  +GT + DSL       R ++    E
Sbjct: 151 QMGATTRSTALEEIAAEYGITSLLSFASVVTESLAFGTPLSDSLERQAGTIRDDQRAALE 210

Query: 289 KKAASLGPKLTVPMIIFFLPVLILVIIGP 317
            +   +  K+ +P+    +P +++ I+GP
Sbjct: 211 AEIEKVPVKMLLPLGTLIVPAMLIAILGP 239


>gi|14590540|ref|NP_142608.1| hypothetical protein PH0653 [Pyrococcus horikoshii OT3]
 gi|3257061|dbj|BAA29744.1| 358aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 358

 Score = 40.8 bits (94), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 76/162 (46%), Gaps = 15/162 (9%)

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE-DIGGQSV 216
           Y+ F   SVW     ++R   +++A P  L  +   + +GI + +A+  V++ D G    
Sbjct: 166 YMRFYPKSVW-----KRRVEEVEKALPYVLRHMASLLNAGIGLAEAMVSVSKADYG---- 216

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            +SEE  + + E+    + + A   F  + + D V    + ++++ ++G ++ D L  + 
Sbjct: 217 VVSEEFAMVVQEMHKGSSFEDALTKFEEKMKSDMVSRVVKQILRALKFGGNLADILYKMA 276

Query: 277 SETRSE---RLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            E   E   +LM+  +K    G       +   +P L++V+I
Sbjct: 277 DEFSFEYRIKLMDYVQKIN--GISFVYMFMTVVMPTLLIVVI 316


>gi|303248307|ref|ZP_07334569.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490332|gb|EFL50244.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 326

 Score = 40.8 bits (94), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF  P  WI+    KR +  +R  P+ALDL+   + +G +    +  V  +    + P+
Sbjct: 132 LGFL-PFKWIAMRKAKRMTEFERQLPEALDLVGRALRAGHTFTSGMGMVVSEF---AEPI 187

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           S E   T+ E++F     VA +N  +R  +DC
Sbjct: 188 SSEFRTTLEEINFGMGVTVALDNLMDR--VDC 217


>gi|111220778|ref|YP_711572.1| hypothetical protein FRAAL1321 [Frankia alni ACN14a]
 gi|111148310|emb|CAJ59982.1| putative membrane protein [Frankia alni ACN14a]
          Length = 316

 Score = 40.8 bits (94), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 68/158 (43%), Gaps = 9/158 (5%)

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W++  + +R+  +   +P   +LL + V +G S   AL RV+    G+   L  E+ L +
Sbjct: 159 WLTRAIGEREDRMLLEFPTVAELLALAVTAGESAIGALERVSRLTHGE---LGRELRLAL 215

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL---VSETRSER 283
           A+         A E    RT +  +      +  +   GT + D LR     V E    +
Sbjct: 216 ADARAGATLVQALEGIAARTALAPLTRFVDGMAVAIERGTPLADILRAQAMDVREAGKRQ 275

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           L+EA  +       + +P++   LP  ++    PA++S
Sbjct: 276 LLEAGGRKEI---AMMIPVVFLVLPTTVIFAFYPALVS 310


>gi|15668960|ref|NP_247764.1| hypothetical protein MJ_0779 [Methanocaldococcus jannaschii DSM
           2661]
 gi|2833584|sp|Q58189|Y779_METJA RecName: Full=Uncharacterized protein MJ0779
 gi|1499599|gb|AAB98769.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
           2661]
          Length = 299

 Score = 40.8 bits (94), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 68/130 (52%), Gaps = 21/130 (16%)

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           VI +G   F  PS+   N ++  +++I    P AL ++++ +ESG SI++AL  V +   
Sbjct: 62  VIYVGAALFI-PSILYENKIETLENNI----PQALYIMILALESGRSINEALLEVVKS-- 114

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFE-------NFYNRTQMDCVRNATQALIQSDRYG 265
             ++    ++   +  L  + N++++FE       N Y+      +R   + +I++ +YG
Sbjct: 115 --NIKEVSDIFRKV--LYLMENQKLSFEESMTIVSNLYDS---KVLRMLARIMIENRKYG 167

Query: 266 TSIGDSLRVL 275
             + DSL++L
Sbjct: 168 GDLSDSLKIL 177


>gi|84489944|ref|YP_448176.1| hypothetical protein Msp_1152 [Methanosphaera stadtmanae DSM 3091]
 gi|84373263|gb|ABC57533.1| conserved hypothetical membrane-spanning protein [Methanosphaera
           stadtmanae DSM 3091]
          Length = 307

 Score = 40.8 bits (94), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 67/143 (46%), Gaps = 7/143 (4%)

Query: 154 ILIGYVGFCAPSV----WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           I+I  +    PSV    +IS   + R+ +I+   PD L+ +   +  G+  + AL  +++
Sbjct: 67  IIISVLFLFLPSVIMIIYISYNREHRKENIEEQLPDYLNQIASLLNVGLGFESALEELSK 126

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
              G   PL+ E+   + E  F      +  +  NR  +D +R   Q +I +   G ++ 
Sbjct: 127 TSKG---PLNNEIKQLLIETQFKKPFNESLMDIANRNDLDNLRYIFQIIIHTRESGGNLA 183

Query: 270 DSLRVLVSETRSERLMEAEKKAA 292
           + L  +  + +   L++ +++A+
Sbjct: 184 EVLEDISHDLKEIILLKKQRRAS 206


>gi|325964625|ref|YP_004242531.1| type II secretion system protein F [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470712|gb|ADX74397.1| type II secretion system protein F [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 204

 Score = 40.8 bits (94), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%)

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           R ER   AEK+AASLG KL VP+ +  LP  I + + P +L+++ +
Sbjct: 158 RRERFRAAEKRAASLGVKLVVPLGLCSLPAFICLGVVPVLLALVPS 203


>gi|20094142|ref|NP_613989.1| hypothetical protein MK0705 [Methanopyrus kandleri AV19]
 gi|19887149|gb|AAM01919.1| Predicted membrane protein [Methanopyrus kandleri AV19]
          Length = 325

 Score = 40.8 bits (94), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 5/137 (3%)

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R   I+   PDAL  ++  + +G+SI + +R VAE   G+   LS E  + + ++     
Sbjct: 102 RIKDIEENLPDALRQMVEELRAGLSIFETIRNVAESDYGE---LSREFRIVVRDMDTGKT 158

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
            + A  +   R   + +  A +  ++    G ++ D L  + ++ R  R +E E+KA + 
Sbjct: 159 FEEAILDMAERVNSELLTRAVRLTVRISMSGGALADVLEAVENDIREVRRIELERKAITT 218

Query: 295 GPKLTVPM--IIFFLPV 309
            P L + +  +I  LPV
Sbjct: 219 MPCLALALGGLISGLPV 235


>gi|332671124|ref|YP_004454132.1| Type II secretion system F domain-containing protein [Cellulomonas
           fimi ATCC 484]
 gi|332340162|gb|AEE46745.1| Type II secretion system F domain protein [Cellulomonas fimi ATCC
           484]
          Length = 310

 Score = 40.8 bits (94), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 14/160 (8%)

Query: 167 W-ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           W +   V +R+S + +  P   +LL + V +G     AL RV     G+   L+ E+  T
Sbjct: 153 WALGRQVAQRESRMLQEMPTVAELLALAVGAGEGATGALERVVRSTRGE---LTAELERT 209

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE--- 282
           +A+         A +   +RT +  +    + +  +   GT + + LR    + R E   
Sbjct: 210 LADARAGAPLTAALDGLADRTGLAALARFAEGVAVAVERGTPLAEVLRAQAQDVREEVRR 269

Query: 283 RLME--AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
            LME    K+ A     + VP++   LPV +   + P++L
Sbjct: 270 DLMETGGRKEVA-----MMVPVVFLILPVTVAFAVFPSLL 304


>gi|225174957|ref|ZP_03728954.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169597|gb|EEG78394.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 322

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 78/167 (46%), Gaps = 7/167 (4%)

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           +L+  +GF AP +++     +R  ++    P+AL+++   + +G S  QA+  V  ++  
Sbjct: 122 VLVAVIGFKAPGIYVDVAKGRRMQALNNQLPEALNIISSGLRAGYSFPQAMAVVGREM-- 179

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
              P+++E    + +     +   A      RT  + +     +L+   + G ++ + L 
Sbjct: 180 -DAPIADEFNRVLRDNRLGKSMDDALLEMTARTDNEDLDLVVTSLLIQRQVGGNMAEVLN 238

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV---LILVIIGP 317
            +    R    ++ E +A +   +++  +II  LP+   L+L++I P
Sbjct: 239 KIEHTIRERMRIKGEIRALTAQQRMS-AVIIVLLPIAVALLLLVINP 284


>gi|90412172|ref|ZP_01220178.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
 gi|90326896|gb|EAS43281.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
          Length = 302

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +GF     W   L++KRQ+  ++A+PDAL++++  V +G S+ Q++  V + +  +   L
Sbjct: 110 LGFLWGWAW---LIKKRQNEFEQAFPDALNIMMSAVTAGESVMQSISYVGKTLDNKVGDL 166

Query: 219 SEEM--LLTIAELSFLPNRQV---AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
            ++M   L + E    P  QV   A +++   T +  V      + +  +    +   +R
Sbjct: 167 FQDMGERLKLGE----PPEQVFKRASKHYPYPTFLFFVVTIRANMSRGGQLKAVMARLIR 222

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           VLV     ++   A    A L  K+   +   F+  +IL  I P  L+ + T
Sbjct: 223 VLVDSRTLDKKKSAMTSEARLSAKIVASLPFIFM--VILSFISPQNLNYVLT 272


>gi|260892928|ref|YP_003239025.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260865069|gb|ACX52175.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 313

 Score = 40.4 bits (93), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 62/128 (48%), Gaps = 3/128 (2%)

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P +++ +L ++R +  +   PDAL L+   + +G  + QA+  V  ++     P+S+E  
Sbjct: 123 PFLYLRHLRRQRLARFQSQLPDALSLMANTMRAGFGMLQAMDVVRREM---PPPISQEFG 179

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+AEL      + A E   +R   D +  A  A+I   + G ++ + L  + +  R   
Sbjct: 180 RTLAELGLGMGVEEALERLSHRVPSDDLDLAVTAVIIQRQVGGNLAEILDNIATTIRERV 239

Query: 284 LMEAEKKA 291
            ++ E +A
Sbjct: 240 RLKGEIRA 247


>gi|163751751|ref|ZP_02158969.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
 gi|161328403|gb|EDP99562.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
          Length = 325

 Score = 40.4 bits (93), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 69/145 (47%), Gaps = 6/145 (4%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
             KR  +I+ ++PD LD++   +++G S   A++   E++ G   PL++E  L    +++
Sbjct: 143 TNKRMDTIEASFPDGLDVIRRALQAGYSFTDAIKLATEELEG---PLAKEFKLMFVNINY 199

Query: 232 LPNRQVAFENFYNRT-QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
             + ++A   F  R   +  +  A+  ++Q +  G ++ +++  L    R         K
Sbjct: 200 TKDIKLALLGFIQRVPSVSALAFASAVMVQRET-GGNLAENIENLTRVIRQRFKFRRRVK 258

Query: 291 AASLGPKLTVPMIIFFLPVLILVII 315
             S   +L+  ++I  LP  +  +I
Sbjct: 259 TLSAEGRLSAWILI-LLPFALFAVI 282


>gi|77456872|ref|YP_346377.1| type II secretion system protein [Pseudomonas fluorescens Pf0-1]
 gi|77380875|gb|ABA72388.1| putative type II secretion system protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 83/171 (48%), Gaps = 22/171 (12%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV-P 217
           +G+  P   ++    +RQ  +       + LL I  E+G++++QALR ++ +  GQ++ P
Sbjct: 127 IGYLLPKRLLAMAAGRRQKQLATEISTFIPLLRILFEAGMAVEQALRVLSHE--GQTLLP 184

Query: 218 -LSEEMLLTIA------ELSFLPN---RQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            L++E+ L +A      EL    N   R +A + F +     CV              + 
Sbjct: 185 VLTQELRLVLARVDSGLELGEELNKATRLLAVDEFTD----TCVILQQLLQQGGGAMKSL 240

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           +  +L+ L+ + R  RL E   K ++   K++V M++F  P L++V+ GP 
Sbjct: 241 L--ALKQLLDDRRLTRLQEYISKMSA---KMSVVMMMFLFPALLIVLAGPG 286


>gi|110636325|ref|YP_676533.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287309|gb|ABG65368.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 337

 Score = 40.4 bits (93), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 153/320 (47%), Gaps = 52/320 (16%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVA---VEREILRKQQITSLQKDSAS 69
           LA  +  A S   L Y ++  ++ S  ++E+R+++V    +E  ++R        +D A+
Sbjct: 9   LAFVVLAACSAGGLAYVLMFNTIASEKKVERRLETVKRAQIEGNVVRAA------RDRAA 62

Query: 70  SRLRTRDS--KSLRNF-VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
              + R S  +SL++   ++ +    L    +  ++R AG   E S+    ++  VV ++
Sbjct: 63  EIAKRRRSIQESLKDIETRQKDQDRFLKRPPLKIQIRQAGL--EMSMERFYILSAVVGLL 120

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
           F+I  + +I G       P  L V   ++ G+  F AP   I+ L ++R  +    +P+A
Sbjct: 121 FVI--VTFIAGA------PL-LAVAGAMVAGF--FGAPRWIIAYLRRRRVQAFLNEFPNA 169

Query: 187 LDLLLICVESGISIDQALRRVA----EDIGGQSVPL--SEEMLLTIAELSF-----LPNR 235
           LD+++  V+SG+ ++ A+R +A    E +  +   L  ++++ L +AE +      +P  
Sbjct: 170 LDIIVRAVKSGLPLNDAVRMIAVEAQEPVRTEFRRLVEAQQLGLPMAEAAMRMSETMPCP 229

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           +V F     + Q     N ++AL          G+  RVL    R  + ++A  +A S+ 
Sbjct: 230 EVNFFGIVLQIQSQAGGNLSEAL----------GNLSRVL----RERKKIKARVQALSME 275

Query: 296 PKLTVPMIIFFLPVLILVII 315
            K +  +II  LP+++  ++
Sbjct: 276 AKASA-VIIGALPIVVAALV 294


>gi|255263835|ref|ZP_05343177.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255106170|gb|EET48844.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 322

 Score = 40.4 bits (93), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 6/134 (4%)

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           +R G  +L+G  G     +W++N  +KR + I+   PDA++L++  +  G     A+  V
Sbjct: 119 IRAGVSLLMGVGGVF---IWVNNKAKKRLALIEEQLPDAVELMVRSLRVGHPFTSAVAIV 175

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A+++     PL  EM +   E ++  +   A +    R +M  +R    A+    + G +
Sbjct: 176 AKEV---PDPLGSEMGVISDEAAYGRDVGEALKAMAERLEMQDMRFLAVAVTIQQQAGGN 232

Query: 268 IGDSLRVLVSETRS 281
           + + L  L    R+
Sbjct: 233 LAEILHGLAQVIRA 246


>gi|210614117|ref|ZP_03290053.1| hypothetical protein CLONEX_02266 [Clostridium nexile DSM 1787]
 gi|210150818|gb|EEA81826.1| hypothetical protein CLONEX_02266 [Clostridium nexile DSM 1787]
          Length = 430

 Score = 40.4 bits (93), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 64/154 (41%), Gaps = 7/154 (4%)

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE-----EMLLTIAEL 229
           R+  +   +P+ ++   + + +G++      R+ ++   Q +   E     EM  T  E+
Sbjct: 276 RKEQMLTDYPEIINKFALLLSTGMTTKNVWERIVKNYEEQKICTGERAAYEEMRYTCNEM 335

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT-SIGDSLRVLVSETRSERLMEAE 288
                   A+E F  R  +         L Q+ + GT  + D LR    +    R   A+
Sbjct: 336 QSGITEAEAYERFGKRCGISVYMKFGALLAQNLKKGTKGMTDLLRNESDQAFENRKSRAK 395

Query: 289 KKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +     G KL  PM      VL++VI+ PA LS+
Sbjct: 396 RLGEEAGTKLLAPMFGMLAIVLVIVIV-PAFLSM 428


>gi|170720030|ref|YP_001747718.1| type II secretion system protein [Pseudomonas putida W619]
 gi|169758033|gb|ACA71349.1| type II secretion system protein [Pseudomonas putida W619]
          Length = 295

 Score = 40.4 bits (93), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 106/229 (46%), Gaps = 35/229 (15%)

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIW---IFGYD--KLLEYPFQLRVGAVILIGYVG 160
           G+R      +   ++L +P++ +IL +I      G D    L +P    +GA  L+    
Sbjct: 76  GWRRSRQRALFAAMQLGLPLVAVILTLILQQAALGSDGTHWLVWPL-FALGASYLL---- 130

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV--PL 218
              P   ++   ++RQ  I       + LL I  E+G++++QALR ++++  GQ++   +
Sbjct: 131 ---PKRLLAVAARRRQQRIALEVSLMIPLLRILFETGLAVEQALRVLSQE--GQALLPEI 185

Query: 219 SEEMLLTI----AELSFLPN-----RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           SEE+   +    + L+  P      R +A + F +     CV    Q L+Q    G+   
Sbjct: 186 SEELRQVLQRVDSGLALGPELEKSARVLAVDEFID----TCV-ILQQLLVQ----GSGAM 236

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
            SL  L       RL   +++ + +  K++  M++F  P L++V+ GP 
Sbjct: 237 KSLLALKDLLDDRRLTRMQERVSKMSAKMSAVMMVFLFPALLIVLAGPG 285


>gi|258650978|ref|YP_003200134.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
 gi|258554203|gb|ACV77145.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
          Length = 267

 Score = 40.4 bits (93), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 70/148 (47%), Gaps = 9/148 (6%)

Query: 188 DLLLICVESGISIDQALRRVAEDIG--GQSVPLSEEMLLTI----AELSFLPNRQVAFEN 241
           +LL   ++SG+++  ALR V+E +G  G S    +  L  +    A L+   +   A+  
Sbjct: 123 ELLAAALDSGLAMATALRAVSEVLGDQGPSAGQQQSALAALDSVAAMLALGADTDTAWRA 182

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
                 +  +  A +   +S   GT++ D++R   ++ R +   E+ + A   G  +T P
Sbjct: 183 VDADADLAPLAAAAR---RSAVGGTTLADAVREHAAQLREQARDESVRSAGRAGVLMTAP 239

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMKDH 329
           + + FLP  + + + P +L ++  +  H
Sbjct: 240 LGVCFLPAFLCLGLAPVVLGLLGRLTIH 267


>gi|104779904|ref|YP_606402.1| type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
 gi|95108891|emb|CAK13587.1| putative type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
          Length = 295

 Score = 40.0 bits (92), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVP-LSEEMLLTI----AELSFLPNRQVAFENFY 243
           LL I  E+G++++QALR +A++ G   VP +S+E+ L +    + L+  P  + +     
Sbjct: 156 LLRILFETGLAVEQALRVLAQE-GRSLVPNISDELRLVLQRVDSGLALGPELEKSARLLA 214

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
               +D      Q L+Q    G+    SL  L       RL   +++ + +  K++  M+
Sbjct: 215 VDELIDTCVILQQLLVQ----GSGSMKSLLALKELLDDRRLTGLQERVSKMSAKMSAVMM 270

Query: 304 IFFLPVLILVIIGPA 318
           +F  P L++V+ GP 
Sbjct: 271 VFLFPALLIVLAGPG 285


>gi|82703470|ref|YP_413036.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411535|gb|ABB75644.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 323

 Score = 40.0 bits (92), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 85/187 (45%), Gaps = 9/187 (4%)

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
           LL  PF +     +L G  G   P  +  +  +KR   I+R  P+ +DL+   +++G + 
Sbjct: 114 LLGLPFAV----TLLCGATGSVLPLFFTLSAKRKRLEKIERQLPEVIDLMARALKAGHAF 169

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
             AL+  + D      P ++E  LT  E++F  + Q A  N   R  +  +R    A++ 
Sbjct: 170 SGALQMASTD---GPEPAADEFRLTFDEINFGVSVQDALMNLATRVPITDLRYFVIAVLI 226

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFLPVLILVIIGPA 318
               G ++ + L  +    R+   +  + +  S   +L+  ++  + F   L++ ++ P 
Sbjct: 227 QRESGGNLAELLDKISGLIRARLTLLGKIRVLSAEGRLSAWILSCLPFATALMINLVNPG 286

Query: 319 ILSIIDT 325
            L+++ T
Sbjct: 287 FLTVLWT 293


>gi|83859361|ref|ZP_00952882.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852808|gb|EAP90661.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 331

 Score = 40.0 bits (92), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 73/150 (48%), Gaps = 5/150 (3%)

Query: 167 WISNLVQK-RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           W+  +++K RQ      + DALD+++  V+SG+ +++ L+ +A++      P+ +E  L 
Sbjct: 143 WVLGMMRKGRQKKFTENFADALDIIVRGVKSGLPLNETLKIIAQE---GEAPVKQEFQLL 199

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           +  L+   + +      + R  +  +   T  L    + G ++ ++L  L +  R+ ++M
Sbjct: 200 VEGLAVGVDVEEGMRRMHRRMPLPELSFFTTVLAIQQKTGGNLAEALNNLSAVLRARKMM 259

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             +  A S   K +   II  LP  + V++
Sbjct: 260 REKVSALSSEAKASA-WIIGSLPPGVGVMV 288


>gi|289706419|ref|ZP_06502777.1| type II secretion system F domain protein [Micrococcus luteus SK58]
 gi|289556914|gb|EFD50247.1| type II secretion system F domain protein [Micrococcus luteus SK58]
          Length = 313

 Score = 40.0 bits (92), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P   +L  + V +G S   AL R+A    G+   L+ E  +T+A++    +   A +   
Sbjct: 174 PSVAELFALSVGAGESAAGALERIAGTARGE---LAGEFRVTLADMRAGASLSAALKAMG 230

Query: 244 NRTQMDCV-RNATQALIQSDRYGTSIGDSLRVLVSETRS---ERLMEAEKKAASLGPKLT 299
            R Q+  V R     LI  DR GT + D LR    + R      LMEA  +      ++ 
Sbjct: 231 RRVQLAPVERFIGGVLIALDR-GTPLADVLRAQAQDVREMGRRELMEAAGRKEI---QMM 286

Query: 300 VPMIIFFLPVLILVIIGPAI 319
           VP++   LP+ ++  + P I
Sbjct: 287 VPLVFGILPLTVIFAVFPGI 306


>gi|320095978|ref|ZP_08027592.1| hypothetical protein HMPREF9005_2204 [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977085|gb|EFW08814.1| hypothetical protein HMPREF9005_2204 [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 178

 Score = 40.0 bits (92), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 20/179 (11%)

Query: 153 VILIG-YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA--- 208
           V L+G  VG  A    ++     RQ  ++ A PDA +LL + V +G S+  AL RVA   
Sbjct: 7   VALLGCVVGMSAWDRLLTARADSRQRRVEAAVPDASELLALAVGAGESVPAALDRVASLS 66

Query: 209 -EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
             D+G       +E+   +A++        A  +   R     +    Q L  +   G+ 
Sbjct: 67  HSDLG-------DELARAVADIRLGAPSVRALTDLAARNDSPALSRLCQTLSTAIGRGSP 119

Query: 268 IG----DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           +     D  R  + E   +RLME   K       +  P++   LPV +L  + P ++++
Sbjct: 120 LAAVLHDQARD-IREASRQRLMEEGGKREI---AMLFPVVFLILPVTVLFALYPGLMAL 174


>gi|315606116|ref|ZP_07881147.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312398|gb|EFU60484.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 298

 Score = 40.0 bits (92), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 66/151 (43%), Gaps = 3/151 (1%)

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            ++RQ +I  A PD  +LL + V +G SI  A+ RVA   GG   PL  E+ LT A +  
Sbjct: 147 ARRRQRAIDAAVPDCAELLALAVAAGESIPAAIERVAGCAGG---PLGSELALTSAHIRN 203

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                 A      RT    +   ++ L  +   G+ +   L     + R   L    ++ 
Sbjct: 204 GTPSVRALAELVERTDSPSLTRLSRTLTTAIERGSPLASVLHDQARDQRERSLASLMEEG 263

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
                 + +P++   LPV ++  + P ++++
Sbjct: 264 GRREIAMLLPVVFLILPVTVMFALYPGLIAL 294


>gi|257790323|ref|YP_003180929.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|317489772|ref|ZP_07948271.1| hypothetical protein HMPREF1023_01970 [Eggerthella sp. 1_3_56FAA]
 gi|325830267|ref|ZP_08163724.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
 gi|257474220|gb|ACV54540.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|316911118|gb|EFV32728.1| hypothetical protein HMPREF1023_01970 [Eggerthella sp. 1_3_56FAA]
 gi|325487734|gb|EGC90172.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
          Length = 306

 Score = 40.0 bits (92), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           AL  +   V S +++++ALR  A  +     PL EE+   +A+ ++     +AFE    R
Sbjct: 135 ALPQIAASVRSSLTLERALRTAASHV---EDPLREELARVLADTAYGTTLAMAFERMARR 191

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T    VR+   A+    R+G ++   L ++ +   +      E K    G +L    +  
Sbjct: 192 TDSPDVRSLAAAVRIQQRFGGAVAPVLDLIAAHAAARLRTSRELKTELAGTRLAKWFVAL 251

Query: 306 FLPVLILVIIG 316
            +P +  ++  
Sbjct: 252 AMPAIFFIMFA 262


>gi|289424541|ref|ZP_06426324.1| type II secretion system F domain protein [Propionibacterium acnes
           SK187]
 gi|289428815|ref|ZP_06430495.1| type II secretion system F domain protein [Propionibacterium acnes
           J165]
 gi|295129802|ref|YP_003580465.1| type II secretion system F domain protein [Propionibacterium acnes
           SK137]
 gi|289155238|gb|EFD03920.1| type II secretion system F domain protein [Propionibacterium acnes
           SK187]
 gi|289157816|gb|EFD06039.1| type II secretion system F domain protein [Propionibacterium acnes
           J165]
 gi|291377230|gb|ADE01085.1| type II secretion system F domain protein [Propionibacterium acnes
           SK137]
 gi|313814294|gb|EFS52008.1| type II secretion system F domain protein [Propionibacterium acnes
           HL025PA1]
 gi|313834346|gb|EFS72060.1| type II secretion system F domain protein [Propionibacterium acnes
           HL056PA1]
 gi|314974780|gb|EFT18875.1| type II secretion system F domain protein [Propionibacterium acnes
           HL053PA1]
 gi|314980264|gb|EFT24358.1| type II secretion system F domain protein [Propionibacterium acnes
           HL072PA2]
 gi|314985439|gb|EFT29531.1| type II secretion system F domain protein [Propionibacterium acnes
           HL005PA1]
 gi|314987403|gb|EFT31494.1| type II secretion system F domain protein [Propionibacterium acnes
           HL005PA2]
 gi|315082165|gb|EFT54141.1| type II secretion system F domain protein [Propionibacterium acnes
           HL078PA1]
 gi|315086398|gb|EFT58374.1| type II secretion system F domain protein [Propionibacterium acnes
           HL002PA3]
 gi|315097273|gb|EFT69249.1| type II secretion system F domain protein [Propionibacterium acnes
           HL038PA1]
 gi|315106264|gb|EFT78240.1| type II secretion system F domain protein [Propionibacterium acnes
           HL030PA1]
 gi|327445234|gb|EGE91888.1| type II secretion system F domain protein [Propionibacterium acnes
           HL013PA2]
 gi|327447319|gb|EGE93973.1| type II secretion system F domain protein [Propionibacterium acnes
           HL043PA1]
 gi|328758434|gb|EGF72050.1| type II secretion system F domain protein [Propionibacterium acnes
           HL020PA1]
 gi|332674641|gb|AEE71457.1| hypothetical protein PAZ_c02540 [Propionibacterium acnes 266]
          Length = 249

 Score = 40.0 bits (92), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 18/188 (9%)

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ---KRQSSIKRA--WPDALDLLLICVES 196
           + +PF    G  +L+G V +     W S  ++    R+    RA   P+AL +L   +E+
Sbjct: 70  VPWPFPAAAGLSVLVGTVMW-----WGSGRLESSGHRRMEQHRAAQLPEALLMLSSAMEA 124

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF-LPNRQVAFENFYNRTQMDCVRNAT 255
           G+ +  A+  VAE + G   P +E++    + L+  +P+ +     + +   ++  R+  
Sbjct: 125 GLPLRSAVTTVAESLEG---PCAEDLRRLASSLAAGVPDSRA----WNDLASVEVWRDPA 177

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           Q + ++   G  I + L    ++ +     + EKKA   G     P++   LP  +LV +
Sbjct: 178 QDVSRAVDSGEGISELLSAHAAQLQVAAAEKTEKKARKAGVDAIGPLVCCHLPAFLLVGV 237

Query: 316 GPAILSII 323
            P I  ++
Sbjct: 238 VPIIAGMV 245


>gi|313793203|gb|EFS41270.1| type II secretion system F domain protein [Propionibacterium acnes
           HL110PA1]
 gi|313802708|gb|EFS43926.1| type II secretion system F domain protein [Propionibacterium acnes
           HL110PA2]
 gi|314964615|gb|EFT08715.1| type II secretion system F domain protein [Propionibacterium acnes
           HL082PA1]
 gi|315078730|gb|EFT50756.1| type II secretion system F domain protein [Propionibacterium acnes
           HL053PA2]
 gi|327457152|gb|EGF03807.1| type II secretion system F domain protein [Propionibacterium acnes
           HL092PA1]
          Length = 249

 Score = 40.0 bits (92), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 18/188 (9%)

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ---KRQSSIKRA--WPDALDLLLICVES 196
           + +PF    G  +L+G V +     W S  ++    R+    RA   P+AL +L   +E+
Sbjct: 70  VPWPFPAAAGLSVLVGTVMW-----WGSGRLESSGHRRMEQHRAAQLPEALLMLSSAMEA 124

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF-LPNRQVAFENFYNRTQMDCVRNAT 255
           G+ +  A+  VAE + G   P +E++    + L+  +P+ +     + +   ++  R+  
Sbjct: 125 GLPLRSAVTTVAESLEG---PCAEDLRRLASSLAAGVPDSRA----WNDLASVEVWRDPA 177

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           Q + ++   G  I + L    ++ +     + EKKA   G     P++   LP  +LV +
Sbjct: 178 QDVSRAVDSGEGISELLSAHAAQLQVAAAEKTEKKARKAGVDAIGPLVCCHLPAFLLVGV 237

Query: 316 GPAILSII 323
            P I  ++
Sbjct: 238 VPIIAGMV 245


>gi|220913900|ref|YP_002489209.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860778|gb|ACL41120.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 200

 Score = 40.0 bits (92), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 280 RSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           R ER   AEK+AASLG KL +P+ +  LP  I + + P +L+++ +
Sbjct: 153 RRERFRAAEKRAASLGVKLVIPLGLCSLPAFICLGVVPVLLALVPS 198


>gi|152994351|ref|YP_001339186.1| type II secretion system protein [Marinomonas sp. MWYL1]
 gi|150835275|gb|ABR69251.1| type II secretion system protein [Marinomonas sp. MWYL1]
          Length = 329

 Score = 39.7 bits (91), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 5/134 (3%)

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           FCA  V   N + K     K+  P A+D ++    +G+ +  A   VAE++ G   PL++
Sbjct: 135 FCAVLVLYRNAMAKHLKEFKQNLPQAIDSIVRIARAGVPVSNAFNLVAENLPG---PLAK 191

Query: 221 EMLLTIAELSF-LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSET 279
           E  L    L   +P RQ A ++   R  ++  R     LI +   G  + D+L  L    
Sbjct: 192 EFSLVDKWLRLGVPLRQ-AMQDSAKRVPLNEYRFFVVILIINQEAGGRLSDTLERLAHTL 250

Query: 280 RSERLMEAEKKAAS 293
           R  + +  + +A +
Sbjct: 251 RERQELALKIRAKT 264


>gi|28493158|ref|NP_787319.1| hypothetical protein TWT191 [Tropheryma whipplei str. Twist]
 gi|28476198|gb|AAO44288.1| unknown [Tropheryma whipplei str. Twist]
          Length = 298

 Score = 39.7 bits (91), Expect = 0.56,   Method: Compositional matrix