BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780721|ref|YP_003065134.1| pilus component protein
[Candidatus Liberibacter asiaticus str. psy62]
         (329 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040398|gb|ACT57194.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 329

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI
Sbjct: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
           TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR
Sbjct: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK
Sbjct: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE
Sbjct: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV
Sbjct: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           PMIIFFLPVLILVIIGPAILSIIDTMKDH
Sbjct: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329


>gi|13474665|ref|NP_106234.1| hypothetical protein mlr5604 [Mesorhizobium loti MAFF303099]
 gi|14025420|dbj|BAB52020.1| mlr5604 [Mesorhizobium loti MAFF303099]
          Length = 339

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 148/324 (45%), Positives = 219/324 (67%), Gaps = 3/324 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            L +A+  A+++F+ ++ + +P+ G  +L+ RMKSVA+ER+ LR +Q 
Sbjct: 1   MTEQVIKSLTDPSLLIALLVAIAVFATVFTL-LPAFGGNQLKARMKSVALERDELRAKQR 59

Query: 61  TSLQ--KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             L    D     LR + S  +RN V +L+L+  L DE+ + KL+ AGFR +  L   L 
Sbjct: 60  ARLASEADRRRKGLREQQSVGMRNIVDRLDLRRALADESTLQKLKVAGFRGQNPLTRFLF 119

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            RLV+P +   LG+++IF    L + P  +R+   IL+ Y GF AP V+++N   KR+ S
Sbjct: 120 FRLVLPFVGFALGLVYIFVLGGLPDKPLVIRLFVCILVAYGGFYAPVVYVNNRATKRKQS 179

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+ AWPDALDL+LICVESG+S++ ALR+VA++IG QSV L+EE +LT AELS+L  R+ A
Sbjct: 180 IQMAWPDALDLMLICVESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLQERKQA 239

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           +EN  NRT ++ V++ +QAL+Q++RYGT +  +LRVL +E+R +R+  AEKKAA+L PKL
Sbjct: 240 YENLANRTGLESVKSVSQALVQAERYGTPVAHALRVLAAESRDQRMNAAEKKAAALPPKL 299

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           TVPMI+FFLPVL  +I+GPA + +
Sbjct: 300 TVPMILFFLPVLFAIILGPAGIQV 323


>gi|239833232|ref|ZP_04681561.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825499|gb|EEQ97067.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
          Length = 333

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 155/323 (47%), Positives = 213/323 (65%), Gaps = 1/323 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M           +  +     V++F+ +  +++P L    L+ RMKSVA ERE +R ++ 
Sbjct: 1   MFSLLTQKLSDPQFLIGALIMVAVFATVVTILLPVLSGSALKSRMKSVATEREAIRSRER 60

Query: 61  TSLQKDS-ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
             L  +S     LR +    +R FV+KL+LK  L DE  V  LR AGFR +  LNI L +
Sbjct: 61  ARLAAESDRRGSLRHQQKPGIREFVEKLDLKRALADEKTVASLRQAGFRGQNPLNIFLFL 120

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           R V+P   + +  I+IF    L +  F +R+   I  GY GF AP++++SN   KR+ SI
Sbjct: 121 RFVLPFGAMAIAAIYIFVLGVLADQTFFVRLLVCIFAGYAGFYAPNLYVSNRATKRKQSI 180

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +RAWPDALDL+LICVESG+S + A RRVA++IG QSV L+EE++LT AELSFLP R+ A+
Sbjct: 181 RRAWPDALDLMLICVESGMSTEAAFRRVADEIGIQSVELAEELMLTNAELSFLPERRQAY 240

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN  NRT ++ V++ TQALIQ++RYGT +  +LR L  E+R  RL+EAEKKAA+L PKLT
Sbjct: 241 ENLANRTGLEPVKSVTQALIQAERYGTPVAQALRTLSQESRDLRLLEAEKKAAALPPKLT 300

Query: 300 VPMIIFFLPVLILVIIGPAILSI 322
           VPMI+FFLPVL +VI+GPA + I
Sbjct: 301 VPMIVFFLPVLFIVILGPAFIQI 323


>gi|153008064|ref|YP_001369279.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559952|gb|ABS13450.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
          Length = 333

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 153/323 (47%), Positives = 216/323 (66%), Gaps = 1/323 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M           +  +     V++F+ +  +++P L    L+ RMKSVA ERE +R ++ 
Sbjct: 1   MFSLLTQKLTDPQFLIGALITVAVFATVVTILMPVLSGSALKSRMKSVATEREAIRSRER 60

Query: 61  TSLQKDS-ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
             L  +S   + LR +  + +R FV++L+LK  L DE  +  LR AGFR +  LNI L +
Sbjct: 61  ARLAAESDRRNSLRHQQKQGIREFVERLDLKRALADEKTIASLRQAGFRGQNPLNIFLFL 120

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           R V+P   +++  I+IF    L +  F +R+   I  GY GF AP++++SN   KR+ SI
Sbjct: 121 RFVLPFGAMLIAAIYIFMLGVLADQTFFVRLLVCIFAGYAGFYAPNLYVSNRATKRKQSI 180

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +RAWPDALDL+LICVESG+S + A RRVA++IG QSV L+EE++LT AELSFLP R+ A+
Sbjct: 181 RRAWPDALDLMLICVESGMSTEAAFRRVADEIGIQSVELAEELMLTNAELSFLPERRQAY 240

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           EN  NRT +D V++ TQALIQ++RYGT +  +LR L  E+R  RL++AEKKAA+L PKLT
Sbjct: 241 ENLANRTGLDPVKSVTQALIQAERYGTPVSQALRTLSQESRDLRLLDAEKKAAALPPKLT 300

Query: 300 VPMIIFFLPVLILVIIGPAILSI 322
           VPMI+FFLPVL +VI+GPA + I
Sbjct: 301 VPMIVFFLPVLFIVILGPAFIQI 323


>gi|209551764|ref|YP_002283681.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537520|gb|ACI57455.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 328

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 175/328 (53%), Positives = 237/328 (72%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + +P    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPSMLIALLVAIAVFATFYTIAVPFFERGDLNKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  ++ + +  LR+++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNTETGAGKASLRSQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L   W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLALAAFWVFGLGNLPERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA
Sbjct: 181 IKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVSDKF 328


>gi|328545274|ref|YP_004305383.1| hypothetical protein SL003B_3658 [polymorphum gilvum SL003B-26A1]
 gi|326415016|gb|ADZ72079.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 325

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 153/324 (47%), Positives = 220/324 (67%), Gaps = 3/324 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
           F     +++ +A+ T V++   ++ +V+P      L+ RMK+VA+ERE +R ++   L  
Sbjct: 3   FSDLANSQMVIAVLTMVAVAGTVFTLVMPVFERDGLKSRMKTVALEREKIRARERARLAT 62

Query: 66  DSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           +   +R  LR +  K ++N V KLNL+  L DEN  +KLR AG+R    L   L  R+V+
Sbjct: 63  EKGDTRVSLRNQPKKQVKNLVDKLNLRTALADENTQDKLRMAGYRGTGPLYTFLFARIVM 122

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P+I  ++ + ++F +      P   +V A + +G +G  AP+V+I N + KRQ SI+RAW
Sbjct: 123 PLILFVIALFYVFAFLPAT-LPSFTKVCAALFVGGIGVFAPNVYIQNRITKRQQSIRRAW 181

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDL+LICVESG+SI+ A R+VA++IG QS+PL+EE+ LT AELSFL  R+ A+ NF 
Sbjct: 182 PDALDLMLICVESGMSIEAAFRKVADEIGIQSIPLAEELTLTNAELSFLQERRQAYLNFA 241

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +D V+N T ALIQ++RYGT IG +LRV+  + R +R+ EAEKKAASL PKLTVPMI
Sbjct: 242 KRTGVDGVKNVTMALIQAERYGTPIGHALRVMADDNREQRMQEAEKKAASLPPKLTVPMI 301

Query: 304 IFFLPVLILVIIGPAILSIIDTMK 327
           +FFLPVL  VI+GPA++ II T +
Sbjct: 302 VFFLPVLFFVIMGPAVMQIIATFR 325


>gi|15887568|ref|NP_353249.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155105|gb|AAK86034.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 328

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 167/328 (50%), Positives = 232/328 (70%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M    F      +  +AI   +++F+ +Y +++P L   +L KRMK+V+ ERE++R ++ 
Sbjct: 1   MTGDLFSRLTDPQTIIAILVTLAVFATLYTLIMPFLERKDLAKRMKAVSSERELIRSRER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             L   +   R  LR  ++KS R  V+K NL+  L D+N +NKLRAAGFRS+ +LN  L 
Sbjct: 61  ERLATVTRDGRTSLRGNNNKSARRIVEKFNLREALADQNTMNKLRAAGFRSQNALNTFLA 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R V+P IFL +   W+F    L +  F +R+ AV++ GY+GF AP++++SN + KRQ+S
Sbjct: 121 ARFVLPFIFLAVAFTWVFVLGNLADKAFVVRLMAVLVFGYIGFYAPNIYVSNRMTKRQAS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LIC+ESG+S++ A+RRVAE++G QS  L+EEM+LT AELSFL +R+ A
Sbjct: 181 IKRAWPDALDLMLICIESGVSMESAMRRVAEEMGEQSPELAEEMILTTAELSFLQDRRTA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            ENF  RTQ+D V++  QALIQ++RYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENFGMRTQLDGVKSVVQALIQAERYGTPLAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMIIFFLPVLI VI+GPA + + DT 
Sbjct: 301 TVPMIIFFLPVLIAVILGPAGIRVADTF 328


>gi|222084474|ref|YP_002543003.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721922|gb|ACM25078.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 325

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 160/318 (50%), Positives = 229/318 (72%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + +A+  A+++F+  Y + +P L  G+L KRMK+V+ ERE +R ++   L  D +
Sbjct: 8   LTDPGMILAVFVAIAVFATFYTIAVPFLERGDLNKRMKAVSTEREQIRARERARLNTDGS 67

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            + LR++++K++R  V++ NL+  LVD N VN+LRAAG RSE +LN+ LV R ++P +FL
Sbjct: 68  KASLRSQNNKNVRQIVERFNLRNALVDTNTVNRLRAAGLRSENALNMFLVARFLLPFLFL 127

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            + +  +FG       PF  R+  VI   Y+GF +P+++ISN V KRQ SIKRAWPDALD
Sbjct: 128 AVAVFLVFGLGYFAAKPFAFRLLGVIGTAYLGFYSPNIYISNRVTKRQKSIKRAWPDALD 187

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+LICVESGISI+  +RRV+E++  QS  L+EEM+LT AELSFL +R+ AF+N   RTQ+
Sbjct: 188 LMLICVESGISIEAGMRRVSEEMAEQSPALAEEMVLTTAELSFLQDRRTAFDNLAARTQI 247

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V++ TQALIQ++RYGT +  +LRV+  E R ER+ EAEKKAA+L PKLTVPMI+FFLP
Sbjct: 248 EIVKSVTQALIQAERYGTPVSQALRVMAQEGRDERMNEAEKKAAALPPKLTVPMIVFFLP 307

Query: 309 VLILVIIGPAILSIIDTM 326
           VL+ VI+GPAI+ ++D  
Sbjct: 308 VLMAVILGPAIIQVMDKF 325


>gi|260461944|ref|ZP_05810189.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032191|gb|EEW33457.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 339

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 147/324 (45%), Positives = 217/324 (66%), Gaps = 3/324 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            L +A+  A+++F+ ++ + +P+    +L+ RMKSVA+ER+ LR +Q 
Sbjct: 1   MTDQVIKSLTDPSLLIALLVAIAVFATVFTL-LPAFSGNQLKSRMKSVALERDELRAKQR 59

Query: 61  TSLQ--KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             L    D     LR   S  +RN V +L+L+  L DE+ + KL+ AGFR +  L   L 
Sbjct: 60  ARLATEADRRRKGLREEQSVGMRNIVDRLDLRRALADESTLQKLKVAGFRGQNPLTRFLF 119

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            RLV+P + L L +++IF    L + P  +R+   IL+ Y GF AP V+++N   KR+ S
Sbjct: 120 FRLVLPFVGLALALVYIFVLGGLPDKPLVIRLFVCILVAYAGFYAPVVYVNNRATKRKQS 179

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+ AWPDALDL+LICVESG+S++ ALR+VA++IG QSV L+EE +LT AELS+L  R+ A
Sbjct: 180 IQMAWPDALDLMLICVESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLQERKQA 239

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           +EN  +RT ++ VR+ +QAL+Q++RYGT +  +LRVL +E+R +R+  AEKKAA+L PKL
Sbjct: 240 YENLASRTGLESVRSVSQALVQAERYGTPVAHALRVLAAESRDQRMNAAEKKAAALPPKL 299

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           TVPMI+FFLPVL  +I+GPA + +
Sbjct: 300 TVPMILFFLPVLFAIILGPAGIQV 323


>gi|241207162|ref|YP_002978258.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861052|gb|ACS58719.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 328

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 172/328 (52%), Positives = 235/328 (71%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPSMLIALFVAIAVFATFYTIAIPFFERGDLNKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  ++ + +  LR ++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNTETGAGKASLRNQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L  +W+FG   L E    +R+ AVI +GY+GF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLTLAAVWVFGLGNLAEKGTPIRLFAVIGVGYLGFYAPNIFISNRMGKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS  L+EEM+LT AELSFLP+R+ A
Sbjct: 181 IKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPALAEEMVLTTAELSFLPDRRAA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVADKF 328


>gi|116249986|ref|YP_765824.1| component of pilus protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254634|emb|CAK05708.1| putative component of pilus protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 328

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 171/328 (52%), Positives = 236/328 (71%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + +P    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPSMLIALLVAIAVFATFYTIAVPFFERGDLNKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  ++ + +  LR+++++S+R  V++ NL+  LVDEN +NKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNTETGAGKASLRSQNNRSVRQIVERFNLRKALVDENTINKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L   W+FG   L E    +R+ AVI +GY+GF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLALAAFWVFGLGNLAEKGTPIRLFAVIGVGYLGFYAPNIYISNRMGKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS  L+EEM+LT AELSFLP+R+VA
Sbjct: 181 IKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPALAEEMVLTTAELSFLPDRRVA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVADKF 328


>gi|319785603|ref|YP_004145079.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171491|gb|ADV15029.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 340

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 147/324 (45%), Positives = 213/324 (65%), Gaps = 3/324 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M              +A+  A+++F+ ++ + +P+ G  +L+ RMKSVA+ER+ LR QQ 
Sbjct: 1   MTEQVIKTLTDPSFLIAMLVAIAVFATVFTL-LPAFGGNQLKSRMKSVALERDELRAQQR 59

Query: 61  TSLQ--KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             L    D     LR   S  +RN V +L+L+  L DE  + KL+ AGFR +  L   L 
Sbjct: 60  ARLAVEADRRRKGLREEQSIGMRNIVDRLDLRRALADEGTLQKLKVAGFRGQNPLTRFLF 119

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            RLV+P +   L  I+IF    L + P  +R+   IL+ Y GF AP ++++N   KR+ S
Sbjct: 120 FRLVLPFVGFALAAIYIFVLGGLPDKPLVIRLFVCILVAYGGFYAPVIYVNNRATKRKQS 179

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+ AWPD LDL+LICVESG+S++ ALR+VA++IG QSV L+EE +LT AELS+LP R+ A
Sbjct: 180 IQMAWPDGLDLMLICVESGMSVEAALRKVADEIGAQSVALAEEFILTNAELSYLPERKQA 239

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           +EN  +RT +D V++ +QAL+Q++RYGT +  +LRVL +E+R  R+  AEKKAA+L PKL
Sbjct: 240 YENLASRTGLDSVKSVSQALVQAERYGTPVAHALRVLAAESRDMRMNAAEKKAAALPPKL 299

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           TVPMI+FFLPVL  +I+GPA + +
Sbjct: 300 TVPMILFFLPVLFAIILGPAGIQV 323


>gi|325291654|ref|YP_004277518.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059507|gb|ADY63198.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 328

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 162/328 (49%), Positives = 231/328 (70%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M    F      +  +AI   +++F+ +Y +++P     +  KRMK+V+ ER+++R ++ 
Sbjct: 1   MTGSLFSSLTDPQTIIAILVTLAVFATLYTLIMPLFERKDFAKRMKAVSSERDLIRSRER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             L   +   +  LR  ++KS R  V+K NL+  L D+N +NKLRAAGFRS+ +LN  L 
Sbjct: 61  ERLAAATRDGKASLRGNNNKSARRIVEKFNLQEALADKNTMNKLRAAGFRSQNALNTFLA 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R V+P +FL L   W+F    L +  F +R+ AV++ GY+GF AP++++SN + KRQ+S
Sbjct: 121 ARFVLPFVFLALAFTWVFVLGNLADKAFVVRLMAVLIFGYLGFYAPNIYVSNAMNKRQAS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+RAWPDALDL+LIC+ESG+S++ A+RRVAE++G QS  L+EEM+LT AELSFL +R++A
Sbjct: 181 IRRAWPDALDLMLICIESGVSMEAAMRRVAEEMGEQSPELAEEMMLTTAELSFLQDRRIA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            ENF  RTQ+D V++  QALIQ++RYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENFGMRTQLDGVKSVVQALIQAERYGTPLAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMIIFFLPVLI VI+GPA + + DT 
Sbjct: 301 TVPMIIFFLPVLIAVILGPAGIRVADTF 328


>gi|150398546|ref|YP_001329013.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150030061|gb|ABR62178.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 327

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 159/323 (49%), Positives = 227/323 (70%), Gaps = 2/323 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +      + VA+  ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  
Sbjct: 5   IETLTDPNIIVAVLVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNT 64

Query: 66  DSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           ++ + R  LRT+ + S+R  V++LNL+  LVD+N VN+L+ AGFRS+ +LN  L  R  +
Sbjct: 65  EAPTGRASLRTQHNSSVREVVERLNLRKALVDDNTVNRLKTAGFRSQNALNTFLFARFCL 124

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +FL + +++IF      + P  +RV   I   YVGF AP+++I+N + KRQ SI+RAW
Sbjct: 125 PFLFLTVSVLYIFVLGNFADKPVMVRVSFAIGFAYVGFYAPNIFIANAISKRQHSIRRAW 184

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLLLICVESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R+VA EN  
Sbjct: 185 PDALDLLLICVESGVSMELAMRRVADEIAVQSQPLAEELVLTTAELSFLPERRVALENLG 244

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT ++ V++  QALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI
Sbjct: 245 RRTGLEEVKSVMQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMI 304

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +FFLPVL+ VI+GPA + + D  
Sbjct: 305 LFFLPVLVAVILGPAGIQVADKF 327


>gi|190889886|ref|YP_001976428.1| pilus component protein [Rhizobium etli CIAT 652]
 gi|190695165|gb|ACE89250.1| pilus component protein [Rhizobium etli CIAT 652]
          Length = 328

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 176/328 (53%), Positives = 236/328 (71%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPGMLIAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  +  + +  LR+++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNANPGAGKASLRSQNNRSVRQIVERFNLRQALVDENTVNKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L   W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLALAAFWVFGLGNLAERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA
Sbjct: 181 IKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVADKF 328


>gi|222147177|ref|YP_002548134.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734167|gb|ACM35130.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 326

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 154/326 (47%), Positives = 223/326 (68%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            L +A+  A+++F+ +Y ++ P L   +L KRMK+V+ ERE++R ++ 
Sbjct: 1   MSADLAATLTNPTLLIAVLVAIAVFATLYTLISPLLERSDLNKRMKAVSSERELIRARER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             +  +     LR  D+ S R  V++ NL+  LVD+  +++L+ AG RS+ +LN+ L  R
Sbjct: 61  ARMNSEGGRGSLRNTDNSSARKIVERFNLRKALVDDKTMDRLKTAGLRSQNALNMFLTAR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
            ++P +FL L   WIF    +   PF +R  A ++ GYVGF  P+++ISN + KRQ SI+
Sbjct: 121 FLLPFLFLALATTWIFALHNMQSRPFAVRFLAAVVAGYVGFYLPNIYISNRITKRQHSIR 180

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDL+LICVESG+S++ A+RRVA+++  QS  L+EEM+LT AELSFL +R+ A+E
Sbjct: 181 RAWPDALDLMLICVESGMSMEAAMRRVADEMASQSPALAEEMVLTTAELSFLQDRRTAYE 240

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N  NRTQ++ V++  QALIQ++RYGT IG +LRVL  E R ER+  AEKKAA+L PKLTV
Sbjct: 241 NLGNRTQLEIVKSVCQALIQAERYGTPIGQALRVLAQEGRDERMNAAEKKAAALPPKLTV 300

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLPVL+ VI+GPA + + D  
Sbjct: 301 PMILFFLPVLVAVILGPAGIRVSDRF 326


>gi|327194689|gb|EGE61535.1| pilus component protein [Rhizobium etli CNPAF512]
          Length = 328

 Score =  208 bits (529), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 177/328 (53%), Positives = 236/328 (71%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPGMLIAVFVAIAVFATFYTIAIPFFERGDLTKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  D  + +  LR+++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNADPGAGKASLRSQNNRSVRQIVERFNLRQALVDENTVNKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L   W+FG   L E    +R+ AVI IGYVGF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLALAAFWVFGLGNLAERGMPIRLFAVIGIGYVGFYAPNIYISNRMGKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA
Sbjct: 181 IKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LENLAMRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVADKF 328


>gi|15963899|ref|NP_384252.1| hypothetical protein SMc02822 [Sinorhizobium meliloti 1021]
 gi|307320431|ref|ZP_07599848.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|15073074|emb|CAC41533.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306893997|gb|EFN24766.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 327

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 157/323 (48%), Positives = 225/323 (69%), Gaps = 2/323 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +      + VA   ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  
Sbjct: 5   IETLTDPNILVAALVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNA 64

Query: 66  DS--ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           ++    + LR + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +
Sbjct: 65  EATTGRASLRAQHNTSVREIVERLNLRKALVDDNTVNRLKTAGYRSQNALNTFLFARFCL 124

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +FL + +++IF      + P  +RV   I   YVGF AP+++I+N + KRQ SI+RAW
Sbjct: 125 PFLFLTVAVLYIFVLGNFADKPIMVRVSFAIGFAYVGFYAPNIFIANAISKRQQSIRRAW 184

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLLLICVESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R++A EN  
Sbjct: 185 PDALDLLLICVESGVSMELAMRRVADEIAVQSPPLAEELVLTTAELSFLPERRIALENLG 244

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +D V++ TQALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI
Sbjct: 245 LRTGLDEVKSVTQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMI 304

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +FFLPVL+ VI+GPA + + D  
Sbjct: 305 LFFLPVLVAVILGPAGIQVADKF 327


>gi|220923700|ref|YP_002499002.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948307|gb|ACL58699.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 321

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 140/312 (44%), Positives = 201/312 (64%), Gaps = 2/312 (0%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L VA   A+S F     V  P L    L  R++ VA E E +R ++   LQ     S LR
Sbjct: 11  LLVAGIAAISAFCACMVVSWPYLVRDPLASRLRQVADETEAIRIRERAKLQAGHGPS-LR 69

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           T   K  ++   +LNL     D  +V +LR AG+R +  +   L VRL++P +   + + 
Sbjct: 70  TEPKKLFKDIFDRLNLARQAEDGAVVQRLRMAGYRGQGPVVTFLAVRLIMPFVMFAVAMF 129

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           ++F   +L   PF L++G  + + Y+G+ AP++++ N + KRQ++I+RAWPDALDLLLIC
Sbjct: 130 YVFVVLRLDG-PFVLKLGIALAVAYLGYYAPAIFVKNRISKRQTAIRRAWPDALDLLLIC 188

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+ ++ A R+VA++IG QS  L+EE+ LT AELS+LP+R+ A+EN   RT +D V+ 
Sbjct: 189 VESGMGVESAFRKVADEIGPQSPELAEELSLTTAELSYLPDRRKAYENLAERTGLDGVKG 248

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              +LIQ+++YGT +G +LRVL  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL  V
Sbjct: 249 VVTSLIQAEKYGTPVGQTLRVLAQENRDMRMTEAEKKAAALPPKLTVPMILFFLPVLFAV 308

Query: 314 IIGPAILSIIDT 325
           II PA + I +T
Sbjct: 309 IITPAAIQIANT 320


>gi|307315796|ref|ZP_07595310.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|306898564|gb|EFN29237.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 327

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 157/323 (48%), Positives = 224/323 (69%), Gaps = 2/323 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +      + VA   ++++ +  Y++V P L  G+L KRMKSVA ERE +R ++   L  
Sbjct: 5   IETLTDPNILVAALVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERARLNA 64

Query: 66  DS--ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           ++    + LR + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +
Sbjct: 65  EATTGRASLRAQHNTSVREIVERLNLRKALVDDNTVNRLKTAGYRSQNALNTFLFARFCL 124

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +FL + +++IF      + P  +RV   I   YVGF AP ++I+N + KRQ SI+RAW
Sbjct: 125 PFLFLTVAVLYIFVLGNFADKPIMVRVSFAIGFAYVGFYAPKIFIANAISKRQQSIRRAW 184

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLLLICVESG+S++ A+RRVA++I  QS PL+EE++LT AELSFLP R++A EN  
Sbjct: 185 PDALDLLLICVESGVSMELAMRRVADEIAVQSPPLAEELVLTTAELSFLPERRIALENLG 244

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +D V++ TQALIQ+DRYGT +  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI
Sbjct: 245 LRTGLDEVKSVTQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMI 304

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +FFLPVL+ VI+GPA + + D  
Sbjct: 305 LFFLPVLVAVILGPAGIQVADKF 327


>gi|254419878|ref|ZP_05033602.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186055|gb|EDX81031.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score =  206 bits (523), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 121/326 (37%), Positives = 201/326 (61%), Gaps = 2/326 (0%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
             F       +  +++   V +F+ +  ++    G  +L++RMK+V+  R+ L+++   +
Sbjct: 2   DAFIRFITDPQNLLSLGVGVLVFATVLTLLSSMTGGVKLDQRMKAVSERRDELKRRSRAA 61

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           +          T D    +  V +LNL  +L D  + +++  AG+R    L      R  
Sbjct: 62  IHTGPG-GLRHTDDEGFKKRVVDRLNLTKLLEDPKVADQMAQAGYRGPRPLTTFYFFRFA 120

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
            P IFL++   ++F   K++++P   ++ A +     GF AP+++++N + KR++SI +A
Sbjct: 121 SPFIFLMVVAFYMFVI-KVVDWPTMQKITACVAAAVAGFYAPNLFLTNRITKRRTSIMQA 179

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALDLLLICVE+G+SI+ A+ +V+++IG  S+ L+EE+ L  AELS+LP+R++A+EN 
Sbjct: 180 FPDALDLLLICVEAGMSIEAAIAKVSQEIGTSSIELAEELSLLSAELSYLPDRRMAYENL 239

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT    V++   A+ Q++ YGT +  +LRV+  E R  RL  AEKKAA+L  +LTVPM
Sbjct: 240 GKRTNHPGVKSVAVAMTQAETYGTPLSSALRVMAKENRDLRLSAAEKKAAALPAQLTVPM 299

Query: 303 IIFFLPVLILVIIGPAILSIIDTMKD 328
           I+FFLPVL +VI+GPAIL+I+DTM  
Sbjct: 300 ILFFLPVLFIVILGPAILNIMDTMAK 325


>gi|307943150|ref|ZP_07658495.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773946|gb|EFO33162.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 326

 Score =  206 bits (523), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 132/325 (40%), Positives = 207/325 (63%), Gaps = 6/325 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ- 64
           F   D T++  AI   + +   +Y +++P      L+ RMKSVA+ER+ +R ++   L  
Sbjct: 3   FAGMDFTQVITAIMAMICVSGTLYVLIMPLFERDGLKSRMKSVALERDEIRMRERARLNN 62

Query: 65  --KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
             KD   S   ++ ++ +++  ++ NL+++L D+ +  +L  AGFR    +    + R+ 
Sbjct: 63  AGKDGRGSLRGSQPTQRMKDLTERFNLQSVLTDKEVKMRLAQAGFRGPGPIYKYALGRVF 122

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
            P +  ++ + +       + Y F   +        +G+  P++++ N ++KRQ +I RA
Sbjct: 123 APPVLFVVSLFYATAV---MGYGFLTGLLVGAAFAGLGYFVPNIYLQNTIEKRQKAIGRA 179

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           WPDALDL+LICVESG+SI+ A+++VA++IG QS  L+EE+ LT AELS+L +R++AFEN 
Sbjct: 180 WPDALDLMLICVESGMSIEVAMQKVADEIGVQSADLAEELTLTTAELSYLQDRRIAFENL 239

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
            NRT MD ++N   ALIQ++RYGT +  +LR +  +TR +R+ EAEKKAASL PKLTVPM
Sbjct: 240 GNRTGMDNIKNVVMALIQAERYGTPVAKALRAMSDDTRDQRMQEAEKKAASLPPKLTVPM 299

Query: 303 IIFFLPVLILVIIGPAILSIIDTMK 327
           I+FFLPVL  VI+ PAIL I+D M 
Sbjct: 300 IVFFLPVLFAVIMTPAILQIMDVMG 324


>gi|295690793|ref|YP_003594486.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432696|gb|ADG11868.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 327

 Score =  205 bits (522), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 132/326 (40%), Positives = 196/326 (60%), Gaps = 2/326 (0%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
             +        +    AV +F+ I  +  P +    LE R+KSVA  RE LR++   +L 
Sbjct: 3   LVETLTDPSNLLTAFIAVVVFATIITLASPLMRDNGLEGRLKSVANRREELRRRSREALA 62

Query: 65  KD-SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           +   A   LR +D    +  V++L L  +L D  +V+KL  AGFR    +      R V 
Sbjct: 63  QRHGAPGTLRHQDEGLYKKVVERLQLSRLLEDPKVVDKLAQAGFRGPRPVTTFYFFRFVA 122

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +F  +   +++G +     P Q ++ A +     G+ AP+V+I+N+ QKR+ SI  A+
Sbjct: 123 PFVFAAVVAAYLYGVNDFGLLPIQ-KLCACVAALAFGYYAPNVYITNIAQKRRESIVAAF 181

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD+LDLLLICVESG+S++ A+++V+ +IG QS+ L+EE+ L  AELS+LP R+ A+EN  
Sbjct: 182 PDSLDLLLICVESGMSVEAAIQKVSSEIGAQSMELAEELSLLTAELSYLPERRQAYENLA 241

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT    V++   A+IQ++RYGT +G +LRV+  E R  RL  AEKKA +L  KLTVPMI
Sbjct: 242 RRTNHPGVKSVATAMIQAERYGTPLGAALRVMAKENRELRLSSAEKKATALPAKLTVPMI 301

Query: 304 IFFLPVLILVIIGPAILSIIDTMKDH 329
           +FFLPVL +VI+GPAI+ + D    H
Sbjct: 302 LFFLPVLFIVILGPAIIKVQDVFAKH 327


>gi|86355869|ref|YP_467761.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279971|gb|ABC89034.1| probable pilus assembly protein [Rhizobium etli CFN 42]
          Length = 328

 Score =  205 bits (522), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 170/328 (51%), Positives = 234/328 (71%), Gaps = 2/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M            + +A+  A+++F+  Y + IP    G+L KRMK+V+ ERE +R ++ 
Sbjct: 1   MSQDLAATLTNPSMLIAVFVAIAVFATFYTIAIPFFERGDLNKRMKAVSTEREQIRARER 60

Query: 61  TSLQKDSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
             +  +  + +  LR ++++S+R  V++ NL+  LVDEN VNKLRAAGFRSE +LN  LV
Sbjct: 61  ARMNTEPGAGKTSLRNQNNRSVRQIVERFNLRKALVDENTVNKLRAAGFRSENALNTFLV 120

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            R ++P +FL L   W+FG   L +    +R+ AVI I Y+GF AP+++ISN + KRQ S
Sbjct: 121 ARFLLPFLFLALAAFWVFGLGGLADRGMPMRMLAVIGIAYLGFYAPNIYISNRMSKRQHS 180

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           IKRAWPDALDL+LICVESG+S++ A+RRV+E++G QS PL+EEM+LT AELSFLP+R+VA
Sbjct: 181 IKRAWPDALDLMLICVESGVSMEAAMRRVSEELGEQSPPLAEEMVLTTAELSFLPDRRVA 240

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            +N   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R ER+ EAEKKAA+L PKL
Sbjct: 241 LDNLAARTQLELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEAEKKAAALPPKL 300

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           TVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 301 TVPMILFFLPVLIAVILGPAGIQVADRF 328


>gi|114568975|ref|YP_755655.1| type II secretion system protein [Maricaulis maris MCS10]
 gi|114339437|gb|ABI64717.1| type II secretion system protein [Maricaulis maris MCS10]
          Length = 331

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 191/322 (59%), Gaps = 4/322 (1%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
           D        +A+  A+ +F+ +  +  P+LGS +L+KR+KSV   RE LR++   ++   
Sbjct: 11  DFLTDPGSLIAMVAAILVFATVVTLTSPALGSDKLDKRIKSVNNRREELRRKNRAAIDAA 70

Query: 67  SASSR---LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           + + +           +R  V+ L+L+    D  +  KL  AG R +         RL+ 
Sbjct: 71  AMAGKGTIRGAEAKGLVRKVVEALDLQKAFEDPALHEKLAQAGMRGQRPAMTFYFFRLLS 130

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P I   + + ++F  +     P   RV     +G +G+ AP++++SNL  KRQ SI  A+
Sbjct: 131 PFILFGVALFYVFMIND-FGLPQITRVCFSFGLGLLGYYAPNLYLSNLAAKRQQSIMGAF 189

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD LDLLLICVESG+SI+ A  +V+ ++G QS+ L+EE+ LT AELS+L +R+VA+EN  
Sbjct: 190 PDGLDLLLICVESGMSIEAAFHKVSSEVGSQSIELAEELSLTTAELSYLQDRRVAYENLA 249

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT    V+    +LIQ++RYGT +G +LRV+  E R  RL  AEKKAASL  KLTVPMI
Sbjct: 250 KRTNHPGVKAVCTSLIQAERYGTPLGQALRVMAKENRDMRLAAAEKKAASLPAKLTVPMI 309

Query: 304 IFFLPVLILVIIGPAILSIIDT 325
           IFFLPVL +VI+GPAI+     
Sbjct: 310 IFFLPVLFVVILGPAIIRFQSM 331


>gi|227823976|ref|YP_002827949.1| components of type IV pilus TadC [Sinorhizobium fredii NGR234]
 gi|227342978|gb|ACP27196.1| components of type IV pilus TadC [Sinorhizobium fredii NGR234]
          Length = 327

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 150/323 (46%), Positives = 225/323 (69%), Gaps = 2/323 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                   + +A+  ++++ +  Y++ +P    G+L KRMKSVA ERE +R ++   L  
Sbjct: 5   IRTLTDPNIIIAVLVSMAVLATFYSLAVPFFERGDLTKRMKSVATEREQIRARERARLNA 64

Query: 66  DSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
           ++++ +  LR + + S+R  V++LNL+  LVD+N VN+L+ AG+RS+ +LN  L  R  +
Sbjct: 65  EASAGKASLRAQHNTSVRQIVERLNLRQALVDDNTVNRLKTAGYRSQNALNTFLFARFCL 124

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +FL + +++IF      + PF LR+   +   Y+GF AP+++I+N + KRQ SI+RAW
Sbjct: 125 PFLFLTVAVVYIFVLGNFADKPFMLRICFALGFAYLGFYAPNIFIANAISKRQHSIRRAW 184

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLLLICVESG+S++ A+RRVA++I  QS  L+EE++LT AELSFLP+R++A EN  
Sbjct: 185 PDALDLLLICVESGVSMELAMRRVADEIAAQSSALAEELVLTTAELSFLPDRRIALENLG 244

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R+ ++ V+   QALIQ+DRYGT I  +LRVL  E+R +R+  AEKKAA+L PKLTVPMI
Sbjct: 245 LRSGLEEVKAVMQALIQADRYGTPIAQALRVLAQESRDQRMTAAEKKAAALPPKLTVPMI 304

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +FFLPVL+ VI+GPA + + D  
Sbjct: 305 LFFLPVLVAVILGPAGIQVADKF 327


>gi|329847258|ref|ZP_08262286.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842321|gb|EGF91890.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 343

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 131/320 (40%), Positives = 194/320 (60%), Gaps = 2/320 (0%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
           F          +AI  AV +F  +  +        +L+KR+K+VA  RE LR+Q    + 
Sbjct: 4   FASTIMNPSNLIAIAVAVLVFFTVITLGKSMTSGEQLDKRLKAVAQRREELRRQSRQQIV 63

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           K+ +   LR +D    R FV K NL+ +L D  +   L  AGFR    ++     R ++P
Sbjct: 64  KEQS-GGLRHKDDGMARGFVDKFNLRKLLEDPKVAENLAMAGFRGPKPISTFYFFRFLMP 122

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            +   L   +IF  +        +++   + +   G+ AP+++ISN   KR+ SI  A+P
Sbjct: 123 FVLGALATFYIFVVND-FGQKMNMKILICVAMFVAGYYAPNIYISNTASKRRQSIVAAFP 181

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLLLICVE+G+SI+ AL +V+++IGG S+PL+EEM L +AELS+LP R+ A+E F  
Sbjct: 182 DALDLLLICVEAGMSIETALHKVSQEIGGTSIPLAEEMSLLVAELSYLPERRQAYEGFSK 241

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT    +++   A+IQ+++YGT +G +LRV+  E R  RL  AEKKAA+L  +LTVPMI+
Sbjct: 242 RTSHPGIKSVCTAMIQAEKYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTVPMIV 301

Query: 305 FFLPVLILVIIGPAILSIID 324
           FFLPVL +VI+GPA L +ID
Sbjct: 302 FFLPVLFVVILGPAALKVID 321


>gi|300021859|ref|YP_003754470.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523680|gb|ADJ22149.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 128/322 (39%), Positives = 197/322 (61%), Gaps = 2/322 (0%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILR-KQQITSL 63
           F +          +  AV +F+ + ++ +P L   ++ +RMK +AVER  +R  +     
Sbjct: 4   FIETMMNPHFVATMLAAVCVFATVLSIALPMLQRDQMNRRMKEMAVERGKMRSARLAEMS 63

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
            KD  S++LR      ++  V +L L+    ++ I   L+ AG R + ++   L  R+  
Sbjct: 64  SKDRPSNKLRPTAKGFMQRIVDELKLRERFDNDEIRENLKRAGLRGQANIVTFLFFRVAA 123

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           PII   L + ++F        P  + VG  +  G++GF  P+V+ISN VQKRQ+SIK+A+
Sbjct: 124 PIIIFFLALFYVFVLYDTGHAPI-VNVGIALGAGFLGFYLPNVFISNRVQKRQTSIKQAF 182

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALD+LLICV+SG+S++ A  +V ++I  QS+ L+EEM LT AELS+L +R+ A+EN  
Sbjct: 183 PDALDMLLICVQSGMSVEAAFAKVGKEIANQSIELAEEMALTTAELSYLQDRRQAYENLA 242

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +  V+    AL+Q++RYGT +G +LR +  E R  R  EAE+KA++L PKLTVPMI
Sbjct: 243 KRTGLPGVKGVATALVQAERYGTPVGQALRTMAKENREIRQSEAERKASALPPKLTVPMI 302

Query: 304 IFFLPVLILVIIGPAILSIIDT 325
           +FFLPVL +VI+GPA +  +  
Sbjct: 303 VFFLPVLFIVILGPAGIGYMQM 324


>gi|148258240|ref|YP_001242825.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146410413|gb|ABQ38919.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 324

 Score =  203 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 132/325 (40%), Positives = 195/325 (60%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +             +  A++  + +Y +++P      L KRMK+VA ERE +++++ 
Sbjct: 1   MVDFLVTKLHDPHFMTMLFAAIAASATVYTLIMPLFAGENLNKRMKAVASERERIKQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             +      S LR    + +   V   NL   L  E    KL  AG+R +      L  R
Sbjct: 61  ERMNAGEKVS-LRQTPKQLVAKVVDDFNLTKWLAQEAAREKLIMAGYRGQAPYITFLFAR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV P++  +  ++++F    L +    +++G  I + Y+G  AP +++SN + KRQ SIK
Sbjct: 120 LVTPVVLFVGSVLYVFVIANL-QKSLPIKIGICIGMAYLGLQAPMLFLSNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+V+ +I  QS+ LSEE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEAAFRKVSMEIASQSIALSEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLARRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMILFFLPVLFVVILGPTGIKVAAM 323


>gi|146338118|ref|YP_001203166.1| putative pilus assembly protein membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146190924|emb|CAL74929.1| putative pilus assembly protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  203 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 134/325 (41%), Positives = 194/325 (59%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +                A++  + +Y +++P      L KRMK+VA ERE +++++ 
Sbjct: 1   MVDFLVTKLHDPHFMTMFFAAIAASATVYTLIMPLFAGENLNKRMKAVASERERIKQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L      S LR    + +   V   NL   L  E   +KL  AG+R +      L  R
Sbjct: 61  ERLNAGEKVS-LRQTPKQLVAKVVDDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFGR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV P++     ++++F    L E    +++G  + + Y+G  AP +++SN + KRQ SI+
Sbjct: 120 LVTPVVLFAGSVLYVFVIAHL-EKSMPVKIGICVGMAYLGLQAPMLFLSNAISKRQLSIR 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A RRVA +I  QS+ LSEE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEAAFRRVAIEISSQSIALSEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLARRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMILFFLPVLFVVILGPTGIKVAAM 323


>gi|254473723|ref|ZP_05087118.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957109|gb|EEA92314.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 324

 Score =  203 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 129/320 (40%), Positives = 205/320 (64%), Gaps = 3/320 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + + + T +++   ++A++ P     +L+ RMKSVA+ER+ +R ++   L ++  
Sbjct: 6   LGGNNIFMVVLTLIAVSGTVFALLSPLFERDDLKSRMKSVALERDKIRSRERNRLAQEKE 65

Query: 69  SSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
           + R  LR+     +R FV K +LK +L  +N+  KL+ AG+R    L   L +++++P+ 
Sbjct: 66  NQRVSLRSNPKDGVREFVDKYDLKKLLSSDNVAKKLKMAGYRGVSPLYTYLFLQIILPVA 125

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
           F      ++    +L + PF   V   + +  +GF  PS+ + N V KRQ SI+ AWPDA
Sbjct: 126 FFAASFFYLVVILQL-DIPFAGVVACSLGVAAIGFYGPSIIVQNKVMKRQESIRLAWPDA 184

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +DL+LICVESG+SI+ A ++VAE++G QS  L+EE++L  AELS+L  R+ A++N   RT
Sbjct: 185 MDLMLICVESGMSIEAAFKKVAEEVGPQSTALAEELILANAELSYLDERRKAYQNLAERT 244

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +D V+N   AL Q+++YGT IG +LRVL  E+R ER+ EAE+KAA+L PKLTVPM++FF
Sbjct: 245 GLDGVKNVVVALSQAEKYGTPIGYALRVLSEESRQERMQEAERKAAALPPKLTVPMMLFF 304

Query: 307 LPVLILVIIGPAILSIIDTM 326
           LPVL +V+I PA++ +    
Sbjct: 305 LPVLFIVLIAPAVIKVSAHF 324


>gi|118589708|ref|ZP_01547113.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
 gi|118437794|gb|EAV44430.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
          Length = 325

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 135/324 (41%), Positives = 212/324 (65%), Gaps = 3/324 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            D   +++   A+   +++   ++++V+P L    L+ RMKSVA+ER+ LR ++   LQ 
Sbjct: 3   IDTLASSQFLAAVLAMIAVTGTVFSLVMPLLSRDTLKSRMKSVAIERDKLRAKERARLQA 62

Query: 66  DSASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             A ++  LR +    +++ V +LNLK  L D+  V+ LR AG+R    L   LV R+V+
Sbjct: 63  THADAKASLRNQPKAQMKSLVDRLNLKEALSDQTTVDNLRMAGYRGAAPLYYFLVARIVI 122

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P       + + F      + P   ++   + +  +G   P++++ N + KR+ +I+RAW
Sbjct: 123 PAGIFTFSVAYAFLVLP-DDLPALSKICFCLGLAGLGAFMPNLYLKNKIDKRKLTIQRAW 181

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDL+LICVESG+SI++  RRVAE++G QSV L+EE+ LT AELS+L +R++A+EN  
Sbjct: 182 PDALDLMLICVESGMSIEEGFRRVAEEVGVQSVELAEELSLTTAELSYLSDRRIAYENLA 241

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +D V+N   ALIQ++RYGT +G +LR +  +TR +R+  AE+KAASL PKLTVPMI
Sbjct: 242 KRTGVDGVKNVMMALIQAERYGTPVGTALRTMADDTREQRMQMAEQKAASLPPKLTVPMI 301

Query: 304 IFFLPVLILVIIGPAILSIIDTMK 327
           +FFLPVL  +I+GPA++ ++DT +
Sbjct: 302 MFFLPVLFFIIMGPAVIQVMDTFR 325


>gi|83859362|ref|ZP_00952883.1| hypothetical protein OA2633_13195 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852809|gb|EAP90662.1| hypothetical protein OA2633_13195 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 326

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 129/324 (39%), Positives = 196/324 (60%), Gaps = 4/324 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
           F           A+  A  +F+ ++ +  P++G   L KRMK+VA  RE LR++    L+
Sbjct: 4   FIRWIVTPANLFAVIAAGLVFATVWTLSAPAMGGDNLNKRMKAVANRREELRRKAREELE 63

Query: 65  KDSASSR---LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           K +   +            R  V+KLNL  +L D N+  KL  AG+R +  +      R 
Sbjct: 64  KSANEKKGGLRGKDTRSLYRKVVEKLNLATLLEDANLKTKLIQAGYRGQGPVYAFYFARF 123

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
            +P +  +LG ++++  +     P   R+  V+++  +G+ AP +++SN   KR+ SI +
Sbjct: 124 AIPPVMGLLGFVYLWVVND-FGLPVMQRLTIVMVLAVLGYYAPGIYLSNQAAKRRDSIMQ 182

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PD+LDL+LICVE+G+SI+ AL +VA +IG  S+ L+EE+ LT AEL++L +R+ AFEN
Sbjct: 183 AFPDSLDLMLICVEAGMSIEAALHKVAAEIGTNSMELAEELSLTNAELAYLQDRRAAFEN 242

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT +  V+    ALIQ++RYGT +G +LRV+  E R  R+  AEKKAA+L  KLTVP
Sbjct: 243 LGMRTNLPGVKAVATALIQAERYGTPLGQALRVMAKENRDMRMSNAEKKAAALPAKLTVP 302

Query: 302 MIIFFLPVLILVIIGPAILSIIDT 325
           MI+FFLPVL +VIIGPA +S  + 
Sbjct: 303 MILFFLPVLFVVIIGPAAISFQNM 326


>gi|87199097|ref|YP_496354.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134778|gb|ABD25520.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 335

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 108/318 (33%), Positives = 175/318 (55%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
                 +I  A++ F+++ A+         + KR+K++   RE L+   +T+  +   S 
Sbjct: 14  DVYFVGSILVAIAAFAVMLAIYAAVTVRDPMAKRVKALNERREQLKSGIVTANARKRTSI 73

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             R + +  +R F++ L +        I  KL  AG R +     +++ RLV PI   + 
Sbjct: 74  VRRNQTTDQIRGFLESLKVLQDSQLAVIQQKLAQAGIRKKEWAVAVILGRLVGPIALGLF 133

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G    +  +   ++    R     +    G+  P ++I NLV KR  ++++  PDALDLL
Sbjct: 134 GAAVFYWSNTFPDWSPFKRFLGFAVCLIAGYKGPDLFIQNLVSKRTVAVRKGLPDALDLL 193

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +IC E+G+++D A  RVA ++G     L +E  LT  ELSFL  R+ AFEN   R  +D 
Sbjct: 194 VICAEAGLTVDAAFSRVARELGRAYPELGDEFALTAIELSFLTERRHAFENLAYRVDLDS 253

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V+     +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +T+P+I+F LPVL
Sbjct: 254 VKGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTIPLILFILPVL 313

Query: 311 ILVIIGPAILSIIDTMKD 328
            +VI+GPA  SI D++ +
Sbjct: 314 FIVILGPAACSISDSLVN 331


>gi|85713510|ref|ZP_01044500.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699414|gb|EAQ37281.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 325

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 139/326 (42%), Positives = 199/326 (61%), Gaps = 2/326 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     + F   +    +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++ 
Sbjct: 1   MLDILIEKFHDPQFMTMVLAAIAASATVYTLITPFFAADGLTKRMKAVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+ LNL   +  E    KL  AG+R +      L  R
Sbjct: 61  ERLSKSEKVS-LRQAPKQFVSKIVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V PI+ LI  I ++F      + P  +++G  I   + G  AP +++ N + KRQ SIK
Sbjct: 120 MVTPIVMLIGAIAYVFLLS-HTQQPTHVKIGICIGATFFGLQAPMLFLKNAITKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+V+ +IG QSV L+EE  LT AELS+L +R++A+E
Sbjct: 179 RAFPDALDLLLICLESGMSIEVAFRKVSTEIGNQSVALAEEFTLTTAELSYLQDRKIAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N  NRT ++ V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLANRTGVEGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLPVL +VI+GP  + I   M
Sbjct: 299 PMIVFFLPVLFVVILGPTGIKIAAQM 324


>gi|85707698|ref|ZP_01038764.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
 gi|85689232|gb|EAQ29235.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
          Length = 333

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 107/316 (33%), Positives = 183/316 (57%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
              L   +   ++ F++I A+         + KR+KS+   R+ L+   +TS  K  AS 
Sbjct: 14  DVVLVGTLLAGLAAFAVIMAIYAAITIKDPMAKRVKSLNERRDELKAGIVTSGTKKRASL 73

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             ++  +  +++ + K+N+      + +  KL  AG+R++    I++ +R V+P++F I+
Sbjct: 74  VRKSDTTDKVKDSLGKMNVLEQSQLQAVQQKLAHAGYRNKELAVIVIGLRAVLPVVFGIV 133

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G   I+ ++         +  A+    ++G+  P +++ N   KR   I++  PDALDLL
Sbjct: 134 GFFAIYYFNVFDIKSDFYKFLAMAGCLFLGYKGPELFLKNKADKRTKEIQKGLPDALDLL 193

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +IC E+G+++D A  RVA+++G     L +E  LT  ELSFL  R++AF N   R  ++ 
Sbjct: 194 VICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAIELSFLNERKMAFNNLAYRVDLEA 253

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V+     +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL
Sbjct: 254 VKGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVL 313

Query: 311 ILVIIGPAILSIIDTM 326
            +VI+GPA  +I DT+
Sbjct: 314 FIVILGPAACAITDTL 329


>gi|304392379|ref|ZP_07374320.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295483|gb|EFL89842.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 328

 Score =  198 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 134/327 (40%), Positives = 198/327 (60%), Gaps = 5/327 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            FD+    +  +A+T  ++ F+   ++ +P L    LE RMKSVA+ER+ LR ++   +Q
Sbjct: 1   MFDIITQPQNLIAMTVTLACFATALSIAMPLLAKDPLEGRMKSVALERDKLRARERAKIQ 60

Query: 65  KDSASSRLR-----TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            D   +  R        + ++   V+KLNL+  L DEN    L  AG+R    L I L +
Sbjct: 61  ADKQKAGQRVGAKKAEANSAITGLVEKLNLRTALADENTEAMLVHAGYRGSKPLFIFLAL 120

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           R  +P++FL L  I++    +  E          ++ G +GF  P + +   ++ RQ SI
Sbjct: 121 RFALPLVFLALTAIYLLFLSERTEGDTMTIGIKCLVAGAIGFYLPILVVKQKMKARQLSI 180

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
            ++WPDALDL LICVESG+SI+ A R+VA +IG QS PL+EE+++T AELSFL  R+ A+
Sbjct: 181 SQSWPDALDLSLICVESGMSIEVAFRKVASEIGAQSPPLAEELMITTAELSFLQERKHAY 240

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           +N   RT ++ V+N   +L+QS++YGT +  +LRVL  E R  R+  AEKKAA LGPKLT
Sbjct: 241 DNLVYRTGLESVKNVVLSLVQSEKYGTPLSVALRVLSQENRDTRMAMAEKKAAGLGPKLT 300

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTM 326
           VPM+I FLPVL  VI+GPA++  +   
Sbjct: 301 VPMMICFLPVLFCVILGPAVIRTMAEF 327


>gi|167648147|ref|YP_001685810.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350577|gb|ABZ73312.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 328

 Score =  198 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 131/323 (40%), Positives = 196/323 (60%), Gaps = 1/323 (0%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
                      ++   A+ +F+ I  +  P L S  LE R+KSVA  RE LR++   ++ 
Sbjct: 1   MIKELTDPTNLLSAFIAIVVFATIVTLAAPMLSSNGLEGRLKSVANRREELRRRSREAMS 60

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           +      LR  D    +N V +L L  +L D  +V+KL  AGFR    ++     R V+P
Sbjct: 61  QKGGGGTLRHADEGMYKNVVDRLQLSRLLEDPKVVDKLAQAGFRGPKPVSTFYFFRFVMP 120

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
             F ++   +++  +     P Q ++ A      VG+ AP+++ISN+ QKR+ SI  A+P
Sbjct: 121 FAFALVAAFYLYVINGFGLLPVQ-KIAACFFALTVGYYAPNIYISNIAQKRRESIVAAFP 179

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDL+LICVESG+SI+ A+ +V  ++GG S+ L+EE+ L  AELS+LP R++A+E    
Sbjct: 180 DALDLMLICVESGMSIEAAIAKVGAEVGGASIELAEELSLLTAELSYLPERRLAYEGLAR 239

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT    +R+   A+IQ++RYGT +G +LRV+  E R  RL  AEKKAA+L  KLTVPMI+
Sbjct: 240 RTNHPGIRSVVTAMIQAERYGTPLGAALRVMAKENRDLRLSAAEKKAAALPAKLTVPMIL 299

Query: 305 FFLPVLILVIIGPAILSIIDTMK 327
           FFLPVL +VI+GPA ++I+D + 
Sbjct: 300 FFLPVLFIVIMGPAAINIMDAIA 322


>gi|315497460|ref|YP_004086264.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415472|gb|ADU12113.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 135/328 (41%), Positives = 204/328 (62%), Gaps = 3/328 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M    F L       +A+  A+  F  +  ++  SL   +L+KRMK+VA  RE LR+Q  
Sbjct: 1   MKELAFTLM-QPANLIALVVAILAFLAVLTLLRSSLSGEQLDKRMKAVAQRREELRRQSR 59

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            S+ + S S  LR  D    +  V +LNLK +L D  +V+KL  AGFR    +      R
Sbjct: 60  QSMVQASNSG-LRQTDESLYKRIVDRLNLKTLLEDPKVVDKLAMAGFRGPKPITTFYFFR 118

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
            ++P +   L   +I+  +     P  +++   + +   G+ AP+++ISN   KR++SI 
Sbjct: 119 FLMPFVMGALSTFYIYVVND-FGQPPNIKILICVAMFVAGYYAPNIYISNAASKRRASIV 177

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
            A+PDALDLLLICVE+G+SI+ AL++V+++IG  S+ L+EE+ L +AELS+LP R++A+E
Sbjct: 178 TAFPDALDLLLICVEAGMSIEAALQKVSQEIGSASIELAEELSLLVAELSYLPERRMAYE 237

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               RT    +++   A+IQ+++YGT +G +LRV+  E R  RL  AEKKAA+L  +LTV
Sbjct: 238 GLARRTNYPGIKSVCTAMIQAEKYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTV 297

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKD 328
           PMI+FFLPVL +VI+GPAIL+I+D M  
Sbjct: 298 PMIVFFLPVLFVVILGPAILNIMDMMGK 325


>gi|315121886|ref|YP_004062375.1| pilus component protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495288|gb|ADR51887.1| pilus component protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 319

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 242/320 (75%), Positives = 284/320 (88%), Gaps = 2/320 (0%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +FD+  +AV + T++S+FSLIYAV+IPSLGS ELEKR+KSV++ERE LRKQQ+  L K  
Sbjct: 1   MFDSVTIAVVVATSISVFSLIYAVIIPSLGSDELEKRIKSVSIEREELRKQQLARLGK-- 58

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            SS LRT D+ SLR FV+K NLKAILVD+ +V+KLRAAGFRSEY+LNILL++RLV+PII 
Sbjct: 59  PSSGLRTHDNMSLRKFVEKFNLKAILVDKPMVDKLRAAGFRSEYALNILLIIRLVLPIIT 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L++GIIWIFG+DKL +Y F  R+  VILIGY GF APS++ISNLV KRQ SI+RAWPDAL
Sbjct: 119 LVIGIIWIFGFDKLEQYSFFNRLFVVILIGYAGFYAPSMFISNLVTKRQDSIRRAWPDAL 178

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLLLIC+ESGI++DQALRRVAE++GGQSV LSEE+LLT AELSFL NRQVAFENFYNRTQ
Sbjct: 179 DLLLICIESGIAVDQALRRVAEEVGGQSVALSEELLLTTAELSFLLNRQVAFENFYNRTQ 238

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           MDC+RN  QA IQSDRYGTSIGDSLRVLV+ETRSERLMEAEKKAA+L PKLTVPMI+FFL
Sbjct: 239 MDCIRNVMQAFIQSDRYGTSIGDSLRVLVAETRSERLMEAEKKAAALSPKLTVPMILFFL 298

Query: 308 PVLILVIIGPAILSIIDTMK 327
           PVL+LVIIGPAIL+I+DTMK
Sbjct: 299 PVLMLVIIGPAILNIMDTMK 318


>gi|92116008|ref|YP_575737.1| type II secretion system protein [Nitrobacter hamburgensis X14]
 gi|91798902|gb|ABE61277.1| type II secretion system protein [Nitrobacter hamburgensis X14]
          Length = 325

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 137/326 (42%), Positives = 199/326 (61%), Gaps = 2/326 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +  +     +    +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++ 
Sbjct: 1   MLDFLIEKLHDPQFMTMVLAAIAASATVYTLITPFFAAEGLTKRMKAVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+ LNL   +  E    KL  AG+R +      L  R
Sbjct: 61  ERLAKSEKVS-LRQAPKQFVSKVVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V PI+ LI  I+++F     ++    +++G  I   + G  AP +++ N + KRQ SIK
Sbjct: 120 MVTPIVMLIGAIVYVFLLS-HMQQSTPIKIGICIGAAFFGLQAPMLFLKNAITKRQISIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+V+ +IG QSV L+EE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEVAFRKVSTEIGSQSVALAEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAKRTGVEGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLPVL +VI+GP  + I   M
Sbjct: 299 PMIVFFLPVLFVVILGPTGIKIAAQM 324


>gi|163757632|ref|ZP_02164721.1| putative component of pilus protein [Hoeflea phototrophica DFL-43]
 gi|162285134|gb|EDQ35416.1| putative component of pilus protein [Hoeflea phototrophica DFL-43]
          Length = 331

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 157/331 (47%), Positives = 227/331 (68%), Gaps = 5/331 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M              V I  +V++F+ ++ ++ P    G+L+KRMKS A+ER+ +R ++ 
Sbjct: 1   MLSDIASSLTDPAYLVPILVSVAVFATLFTIMAPYFERGDLDKRMKSAALERDEIRARER 60

Query: 61  TSLQKDSAS-----SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
             L  + +      + LR  ++ S+R  V++LNL+  L D+  V KLRAAG+R++ +LN+
Sbjct: 61  ARLHAEQSRGGSKSAGLRAHNNASVRGIVEQLNLRKALADDATVAKLRAAGYRTQNALNM 120

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
            L+ R V+P  F +  ++++F  + + + P  +R+ A I+  Y GF AP+++ISN  +KR
Sbjct: 121 FLLARFVLPFFFFVAAVVYVFVLENMTDKPTTVRLLACIVAAYAGFYAPNIFISNQSKKR 180

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           Q SIK AWPDALDLLLICVESG+SI+ A++RVAE+I  QS  L+EE LLT AELS+L +R
Sbjct: 181 QQSIKMAWPDALDLLLICVESGVSIEAAMKRVAEEIAIQSTALAEEFLLTTAELSYLQDR 240

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           +VAFEN  NRT ++ V++ TQALIQS+RYGT I  +LRVL  E+R  R+ EAEKKAA+L 
Sbjct: 241 RVAFENLGNRTGLEAVKSVTQALIQSERYGTPIAQALRVLAQESRDARMTEAEKKAAALP 300

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           PKLTVPMI+FFLPVLI VI+GPA + ++D  
Sbjct: 301 PKLTVPMILFFLPVLIGVILGPAAIQVMDRF 331


>gi|254293219|ref|YP_003059242.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041750|gb|ACT58545.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 333

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 124/318 (38%), Positives = 197/318 (61%), Gaps = 5/318 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
             + F       A+   ++ F+ I  +  P+L   +LE R+KSV+  RE LR++    L+
Sbjct: 1   MIESFTDPGFLAALLAGLASFATILTIAAPALKGNKLETRLKSVSNRREELRRKSREQLK 60

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             S    LR +D   +RN V KL+L+++L D+N+   L  AG R    ++     R  +P
Sbjct: 61  DKS----LRRKDEGMMRNVVDKLDLQSLLRDDNLEKALVQAGLRGPRPVSAFYFARFALP 116

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            +  +L  +++   +   +  FQL++ AV+     GF AP+++++N   KR++SI +A+P
Sbjct: 117 FLLGLLTFLYLHFVND-FDLNFQLQMCAVMFGAAAGFYAPNMYLTNRADKRKASIMKAFP 175

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D+LD++LICVESG+SI+ A  +V E++G  SV L+EE+ LT AELS+L  R+ A+ N  +
Sbjct: 176 DSLDMMLICVESGMSIESAFAKVGEEVGTASVELAEELGLTTAELSYLQERRQAYVNLAD 235

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT    +++   AL+Q+++YGT +G +LR +  E R  R++EAEKKAA+L  KLTVPMI+
Sbjct: 236 RTNHPGIKSVATALVQAEKYGTPMGTALRTMAKENREIRVLEAEKKAAALPAKLTVPMIV 295

Query: 305 FFLPVLILVIIGPAILSI 322
           FFLPVL +VI  PA + I
Sbjct: 296 FFLPVLFIVIGTPAYIQI 313


>gi|75674494|ref|YP_316915.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
 gi|74419364|gb|ABA03563.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
          Length = 325

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 137/326 (42%), Positives = 197/326 (60%), Gaps = 2/326 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     + F   +    +  A++  + +Y ++ P   +  L KRMK+VA ERE +R ++ 
Sbjct: 1   MLDILIEKFHNPQFMTMVLAAIAASATVYTLITPFFAADGLTKRMKAVASERERIRLRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L +    S LR    + +   V+ LNL   +  E    KL  AG+R +      L  R
Sbjct: 61  ERLARTEKVS-LRQAPKQFISKIVEDLNLGKWVAQEAAREKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V PI+ LI  I ++F      +    +++G  I   + G  AP +++ N + KRQ SIK
Sbjct: 120 MVTPIVMLIGAIAYVFLLS-HTQQSTTVKLGICIGATFFGMQAPMLFLHNAITKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+V+ + G QSV L+EE+ LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICLESGMSIEVAFRKVSTETGNQSVALAEELTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N  NRT ++ V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLANRTGVEGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMRMTEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLPVL +VI+GP  + I   M
Sbjct: 299 PMIVFFLPVLFVVILGPTGIKIAAQM 324


>gi|304320652|ref|YP_003854295.1| hypothetical protein PB2503_05397 [Parvularcula bermudensis
           HTCC2503]
 gi|303299554|gb|ADM09153.1| hypothetical protein PB2503_05397 [Parvularcula bermudensis
           HTCC2503]
          Length = 338

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 125/324 (38%), Positives = 194/324 (59%), Gaps = 2/324 (0%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
             F +     +  +A+  AV +F  I  +V+P      L+KR+K VA  +E LR+Q    
Sbjct: 2   QEFIEAAVDRQNQIAMLAAVGVFLTIVTLVMPLFADNGLDKRVKKVADYKERLRQQSRAE 61

Query: 63  LQKDSASSRLRTRDSKSL-RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           L        LR   +  + +  V++L L  I        +L  AG R E  +   ++ R+
Sbjct: 62  LAGSRKPGSLRNATAGGMGKRLVEQLKLFEIFDAAAARKQLMMAGLRGERPVFTYMLARV 121

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           + P+  L++ I +++  + +    F +R+   I    +G+  P++++ NLV KR+  I+ 
Sbjct: 122 ITPVAALLVAIFYLYVLEVVEVASF-MRLILCIGALALGYYLPNIYVHNLVTKRKQKIQL 180

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           ++PD+LDLLLICVESG+SI+ AL++V E++      L+EE  LT AELS+L +R+VA+ N
Sbjct: 181 SFPDSLDLLLICVESGMSIEAALQKVTEEVAASCPELAEEYGLTTAELSYLQDRKVAYHN 240

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT ++ V++ T ALIQS+ YGT++G SLRV+ +E R  R+  AEKKAA+L PKLTVP
Sbjct: 241 LGERTGLEGVKSVTTALIQSEVYGTALGASLRVMAAENREIRMQNAEKKAAALPPKLTVP 300

Query: 302 MIIFFLPVLILVIIGPAILSIIDT 325
           MI+FFLPVL +VI+GP +L    T
Sbjct: 301 MILFFLPVLFVVILGPGVLKATST 324


>gi|39936745|ref|NP_949021.1| type II secretion system protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292571|ref|YP_001993176.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
 gi|39650601|emb|CAE29124.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192286320|gb|ACF02701.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
          Length = 324

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 141/325 (43%), Positives = 198/325 (60%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +  + F        +  A++  + +Y +VIP      L KRMK+V  ERE LR+++ 
Sbjct: 1   MLDFLIEKFHDARFMATLLAAIAASATVYTLVIPFFVGETLAKRMKAVGSERERLRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    K +   V+  NL   L  E+  +KL  AG+R +      L  R
Sbjct: 61  DRLAKAEKVS-LRQAPKKFVARVVEDFNLAKWLAQESARDKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V+PI F     +++F      + P  +++G  +   + G  AP +++ N +QKRQ SIK
Sbjct: 120 MVMPIAFGAASALYVFVIAN-FDQPLTIKIGMCVAAIFFGMQAPMLFLKNAIQKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A RRV+ +IG QS+PL+EE  LT AELS+L +R+ A+E
Sbjct: 179 RAFPDALDLLLICIESGMSIETAFRRVSIEIGSQSIPLAEEFTLTTAELSYLQDRKQAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLALRTGLDGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + I   
Sbjct: 299 PMIVFFLPVLFVVILGPTGIRIAAM 323


>gi|115525754|ref|YP_782665.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519701|gb|ABJ07685.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
          Length = 324

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 141/325 (43%), Positives = 203/325 (62%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M +   D F      + +  A++  + +Y ++ P   +  L KRMK+VA ERE +R+++ 
Sbjct: 1   MFNLLIDKFHDPRFMMMLFAAIAASATVYTLITPLFANEGLNKRMKTVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+  NL   +  EN   KL  AG+R +      L  R
Sbjct: 61  DRLAKTERVS-LRQSPKRLVAKVVEDFNLGKWVAQENARQKLLMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V P+IFL+   +++F   K+   P  L++   I   ++G  AP ++++N + KRQ SIK
Sbjct: 120 MVTPLIFLVATALYVFLVAKM-NQPTALKIAICIAATFLGMQAPMLFLTNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLICVESG+SI+ A R+V+ +IG QS+PL+EE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICVESGMSIEVAFRKVSVEIGTQSIPLAEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAKRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + I   
Sbjct: 299 PMILFFLPVLFVVILGPTGIRIAAM 323


>gi|110636326|ref|YP_676534.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287310|gb|ABG65369.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 329

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 151/321 (47%), Positives = 208/321 (64%), Gaps = 4/321 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
                      +A+  ++++F+ I+ VV P  G   L+ RMK+VA+ERE LR +Q   L 
Sbjct: 4   VVTTLTDPSFLLALLVSIAVFATIFTVV-PVGGGDPLKARMKTVALEREELRAKQRARLA 62

Query: 65  KDSASSR---LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
            ++   R   LR  D  S+R  V +L+L+  L DE+ V  LR AG+R +  L   L  RL
Sbjct: 63  AEAERRRAGGLRREDRSSMRAIVDQLDLRRALADESTVAMLRTAGYRGQSPLTRFLFFRL 122

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           V+P   L+L + +IF    L      +R+   IL  Y GF  P ++ISN   KR+ SI+ 
Sbjct: 123 VLPPAGLMLALFYIFVMGGLAAQSLPIRIFVCILAAYGGFYLPVLYISNQASKRKKSIQL 182

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           AWPDALDLLLICVESG+S++QA RRVA++IG QSV L+EE++LT AELSFL  R+ A+EN
Sbjct: 183 AWPDALDLLLICVESGVSVEQAFRRVADEIGTQSVALAEELVLTTAELSFLQERRQAYEN 242

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT ++ V++ +QALIQ++RYGT I  +LRVL  E+R  R+  AEKKAA+L PKLTVP
Sbjct: 243 LAARTGLESVKSVSQALIQAERYGTPISQALRVLADESREARMNAAEKKAAALPPKLTVP 302

Query: 302 MIIFFLPVLILVIIGPAILSI 322
           MI+FFLPVL  +I+GPA + +
Sbjct: 303 MILFFLPVLFAIILGPAAIQL 323


>gi|86748902|ref|YP_485398.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
 gi|86571930|gb|ABD06487.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
          Length = 324

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 136/325 (41%), Positives = 199/325 (61%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     + F        +  A+++ + +Y +V+P L    L KRMK+V  ERE LR+++ 
Sbjct: 1   MIDLLIEKFHDARFMTMLLAAIAVSATVYTLVMPLLVGETLAKRMKAVGSERERLRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V  LNL   +  E+  +KL  AG+R +      L  R
Sbjct: 61  DRLAKAERVS-LRQAPKQFVAKIVDDLNLGKWVAQESARDKLVMAGYRGQAPYITFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V+PI F +   +++F    + +    ++V   I   ++G  AP +++ N + KRQ SI+
Sbjct: 120 MVMPIAFGLAAALYVFVLSNM-DQSTPIKVAICIGCVFLGMQAPMLFLKNAITKRQLSIR 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+VA +IG QS+PL+EE  LT AELS+LP+R+ A+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEAAFRKVAVEIGTQSIPLAEEFTLTTAELSYLPDRKQAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D V++   AL QS+RYGT +  S+RV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAKRTGLDGVKSVCLALQQSERYGTPLSQSIRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMILFFLPVLFVVILGPTGIRVAAM 323


>gi|326388860|ref|ZP_08210442.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206460|gb|EGD57295.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 339

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 103/316 (32%), Positives = 174/316 (55%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
                  +   ++  +++ A+         + KR+KS+   RE L+   + +  K   S 
Sbjct: 19  DVVFVGTVLAGLAAVAVVLAIYAAVTVRDPMAKRVKSLNERREELKAGIVVAASKKRTSI 78

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             R   +  +R+ +++L +           KL  AG R +     ++  R++ P++   L
Sbjct: 79  VRRNETTDRIRSILERLRVLQDSQLATAQQKLAQAGIRKKEWGVAVIFGRMIGPMVLGGL 138

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             ++I+G +    +P   + GA  ++   G+  P V+++NL+ KR ++I++  PDALDLL
Sbjct: 139 AALFIYGLNYFPTWPDYKKFGAFAVMVLAGYKGPDVFVANLIGKRTNAIRKGLPDALDLL 198

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +IC E+G++ID A  RVA ++G     L +E  LT  ELSFL  R+ AFEN   R  ++ 
Sbjct: 199 VICAEAGLTIDAAFSRVARELGRAYPELGDEFSLTAIELSFLTERRSAFENLAYRVNLES 258

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +R     +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +T+P+I+F LP L
Sbjct: 259 MRGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTIPLILFILPTL 318

Query: 311 ILVIIGPAILSIIDTM 326
            +VI+GPA  S+ D  
Sbjct: 319 FVVILGPAACSLSDNF 334


>gi|254504440|ref|ZP_05116591.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222440511|gb|EEE47190.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 324

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 132/322 (40%), Positives = 204/322 (63%), Gaps = 3/322 (0%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
           +   + +   A    +++   I+++V+P L    L+ RMK+VA+ER+ LR ++   LQ  
Sbjct: 4   ETIASAQFLAAFLAMIAVTGTIFSLVMPLLSRDTLKSRMKNVALERDKLRAKERARLQTS 63

Query: 67  SASSR--LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
              +R  LR +    ++NFV +LNLK +L D++  ++LR AG+R    +   L  R+ +P
Sbjct: 64  QGDARMSLRNQPKAKMKNFVDRLNLKEMLADDSTQDRLRMAGYRGSAPIYYFLTARIAIP 123

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
               +  + + F        P   +V   I+   +G   P++++ N + KR+  I+RAWP
Sbjct: 124 GGLFVFALAYAFLLAP-NTIPAFSKVLFCIVFSGLGAFFPNIYLKNQIDKRKLGIQRAWP 182

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDL+LICVESG+SI+ A ++VAE+IG QSV L+EE+ LT AELS+L  R++A+EN   
Sbjct: 183 DALDLMLICVESGMSIEAAFQKVAEEIGAQSVELAEELSLTTAELSYLSERRMAYENLAK 242

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT +D V+N   ALIQ++RYGT +G ++R +  +TR+ER+  AE+KAASL PKLTVPMI+
Sbjct: 243 RTGVDGVKNVMMALIQAERYGTPVGTAIRNMADDTRAERMQFAEQKAASLPPKLTVPMIM 302

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
           FFLPVL  VI+ PA++  +   
Sbjct: 303 FFLPVLFFVILTPAVIQAMGAF 324


>gi|103486613|ref|YP_616174.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98976690|gb|ABF52841.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 347

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 109/310 (35%), Positives = 177/310 (57%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +  A+ +F+++ A+         + KR+K++   RE L+     S  K  A    + + +
Sbjct: 31  LLAAIGVFAVLVAIYNALTVRNPMTKRVKALNERREQLKAGITASTAKRRARLVRKNQTA 90

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
             +RNF+ +L +      + +  KL  AG RS+     ++  R+V+PI+F  L +  I+ 
Sbjct: 91  DRMRNFLGRLQVLQEGQIKEVQQKLAQAGIRSKDLAVAVIFGRMVLPILFGGLALFLIYI 150

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
            D         R G  +    +G+ AP +++ N+ QKR  +I++  PDALDLL+IC E+G
Sbjct: 151 VDMWPTLTPFKRSGFTMAALILGYKAPDLFVDNMRQKRTDAIRKGLPDALDLLVICAEAG 210

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +++D A  RV++++G     L EE  LT  EL FL  R+ AFEN   R  ++ V+     
Sbjct: 211 LTVDSAFSRVSKELGRAYPELGEEFALTSIELGFLTERRQAFENLAYRVNLESVKGVVTT 270

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+++YGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL +VI+GP
Sbjct: 271 MIQTEKYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVLFIVILGP 330

Query: 318 AILSIIDTMK 327
           A  S+ D M 
Sbjct: 331 AACSLSDAMA 340


>gi|85373127|ref|YP_457189.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
 gi|84786210|gb|ABC62392.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
          Length = 331

 Score =  192 bits (487), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 104/317 (32%), Positives = 179/317 (56%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
              L  +I   ++  +++ A+         + KR+K++   R+ L+   + S  K   S 
Sbjct: 14  DVILVGSILAGLAALAVMMAIYAAVTIKDPMAKRVKALNERRDELKAGIVKSSGKKRQSL 73

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             +T  ++ +++ ++ + +      E I  KL  AG R++    +++  RLV+PI+   +
Sbjct: 74  VRKTDQTEKVKDTLQNMKVLQQSQIEVIQQKLAHAGIRNKELAVVVIGARLVLPIVLGGI 133

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             + ++G D   E+    R  A+++   +G+  P + + N   KR  +I++  PDALDLL
Sbjct: 134 VALVVYGLDFFPEWGAMKRYAALVVAMGLGYKGPEMLLKNKAAKRTDAIRKGLPDALDLL 193

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +IC E+G+++D A  RVA+++G     L +E  LT  ELSFL  R+ AF+N   R  ++ 
Sbjct: 194 VICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAIELSFLTERKQAFDNLAYRVDLEA 253

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V+     ++Q++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL
Sbjct: 254 VKGVVTTMVQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPVL 313

Query: 311 ILVIIGPAILSIIDTMK 327
            +VI+GPA  SI D   
Sbjct: 314 FIVILGPAACSISDAFS 330


>gi|110632959|ref|YP_673167.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283943|gb|ABG62002.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 323

 Score =  192 bits (487), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 135/312 (43%), Positives = 190/312 (60%), Gaps = 1/312 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
                 A+  AV+ FS +  V  P L    L +RM  V  ERE+LRKQ+   L       
Sbjct: 9   EPGQLSALMAAVAAFSSVIVVSWPYLFRDNLARRMAKVENERELLRKQERARLAMQKRLP 68

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR+   K  +  V +  L     +  +V++LR AG+R    +   L VRL+ PI    +
Sbjct: 69  SLRSEPRKLFKQIVDRFKLAKQGDNGQLVDRLRRAGYRGNAPVITFLAVRLIAPIAIFAV 128

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            + ++    K  + P    +G    +G  G+  P+++I N + KRQ +I+RAWP+ALDLL
Sbjct: 129 SLTYVLLILK-PDLPLFAILGIAAALGGFGYFVPALYIRNKITKRQKAIQRAWPEALDLL 187

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LICVESG+SI+ A R+VAE+IG QS  ++EE+ LT AELSFL +R+ A+EN   RT ++ 
Sbjct: 188 LICVESGMSIESAFRKVAEEIGTQSAEIAEEIALTTAELSFLQDRRQAYENLGRRTGVEG 247

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR A  +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPVL
Sbjct: 248 VRAAVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMIVFFLPVL 307

Query: 311 ILVIIGPAILSI 322
             VII PA + I
Sbjct: 308 FAVIITPAAIQI 319


>gi|114798130|ref|YP_761686.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738304|gb|ABI76429.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 135/329 (41%), Positives = 197/329 (59%), Gaps = 6/329 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +    F   +   A   A ++F     + +P L   +LE R+K+VA +RE LRKQ  
Sbjct: 1   MYDFLVS-FTKPQTLAAYLVAAAVFGTFMTIFLPYLQGNKLETRLKAVASQREKLRKQSR 59

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            +L+K      LR +D   + +   KLNL   L D N+V  +  AG R    ++     R
Sbjct: 60  AALEKKG----LRRKDDSVVGSISSKLNLAQALEDPNVVKLMNQAGLRGPGPISAFYFAR 115

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           + +P     L   +IF  +        ++ G+VI     GF AP+++ISNL QKRQ S+ 
Sbjct: 116 MAMPFAGAGLMFFYIFFVNDH-GLSQFMKYGSVIFGAAAGFYAPNLYISNLAQKRQKSLM 174

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALD+LLICVE+G+SI+    +V+++IG  S  L+EE  +T+AELS+LP+R++A+E
Sbjct: 175 RAFPDALDMLLICVEAGMSIEMGFNKVSQEIGSASPELAEEFGITVAELSYLPDRRLAYE 234

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT  + V+    AL Q++RYGT +GD+LR++  E R  R+ EAEKKAASL  KLTV
Sbjct: 235 NLALRTGHEGVKAVCMALGQAERYGTPLGDALRMMAKENREMRMSEAEKKAASLPAKLTV 294

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           PMI+FFLPVL LV++GPA +      K++
Sbjct: 295 PMILFFLPVLFLVVLGPAYIQYQAMQKEN 323


>gi|27376545|ref|NP_768074.1| pilus assemble protein [Bradyrhizobium japonicum USDA 110]
 gi|27349686|dbj|BAC46699.1| pilus assemble protein [Bradyrhizobium japonicum USDA 110]
          Length = 324

 Score =  191 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 137/325 (42%), Positives = 198/325 (60%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +             +  A++  + +Y +V+P      L KRMK+VA ERE +R+++ 
Sbjct: 1   MVEFLVSKLHDVRFMTMLLAAIAASATVYTLVMPLFAGEGLSKRMKAVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+  NL   L  E   +KL  AG+R +      L  R
Sbjct: 61  ERLNKSEKVS-LRQTPKQLVSKVVEDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFAR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V PI   +  ++++F     +E P  +++G  I   Y+G  AP +++ N + KRQ SIK
Sbjct: 120 MVAPITLFVGSVLYVFLIA-HMEKPVPVKIGICIGAAYLGLQAPMLFLKNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+S++ A R+VA +I GQS+ LSEE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICIESGMSVEMAFRKVATEIVGQSIALSEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL Q++RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLARRTGLEGVKSVCLALQQAERYGTPLGHSLRVMAQENRDMRMTEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + I + 
Sbjct: 299 PMILFFLPVLFVVILGPTGIKISEM 323


>gi|159043673|ref|YP_001532467.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
 gi|157911433|gb|ABV92866.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
          Length = 331

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/318 (28%), Positives = 158/318 (49%), Gaps = 3/318 (0%)

Query: 14  LAVAITTAVS--IFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           L VA    +   + +     ++  L    L ++ K   ++ +  R        +D    +
Sbjct: 10  LLVAYLGPLGPVLAAGFLGAMLILLTLPFLLRKEKDPLLKIKQERLGTAKRAAEDGKGKQ 69

Query: 72  LRTRDS-KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           LR  D  K L  F + L  +       I  KL  AG+R + S+ I    +L + + FL +
Sbjct: 70  LRQDDPGKKLERFSQYLEPQDNEELSAIRLKLIQAGYRQKSSVQIFHFAQLALGLGFLSI 129

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G+I+ F +    +          ++ G+ G+  P  W+   + KRQ  I   +PD+LDL+
Sbjct: 130 GVIYTFFFGGGEDPDVTKATLTTLVPGFCGYYLPKYWVDKRIDKRQEEITNGFPDSLDLM 189

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           L+CVE+G  +DQA+ RVA +I      L++E  +   E+    ++    ++   R  +  
Sbjct: 190 LVCVEAGQGLDQAIIRVAHEIRAGYPDLADEFEMVAFEIKAGKDKITVLKDMAERCGVGD 249

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V +    LIQS  +GTSI D+LRV   E R +R+M AE+KA  L  KLT+  ++F +P L
Sbjct: 250 VTSFVTVLIQSQSFGTSIADALRVYAGEMRDKRVMRAEEKANVLPTKLTLGTMMFTVPPL 309

Query: 311 ILVIIGPAILSIIDTMKD 328
           ++++IGP++ SI +++  
Sbjct: 310 LIILIGPSMWSIYESLSQ 327


>gi|255264846|ref|ZP_05344188.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255107181|gb|EET49855.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 323

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 81/302 (26%), Positives = 153/302 (50%), Gaps = 3/302 (0%)

Query: 26  SLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVK 85
            L+  V+   L    L   +K      + L++  +T  Q+D   S    + +  L  +  
Sbjct: 21  LLVVGVLGMFLILLTLPVLLKKQEDPLDKLKRNNVTPGQRD---SLRFNQGTDKLDKYAD 77

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
            L  +       I  KL  AG+R + ++      +  + I  L+ G+ +        E  
Sbjct: 78  FLEPQDEEEYSAIRLKLLQAGYRGKSAVRTFHFAQFALGIALLLAGVAYAIYNSTAGEPS 137

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
            Q  + ++++ G VG+ AP  W++   Q RQ +I   +PD+LD++L+CVE+G S+DQ++ 
Sbjct: 138 TQSTIMSILIPGCVGYMAPKYWVTKRQQTRQEAITNGFPDSLDMMLVCVEAGQSLDQSIL 197

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           RV++++      L+ E  +   E+    ++     +   R  +  + +    LIQS  +G
Sbjct: 198 RVSQELKSGFPDLASEYEIVSHEMKAGKDKTSVLRDMSERCGVPDIASFVTVLIQSQSFG 257

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           TSI ++LRV   E R +R+M AE+KA +L  K+T+  ++  +P L++++IGP++  I +T
Sbjct: 258 TSIAEALRVYAGEMRDKRVMRAEEKANTLPTKMTLATMMLTVPPLLIILIGPSVYGIAET 317

Query: 326 MK 327
           +K
Sbjct: 318 LK 319


>gi|296284556|ref|ZP_06862554.1| hypothetical protein CbatJ_13056 [Citromicrobium bathyomarinum
           JL354]
          Length = 342

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 106/322 (32%), Positives = 182/322 (56%), Gaps = 1/322 (0%)

Query: 7   DLFDATELAVA-ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            L     +AVA +   ++  +++ A+         + KR+K++   R+ L+   +    +
Sbjct: 20  TLMGVDVIAVATVLAGIAAMAVMLAIYAAVTVRDPMAKRIKALNERRDELKAGIVRETAR 79

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
              S   RT+ +  +++ +    +      E +  KL  AG R++     ++  R V+PI
Sbjct: 80  KRKSLVRRTQKTDKVKDTLANFKVLQQSQLEVVQQKLAHAGIRNKEYAVYVIGARAVLPI 139

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           +  ++     +  D   ++    R+GA+ +  ++G+  P ++I+N  +KR  +I++  PD
Sbjct: 140 VLGLIAFYLFYVSDMFADWGSFKRLGALSIAVFIGYKGPELYIANKAKKRTDAIRKGLPD 199

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC E+G++ID A  RVA+++G     L +E LLT  ELSFL NR++AF+N   R
Sbjct: 200 ALDLLVICAEAGLTIDSAFTRVAKELGRAYPELGDEFLLTSIELSFLNNRKMAFDNLAYR 259

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             ++ V+     +IQ++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F
Sbjct: 260 VDLEAVQGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLILF 319

Query: 306 FLPVLILVIIGPAILSIIDTMK 327
            LP L +VI+GPA  SI D   
Sbjct: 320 ILPTLFIVILGPAGCSIADAFS 341


>gi|302381751|ref|YP_003817574.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192379|gb|ADK99950.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 333

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 123/317 (38%), Positives = 194/317 (61%), Gaps = 3/317 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
                ++I   + +F+ +  ++    G   L+KRM++V+V R+ L+++   ++   +   
Sbjct: 6   EPRTLISIVVGLLVFATMLTLLSSMGGGVSLDKRMQAVSVRRDELKRRSRQAIA--NGQG 63

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR  D    +  V +LNL  +L D  +  ++  AG R    L      R   P IF+  
Sbjct: 64  GLRHTDDGFKKRVVDRLNLVKLLEDPKVAEQMIQAGLRGPRPLTTFYFFRFATPFIFMFA 123

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++++F  +        +R+G V+     GF  P++++ N + KRQ SI +A+PDALDLL
Sbjct: 124 AVLYVFVMND-FGLSVTVRLGIVMFATVAGFYGPNIFLKNRIAKRQLSIMQAFPDALDLL 182

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LICVE+G+SI+ A+ +V+++IG  SV L+EE+ L  AELS+LP R++A+E    RT    
Sbjct: 183 LICVEAGMSIEAAIVKVSQEIGTTSVELAEELALLSAELSYLPERRMAYEGLAKRTNHPG 242

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR+ + A+IQ+++YGT +G +LR +  E R  RL  AEKKAA+L  +LTVPMIIFFLPVL
Sbjct: 243 VRSVSTAMIQAEQYGTPLGSALRTMAKENRDLRLSAAEKKAAALPAQLTVPMIIFFLPVL 302

Query: 311 ILVIIGPAILSIIDTMK 327
            +VI+GPAI++I DT+K
Sbjct: 303 FVVILGPAIINIQDTLK 319


>gi|209886535|ref|YP_002290392.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874731|gb|ACI94527.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 142/327 (43%), Positives = 204/327 (62%), Gaps = 2/327 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     D    T+       A++  +  YA++ P      L +RMK+VA ERE +R+++ 
Sbjct: 1   MLDLLIDKLHDTQFLTMTFAAIAASATAYALISPMFAGDGLARRMKAVASERERMRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             + ++     LR    + ++  V++ NL   L  E    KL  AG+R        L  R
Sbjct: 61  ERMNRNEKV-TLRQSPKQVVQRVVERFNLGKWLAQEEAKEKLIMAGYRGHAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV P++FLI   ++IF    L E    +++G  IL  ++G  AP +++ N + KRQ SIK
Sbjct: 120 LVAPVVFLIATALYIFVILNL-EQTMTIKIGICILAAWLGMQAPMLFLKNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLICVESG+SI+ A R+V+ +IG QSVPL+EE+ LT AELS+L +R++A+E
Sbjct: 179 RAFPDALDLLLICVESGMSIEAAFRKVSVEIGSQSVPLAEELTLTTAELSYLQDRKMAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL+QS+RYGT +G +LRV+  E R  R+ EAEKKAASL PKLTV
Sbjct: 239 NLQKRTGLEGVKSVCMALMQSERYGTPLGQTLRVMAQENRDMRMNEAEKKAASLPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMK 327
           PMI+FFLPVL +VI+GP  + +   MK
Sbjct: 299 PMIVFFLPVLFVVILGPTWIKVAAYMK 325


>gi|154250694|ref|YP_001411518.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154644|gb|ABS61861.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 322

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 195/313 (62%), Gaps = 3/313 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
             + E  V + TAV+ F+ I+ +  P L + +L  RMK V+ ERE +R +   +L ++  
Sbjct: 8   MFSIENVVTLLTAVAAFATIFTLTAPLLNTDKLSTRMKYVSTEREAMRARAREALAQEKT 67

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
             RLR      ++  V+K     +L +  +  KLR AGFR    +   +  R V+P +  
Sbjct: 68  --RLRHTPKGFIKQVVEKFASGNMLENAAVKEKLRQAGFRGPGPMYTFVFFRFVMPPVLF 125

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++ ++++   +     P   R+       +VGF  P++++ N++ +RQ SI++A+PDALD
Sbjct: 126 VVTLLYMVFVNDFGLQP-MARLAVSCAAAFVGFYLPNLFVENVISRRQDSIRKAFPDALD 184

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+LICVESG+SI+ A ++VA +IG QSV L+EE+ LT AELS+L  R++A+EN   RT +
Sbjct: 185 LMLICVESGMSIEAAFQKVAAEIGAQSVELAEELGLTTAELSYLQERRMAYENLARRTGL 244

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             V+     LIQ++RYGT +G +LRV+  E R  R+ EAEKKAA L PKLTVPMI+FFLP
Sbjct: 245 PGVKAVATTLIQAERYGTPLGQALRVMAQENRDMRMAEAEKKAAGLPPKLTVPMILFFLP 304

Query: 309 VLILVIIGPAILS 321
           VL  VI+GPAI+ 
Sbjct: 305 VLFGVILGPAIIK 317


>gi|149186259|ref|ZP_01864573.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
 gi|148830290|gb|EDL48727.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
          Length = 329

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 111/318 (34%), Positives = 185/318 (58%), Gaps = 1/318 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
              L  +I   ++ F++I+A+         + KR+K++   RE L+   +T+  K   S 
Sbjct: 13  DVILVGSILAGIAAFAVIFAIYTAVTIKDPMAKRVKALEGRREELKLGLVTAGAKKRQSL 72

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             +T  +  +R  +  + +      + +  KL  AGFR++    IL+ +R+V+PI+F  +
Sbjct: 73  VRKTNTTDKVRETLGNMKVLQDSQVQMMQQKLAWAGFRNKEVAVILIGLRMVLPIVFGSI 132

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             I ++G +   ++ F  RV A+    + G+  P +++SN+  KR  +I++  PDALDLL
Sbjct: 133 AAILLYGIEIYPDWQF-KRVAALAFAVFAGYKGPEIYLSNIASKRTDAIRKGLPDALDLL 191

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +IC E+G+++D A  RVA+++G     L +E  LT  ELSFL  R+ AF+N   R  ++ 
Sbjct: 192 VICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAIELSFLNERKKAFDNLAYRVNLEA 251

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V+     ++Q++RYGT +  +LRVL +E R+ER+M AE+KAA L   +TVP+I+F LPVL
Sbjct: 252 VKGVVTTMVQTERYGTPLASALRVLSAEFRNERMMRAEEKAARLPAIMTVPLIMFILPVL 311

Query: 311 ILVIIGPAILSIIDTMKD 328
            +VI+GPA  SI D    
Sbjct: 312 FIVILGPAACSIADAFSK 329


>gi|16127170|ref|NP_421734.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|221235971|ref|YP_002518408.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
 gi|13424566|gb|AAK24902.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|220965144|gb|ACL96500.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
          Length = 362

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 130/326 (39%), Positives = 197/326 (60%), Gaps = 4/326 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK---QQIT 61
             +   +    +    AV +F+ I  +  P +    LE R+KSVA  RE LR+   Q I+
Sbjct: 38  LVETLTSPSNVLTAFIAVVVFATIITLASPVMRDNNLEGRLKSVANRREELRRRSRQSIS 97

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           +    +A   LR +D    +N V++L L  +L D  +V KL  AGFR    ++     R 
Sbjct: 98  TRAPGTAGGTLRHQDEGLYKNVVERLQLSRLLEDPKVVEKLAQAGFRGPKPVSTFYFFRF 157

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
            +P  F      +++  +     P   ++ A +    +G+ AP+V+ISN+ QKR+ SI  
Sbjct: 158 AMPFAFAAGAAFYLYVVNDFGLLP-MQKLCACVAFLALGYYAPNVYISNVAQKRRESIVA 216

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PDALDLLLICVESG+SI+ A+++V  ++G  S+ L+EE+ L  AELS+LP+R++A+EN
Sbjct: 217 AFPDALDLLLICVESGMSIEAAIQKVGAEVGSSSMELAEELSLLTAELSYLPDRRLAYEN 276

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RT    +++   A+IQ++RYGT +G +LRV+  E R  RL  AEKKAA+L  +LTVP
Sbjct: 277 LARRTNHPGIKSVATAMIQAERYGTPLGTALRVMAKENRELRLSAAEKKAAALPAQLTVP 336

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMK 327
           MI+FFLPVL ++I+GPAI+ + D  K
Sbjct: 337 MILFFLPVLFIMILGPAIMKVQDAFK 362


>gi|84501671|ref|ZP_00999843.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390292|gb|EAQ02851.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 330

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/325 (26%), Positives = 151/325 (46%), Gaps = 12/325 (3%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           + +   D+         +     +  L+    +P +   E++              KQ  
Sbjct: 4   LTNILTDMMGP---LGPLIVVGGLGVLMIVGALPFMLKKEVD---------PLEKLKQNG 51

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
           T    D+       + ++ L  +   L  +       +  KL  AG+RS+ S+      +
Sbjct: 52  TPATADNKDKLRNNKRNQRLERYSSFLEPQNEKEYSAMRIKLLQAGYRSKDSVRYFHFAQ 111

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
             + I  L+ G+I+        +   Q  V  ++  G VG+  P  WI+    +RQ  I 
Sbjct: 112 FALGIFGLLGGVIYFIAVKAADQPDTQTTVMYILGPGGVGYLIPKYWINKRQAQRQEEIT 171

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
             +PDALD+LL+CVE+G S+DQA+ RVA++I      L++E  L   E+    ++     
Sbjct: 172 NGFPDALDMLLVCVEAGQSMDQAILRVAKEIRVSYPSLADEFELVSHEIKAGKDKASVLG 231

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           +   R  +  + +    LIQS  +GTS+ D+LRV  SE R +R+M AE+KA  L  K+T+
Sbjct: 232 DMAERCGVPDIASFVTVLIQSASFGTSVADALRVYASEMRDKRVMRAEEKANKLPTKMTL 291

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
             ++  +P L++++IGP++L I   
Sbjct: 292 ATMMLTVPPLLIILIGPSVLGITKM 316


>gi|91977990|ref|YP_570649.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
 gi|91684446|gb|ABE40748.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
          Length = 324

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 134/325 (41%), Positives = 197/325 (60%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +                A++  + +Y +VIP      L KRMK+V  ERE +R+++ 
Sbjct: 1   MIDFLVAKLHDARFMTMFLAAIAASATVYTLVIPLFVGETLAKRMKAVGSERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             + K    S LR    + +   V+ LNL   +  E   +KL  AG+R +      L  R
Sbjct: 61  DRIAKAERVS-LRQAPKQFVAKVVEDLNLGKWVAQETARDKLVMAGYRGQAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V+PI F I   +++F    + +    +++G  I   ++G  AP +++ N + KRQ SIK
Sbjct: 120 MVMPIAFGIASALYVFLLSNM-QQSTSIKIGMCIAGVFLGMQAPMLFLKNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A R+V+ +IG QS+PL+EE+ LT AELS+LP+R+ A+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEAAFRKVSIEIGTQSIPLAEELTLTTAELSYLPDRKQAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +  SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAIRTGLEGVKSVCLALQQSERYGTPLSQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMIVFFLPVLFVVILGPTGIRVSAM 323


>gi|254441173|ref|ZP_05054666.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251251|gb|EDY75566.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 326

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 71/283 (25%), Positives = 143/283 (50%)

Query: 45  MKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRA 104
           ++  A   + L+                 ++ +  L  +   L  +       I  KL  
Sbjct: 40  LQKKADPLDKLKASNYARDLSSRPEKLRASQGTDKLDKYSSFLEPQDEEEYSAIQLKLIQ 99

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+R++ ++      + ++ I+ L+ GI +        +      + +++  G  G+  P
Sbjct: 100 AGYRTKSAVKTYHFTQFMLGIVLLVGGITYAIYNSATGDPTTNATIMSILGPGMAGYYLP 159

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
             W+     +RQ  +   +PD+LD++L+CVE+G S+DQ++ RVA ++      L+EE  +
Sbjct: 160 KWWVGKRQAERQLEMINGFPDSLDMMLVCVEAGQSLDQSIIRVAHELKSGFPALAEEYQM 219

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
              E+    ++     +   RT +  + +    LIQS ++GTSI ++LRV  +E R +R+
Sbjct: 220 VSHEMKAGKDKTQVLRDMAERTGVADISSFVTVLIQSQQFGTSIAEALRVFSAEMRDKRV 279

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           M AE+KA +L  K+T+  ++  +P L++++IGP+I +I +T++
Sbjct: 280 MRAEEKANTLPTKMTLATMLLTVPPLLIILIGPSIYNIYETLQ 322


>gi|296444390|ref|ZP_06886355.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
 gi|296258037|gb|EFH05099.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
          Length = 329

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 131/327 (40%), Positives = 201/327 (61%), Gaps = 4/327 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M   F        L  ++  AV++ + + ++ +   G   L KRMKSVA ERE +R ++ 
Sbjct: 1   MFDTFVQYASNGRLMFSLMIAVAVVATVISIGLTFSGGDRLAKRMKSVASERERIRARER 60

Query: 61  TSLQKD---SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
            +       S    LR +    ++N V + +L   L   +   +L +AG+R   +    L
Sbjct: 61  AAANAKAKESGPKGLRQQPKVYMKNIVDRFSLDTWLNTGDAKMRLASAGYRGPQAEIAFL 120

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
             RLV PI F +L  I+ F      ++   +++G VI   YVG  +P ++++N + KRQ 
Sbjct: 121 FFRLVTPIAF-VLFGIFYFTVVDDSDWSLLVKIGVVIFAAYVGVKSPELFLTNAITKRQQ 179

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           S++ A+PDALDL+LICVESG+SI+ A R+V ++IG +SVPL+EE  L  AELS+LP+R+ 
Sbjct: 180 SMRIAFPDALDLMLICVESGLSIEHAFRKVGKEIGVRSVPLAEEFALATAELSYLPDRRQ 239

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           AF N   RT +DCV+     LIQ+++YGT +G +LRV   E+R  R+ EAE++AA+L PK
Sbjct: 240 AFHNLAARTGLDCVKQICTVLIQAEKYGTPLGRALRVTAQESRDMRMAEAERQAAALPPK 299

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIID 324
           LTVPMI+FFLPVL++V++ PAI+ ++ 
Sbjct: 300 LTVPMIVFFLPVLMVVVMAPAIIQVMS 326


>gi|316933034|ref|YP_004108016.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
 gi|315600748|gb|ADU43283.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
          Length = 324

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 142/325 (43%), Positives = 201/325 (61%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +  + F  T     +  A++  +  Y +V P +    L KRMK+V  ERE +R+++ 
Sbjct: 1   MVDFLIEKFHDTRFMATLLAAIAAAATAYTLVTPFIVGDTLAKRMKAVGSERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    K +   V+  NL   L  E+  +KL  AG+R +      L  R
Sbjct: 61  DRLAKAEKVS-LRQAPKKFVARVVEDFNLAKWLAQESARDKLVMAGYRGQAPYITFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV+P++F +   ++IF    L + P  +++G  I   + G  AP +++ N +QKRQ SIK
Sbjct: 120 LVMPVVFGLASALYIFVITDL-QQPLTVKIGICIAAIFFGMQAPMLFLKNAIQKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLIC+ESG+SI+ A RRV+ +IG QS+PL+EE  LT AELS+L +R+ A+E
Sbjct: 179 RAFPDALDLLLICIESGMSIEAAFRRVSIEIGSQSIPLAEEFTLTTAELSYLQDRKQAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAQRTGLDGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMIVFFLPVLFVVILGPTGIRLAAM 323


>gi|90425202|ref|YP_533572.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107216|gb|ABD89253.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
          Length = 324

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 137/325 (42%), Positives = 198/325 (60%), Gaps = 2/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M  +    F        +  A++  +  Y ++ P      L KRMK+VA ERE +R+++ 
Sbjct: 1   MFEFIIAKFHDVRFMTMLLAAIAASATAYTLITPLFAGESLSKRMKAVASERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L K    S LR    + +   V+  NL   +  E   +KL  AG+R        L  R
Sbjct: 61  DRLSKTERVS-LRQAPKQFVSKVVEDFNLGKWVAQEAARDKLVMAGYRGHAPYVTFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V+PI F++   ++IF     ++ P  +++   I   ++G  AP ++++N + KRQ SIK
Sbjct: 120 MVMPIAFMLATALYIFVIS-HMQQPLGIKIAICIAACFLGMQAPMLFLTNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLICVESG+SI+ A R+VA +IG QS+PL+EE  LT AELS+L +R+VA+E
Sbjct: 179 RAFPDALDLLLICVESGMSIETAFRKVAIEIGSQSIPLAEEFTLTTAELSYLQDRKVAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   AL QS+RYGT +G SLRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLAKRTGLEGVKSVCLALQQSERYGTPLGQSLRVMAQENRDMRMNEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VI+GP  + +   
Sbjct: 299 PMILFFLPVLFVVILGPTGIKVATM 323


>gi|110679391|ref|YP_682398.1| TadC family type II/IV secretion system protein [Roseobacter
           denitrificans OCh 114]
 gi|109455507|gb|ABG31712.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter denitrificans OCh 114]
          Length = 355

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/318 (22%), Positives = 145/318 (45%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
             D F      +          ++   +   +    +   +       E L++Q  T   
Sbjct: 28  MMDFFHNINALIIEYLGPLGPVILLGTLGLIMIGVTVALMLAQPEDPIEKLKRQIQTPET 87

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                   +   ++ L+ F   L  + +         LR AG++S+ ++      +  + 
Sbjct: 88  NAPEQRLRQGERNEQLQRFASFLEPQDVAELSARQLMLRQAGYQSQDAVRFFHFAQFALG 147

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I  L+L  +++        +  Q  +   I+ G VG+  P  W+   V  R+  I R +P
Sbjct: 148 IAGLVLAFVYLNLLGHGEGFTTQKMMIYTIIPGAVGYYLPVYWVRRRVDARKDEITRGFP 207

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D+LD++L+CVE+G S+DQ + RV++++      L++E  +   E+    ++     +F  
Sbjct: 208 DSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAYEMKAGKDKTTVLNDFGE 267

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  +  V +    L QS ++GTSI ++LRV   E R +R+M AE+ A  L  K+T+  ++
Sbjct: 268 RCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAEEMRDKRVMRAEEAANKLPTKMTLATMM 327

Query: 305 FFLPVLILVIIGPAILSI 322
             +P L+++++GP++  I
Sbjct: 328 LTVPPLLIILVGPSVHGI 345


>gi|260431089|ref|ZP_05785060.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414917|gb|EEX08176.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 327

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 77/306 (25%), Positives = 151/306 (49%), Gaps = 5/306 (1%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              V +  +   +V   +   + E  +K +               +K+      +   ++
Sbjct: 21  LIVVGVLGMFMILVTIPILLNQPEDPLKKL-----QRANSSQKRDRKNKKEQLRQASRNE 75

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L  F   L  K       +  KLR AG+ S+ ++      +  + II +++G++ +  +
Sbjct: 76  QLEKFASFLEPKDEQEYSAMQLKLRQAGYVSKDAVRFFHFAQFSLGIIGIVIGVLLVTVF 135

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
               E+  Q  +  V++ G +G+  P  WI+  V++R+ +I   +PD LDL+L+CVE+G 
Sbjct: 136 SNGQEFSGQQVLIRVLVPGAIGYYLPKYWITRRVEERKEAITAGFPDTLDLMLVCVEAGQ 195

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQA+ RVA ++      +++E  +   E+    ++     +F  R  +  V +    +
Sbjct: 196 SLDQAIVRVASEMKSSYPDIAQEFEIVAYEMKAGKDKNQVLRDFGTRCGVQDVSSFVTVM 255

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +P L+++++GP+
Sbjct: 256 IQSATFGTSIADALRVYAGEMRDKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVGPS 315

Query: 319 ILSIID 324
              I++
Sbjct: 316 AKGIME 321


>gi|149915637|ref|ZP_01904163.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
 gi|149810529|gb|EDM70372.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
          Length = 328

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 75/328 (22%), Positives = 153/328 (46%), Gaps = 11/328 (3%)

Query: 4   YFFDLFDATELAVA-----ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQ 58
            FF       +        +    ++  ++  +VIP L     +       +E+    ++
Sbjct: 2   QFFTQIQDMLIGALGPFGPVIAVGTLGIVLVLLVIPILIKDSKD------PLEKLKRDQR 55

Query: 59  QITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
           +         +     R ++ L  +   L  +       +   L  AG+R+  ++     
Sbjct: 56  ERAGAPGLDTTRLRTNRKNEKLDKYASFLEPQDAKALSQVRLTLLQAGYRTRDAVRYYHF 115

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
            +L + + FL LG+++   +    E   Q  +  ++  G +G+  P  W++   Q+RQ  
Sbjct: 116 AQLTLALGFLTLGVLYFLIFKSGGETSAQQTILYILGPGAIGYMLPKYWVTKRQQQRQED 175

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I   +PD+LD++L CVE+G S+DQ++ RV+ +I      L+EE  +   ++    ++   
Sbjct: 176 ITNGFPDSLDMMLTCVEAGQSLDQSIVRVSNEIAASYPALAEEYQIVANQIKAGRDKPSV 235

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
                 R  +  + +    L+QS  +GTSI D+LRV   E R +R+M AE+KA  L  K+
Sbjct: 236 LNEMAERCGVQDISSFVTVLVQSQTFGTSIADALRVYAGEMRDKRVMRAEEKANKLPTKM 295

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTM 326
           T+  ++  +P L+++++GP+++ I++  
Sbjct: 296 TLATMMLTVPPLLIILVGPSVIGILELF 323


>gi|307318085|ref|ZP_07597521.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306896126|gb|EFN26876.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 321

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 189/315 (60%), Gaps = 2/315 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             E   AI    S FS +  V  P +    L  RM+ V  ERE +R+++   L++ S  S
Sbjct: 9   DPEQLAAIMAGFSAFSAVVVVSWPYVFRDTLSDRMRRVEGERERIRQRERARLEEKSRVS 68

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P+     
Sbjct: 69  -LRVEPKRLFQAIVDRFRLAKQAEDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVAIFAA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            +++I       E P  L V     +G +G+ +P++++ N + KRQ SI+R+WP+ALDLL
Sbjct: 128 CLLYILLVV-RPEAPLLLVVAMAGAMGALGYFSPAIFVRNRITKRQQSIRRSWPEALDLL 186

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LI VE+G+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++ 
Sbjct: 187 LITVEAGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVEG 246

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPVL
Sbjct: 247 VRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMILFFLPVL 306

Query: 311 ILVIIGPAILSIIDT 325
             VII PA++ I+ T
Sbjct: 307 FAVIITPAVIQIMST 321


>gi|227818621|ref|YP_002822592.1| TadC, component of type IV pilus [Sinorhizobium fredii NGR234]
 gi|36958877|gb|AAQ87302.1| Tyrosine phenol-lyase [Sinorhizobium fredii NGR234]
 gi|227337620|gb|ACP21839.1| TadC, component of type IV pilus [Sinorhizobium fredii NGR234]
          Length = 323

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 191/312 (61%), Gaps = 1/312 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             +   A+ T ++ FS + AV  P +    L +RM+ V  ERE +R+++ T L  + +  
Sbjct: 9   DPDQLSAMLTGIAAFSAVVAVSWPYVFRNTLAERMRKVESERERIRQRERTRLNAEKSKV 68

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR    +  +  V + NL     + +I+ +L  AG+R    +   L  RL+ PI+    
Sbjct: 69  ALRAEPRRFFQAIVDRFNLAKQAENSDILRQLSMAGYRGYAPVTTFLAFRLIAPIVLFAA 128

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            +++I       + P    +     +G +G+ AP+++I N + KRQ +I+RAWP+ALDLL
Sbjct: 129 CLLYILLVL-RPQAPLLAVIAMAGAMGSLGYFAPAIFIRNRITKRQQAIRRAWPEALDLL 187

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LI VESG+ I+ A R+V E+IG QS  ++EE+LLT AELS+L +R+ AFEN   RT ++ 
Sbjct: 188 LITVESGMGIESAFRKVGEEIGAQSPEVAEEILLTTAELSYLQDRRQAFENLGQRTGVEG 247

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL
Sbjct: 248 VRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKKAAALPPKLTVPMIVFFLPVL 307

Query: 311 ILVIIGPAILSI 322
             VI+ PA + I
Sbjct: 308 FAVIVTPAAIQI 319


>gi|150377235|ref|YP_001313830.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150031782|gb|ABR63897.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 321

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 134/315 (42%), Positives = 194/315 (61%), Gaps = 2/315 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             E   AI    S FS +  +  P +    L +RM+ V  ERE +R+++   L++ S +S
Sbjct: 9   DAEQLAAIMAGFSAFSAVVVISWPYVFRDTLSERMRKVEGERERIRRRERARLEQKSKTS 68

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P++  + 
Sbjct: 69  -LRVEPKRLFQAIVDRFRLAKQADDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVVIFMA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            +++I       E P  L V   I  G +G+ AP++++SN + KRQ SI+R+WP+ALDLL
Sbjct: 128 CLLYIL-LAVRPEAPLLLVVAMAIATGALGYFAPAIFVSNRITKRQQSIRRSWPEALDLL 186

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LI VESG+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++ 
Sbjct: 187 LITVESGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVEG 246

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEKKAA+L PKLTVPMI+FFLPVL
Sbjct: 247 VRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKKAAALPPKLTVPMILFFLPVL 306

Query: 311 ILVIIGPAILSIIDT 325
             VII PA++ I++ 
Sbjct: 307 FAVIITPAVIQIMNM 321


>gi|90419769|ref|ZP_01227678.1| putative Flp pilus assembly protein TadC, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
 gi|90335810|gb|EAS49558.1| putative Flp pilus assembly protein TadC, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
          Length = 332

 Score =  182 bits (462), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 142/325 (43%), Positives = 209/325 (64%), Gaps = 4/325 (1%)

Query: 5   FFDLFD-ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREI---LRKQQI 60
            F L   +  +A ++  A+++F+   A+ +P L   +L+ RMK+VA+ER+      + ++
Sbjct: 7   MFALLGVSPAVAASLVMAIAVFTTFVAIAMPMLAGNQLKSRMKAVALERDEVRARERARM 66

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            +  +   S   +          V++LNL+  L D+  V+ LR AG+R +  L + L  R
Sbjct: 67  AAENERGRSGLRQQDSKGVASLVVERLNLRTALADDKTVSSLRNAGYRGQRPLTLFLFAR 126

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
            V+P++   L + ++FG   L  +P  +R+   + + YVGF AP  ++ N   KR+ SI 
Sbjct: 127 AVLPLLMFALALFYVFGLGLLDTHPTMMRIAICLGVAYVGFVAPIFFVKNRATKRRLSIS 186

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDLLLICVESG SI+ A RRVAE+IG QS+PL+EE++L  AELS+LP+R+VA++
Sbjct: 187 RAWPDALDLLLICVESGNSIEAAFRRVAEEIGIQSIPLAEELVLVCAELSYLPDRKVAYD 246

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D VR    AL+Q++RYGT +G +LR L  E R +R+  AEKKAA+L PKLTV
Sbjct: 247 NLATRTGLDGVRTVCTALVQAERYGTPLGTALRTLSQENRDQRMNLAEKKAAALPPKLTV 306

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL  VIIGPAI+ ++  
Sbjct: 307 PMIVFFLPVLFAVIIGPAIIKVMAV 331


>gi|329890992|ref|ZP_08269335.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846293|gb|EGF95857.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 330

 Score =  182 bits (462), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 132/326 (40%), Positives = 200/326 (61%), Gaps = 4/326 (1%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVA--VEREILRKQQIT 61
           F       +  ++I   V++F+ +  ++   +G G  L+KRMK+VA   E    R +Q  
Sbjct: 4   FMRFITDPQNLLSIGVGVAVFASVLTLLSSFVGGGARLDKRMKAVAERREELRRRSRQAM 63

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
                + +S LR  D       V +LNL  +L D  + + +  AGFR    LN     R 
Sbjct: 64  RGGAGNEASSLRRTDDSFRSRVVARLNLMKLLEDPKVADNMIQAGFRGPGPLNTFYFFRF 123

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
             P I + L   ++F   K  + P   +V  V++   VGF AP++++ N++ KR++SI  
Sbjct: 124 ATPFILMALTAFYLFVVVK-PDLPMMTQVAMVVMAAGVGFYAPNIYLKNMIDKRRASIMA 182

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PD+LDLLLICVESG+SI+ A+++V++++GGQS+ L+EE+ L  AELS+LP+R++A+E 
Sbjct: 183 AFPDSLDLLLICVESGMSIEAAIQKVSQEVGGQSIELAEELSLLSAELSYLPDRRMAYEG 242

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              RTQ   ++    A+ Q++ YGT +G +LRV+  E R  RL  AEKKAA+L  KLTVP
Sbjct: 243 MAKRTQHPGIKAVATAMTQAETYGTPLGSALRVMAKENRELRLSAAEKKAAALPAKLTVP 302

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMK 327
           MI+FFLPVL +VI+GPAI++I D MK
Sbjct: 303 MILFFLPVLFVVILGPAIINIQDMMK 328


>gi|170740616|ref|YP_001769271.1| type II secretion system protein [Methylobacterium sp. 4-46]
 gi|168194890|gb|ACA16837.1| type II secretion system protein [Methylobacterium sp. 4-46]
          Length = 321

 Score =  182 bits (461), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 130/292 (44%), Positives = 189/292 (64%), Gaps = 4/292 (1%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
           P L    L +RMKSV  ER+ +R ++   L +      LR +    ++  V++  L   L
Sbjct: 33  PFLEPNRLAQRMKSVGEERDRIRLRERDRLNQRGN---LRQQPKAYMKRVVERFKLDNWL 89

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             E+  N+L  AG+R   +    L  RLV+P+ FL+L + ++F   ++L  PF +R+  V
Sbjct: 90  ATEDAKNRLMMAGYRGPQAETAFLFFRLVMPLGFLVLAVFYLFVL-QVLNQPFSIRLLIV 148

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           I   Y G  AP +++ N   KRQ+ I++ WPDALDLLLICVESG++I+ A RRV  ++  
Sbjct: 149 IAATYGGVKAPEIFLKNQTDKRQAQIRKNWPDALDLLLICVESGMAIELAFRRVGVEMAN 208

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
           QS+ L+EE+ LT AELS+L +R+VA++N   RT +D V+    ALIQ++RYGT IG +LR
Sbjct: 209 QSIVLAEELALTTAELSYLTDRRVAYDNLAIRTGLDSVKAVCTALIQAERYGTPIGQALR 268

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           VL  E+R +R+ EAEKKAA+L PKLTVPMI+FFLPVL +VI+ PA++ +   
Sbjct: 269 VLAQESRDQRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILTPAMVQVFAA 320


>gi|126725975|ref|ZP_01741817.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
 gi|126705179|gb|EBA04270.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
          Length = 318

 Score =  182 bits (461), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 84/325 (25%), Positives = 154/325 (47%), Gaps = 13/325 (4%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
            +           +A+ +    F  +   +     +    K           L+     +
Sbjct: 6   DFLIAQLGELGPLIAVGSLGLGFMAVAGFMYMQGMNDPFNK-----------LKATDEKA 54

Query: 63  LQKDSASSRLRTRDS-KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
             K+S +S  + R+    L  + + L  K       +  KL  AG+ S+ ++     ++ 
Sbjct: 55  KAKESRTSLRQKRNKADQLDKYSEFLQPKDEGQLSEMRLKLLQAGYSSKSAVQTFHFLQF 114

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
            + II LI G I+ F          Q+ +      G  G+  P  W++     RQ +I +
Sbjct: 115 ALGIIGLIFGCIYAFTMLPDETTSKQMLMYIG-GPGGAGYMLPKYWVTRRRGTRQKNIIQ 173

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
           A+PD+LDL+LICVESG S+DQA+ +V+++I      L++E  L   E+    +++   ++
Sbjct: 174 AFPDSLDLMLICVESGQSLDQAIIKVSKEIRAGYPDLADEFELVAYEIKAGKDKKRVLKD 233

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           F  R  +  + +    LIQ+  YGT I ++LR   +E R +R+M AE+KA +L  K+T+ 
Sbjct: 234 FSERCGVPDISSFVSVLIQAATYGTPIAEALRAYSAEMRDKRVMRAEEKANTLPVKMTLG 293

Query: 302 MIIFFLPVLILVIIGPAILSIIDTM 326
            ++F LP L+++++GPA+  I   +
Sbjct: 294 TMVFCLPSLLIILVGPAVYKISQVL 318


>gi|299132291|ref|ZP_07025486.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
 gi|298592428|gb|EFI52628.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
          Length = 325

 Score =  181 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 137/326 (42%), Positives = 194/326 (59%), Gaps = 2/326 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     D          +  A++  +  YA++ P   S  L +RMK+VA ERE +R+++ 
Sbjct: 1   MLDMLIDKVQDVRFLTMVFAAIAASATAYALISPLFASDGLTRRMKAVANERERIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             +  +S    LR    + +   V   NL   L  E    KL  AG+R        L  R
Sbjct: 61  ERMN-NSERVTLRQSPKQFIGKIVHDFNLGKWLAQEEAKEKLVMAGYRGHAPYITFLFFR 119

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +V PI+ L +  ++IF   KL      +++G  I   + G  AP +++ N + KRQ SIK
Sbjct: 120 MVTPIVLLAVTALYIFVILKL-NQTTLVKIGICIGAAWFGMQAPMLFLKNAISKRQLSIK 178

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALDLLLICVESG+SI+ A R+V+ +IG QSV L+EE  LT AELS+L +R+ A+E
Sbjct: 179 RAFPDALDLLLICVESGMSIEAAFRKVSFEIGSQSVALAEEFTLTTAELSYLQDRKTAYE 238

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT +D V++   AL+QS+RYGT +G +LRV+  E R  R+ EAEKKAA+L PKLTV
Sbjct: 239 NLQKRTGIDGVKSVCMALMQSERYGTPLGQTLRVMAQENRDMRMTEAEKKAAALPPKLTV 298

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
           PMI+FFLP+L +VI+GP  + +   M
Sbjct: 299 PMIVFFLPILFVVILGPTGIKVAAYM 324


>gi|323137430|ref|ZP_08072508.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
 gi|322397417|gb|EFX99940.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
          Length = 323

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 130/321 (40%), Positives = 202/321 (62%), Gaps = 3/321 (0%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
             +        V+I TA+++ + I  + +P L +  L +RMKSV+ ERE +R+++    +
Sbjct: 4   IIEKLADGRFIVSILTAIAVIATILTIAMPLLNTDTLSRRMKSVSSERERIRQRERALAK 63

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
               +  LR      ++N V + +L   L  ++   KL +AGFR   +    L  RLV P
Sbjct: 64  TQGKA--LRQEPKFYMKNVVDRFSLSKWLNTDDAKLKLASAGFRGPQAEVAFLFFRLVTP 121

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I FL   + +++  D   +    L+   VI   Y+G  AP ++ISN +  RQ+S++RA+P
Sbjct: 122 IAFLFFALFYLYFLDD-SDMSSLLKTMIVIGATYLGVKAPELFISNTITNRQTSMRRAFP 180

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDL+LICVESG+SI+ A R+V  +IG QS+PL+EE  L  AELS+LP+R+ A+ N   
Sbjct: 181 DALDLMLICVESGMSIEHAFRKVGSEIGVQSIPLAEEFALATAELSYLPDRRTAYLNLAA 240

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT ++ V+  +  LIQ+++YGT +G +LR+   E+R  R+MEAEKKAA+L PKLTVPMI+
Sbjct: 241 RTGLESVKQISTVLIQAEKYGTPLGQALRITAQESRDMRMMEAEKKAAALPPKLTVPMIV 300

Query: 305 FFLPVLILVIIGPAILSIIDT 325
           FFLPVL++V++ PA + ++ +
Sbjct: 301 FFLPVLMVVVLSPAAIQVMQS 321


>gi|126729093|ref|ZP_01744907.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710083|gb|EBA09135.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 324

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/324 (22%), Positives = 156/324 (48%), Gaps = 2/324 (0%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           + D    A+      +   ++ A +   L    +   + +     + L++     +   +
Sbjct: 1   MLDQLNTAITDLLGPAGPLILVAGLAILLILATIPIMLNTKPDPLDKLKETSQKKMDAQA 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            +     R ++ L  + + L  +       I  KL  AG+R++ ++ +   ++  + +  
Sbjct: 61  RAVLRDKRRNEKLNKYAQFLEPQDAKELSEIKLKLLQAGYRTKDAVQVYYFMQFALGLGM 120

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L  G  +   +    E     ++  ++  G VG+ AP  WI+  ++KR+  I++ +PDAL
Sbjct: 121 LAAGTGYYLFFVNPEEADMTTKLMYILGPGCVGYLAPKYWITKRMEKRKEEIQQGFPDAL 180

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++L+CVE+G S++Q++ RVA+++      L++E  +   E+    +R     +   R  
Sbjct: 181 DMMLVCVEAGQSMEQSIIRVAKELRASYPALADEFEIISHEMKAGKDRSQVLNDMSERCG 240

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
              V +    L Q+  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +
Sbjct: 241 SQDVSSFVTVLNQAQTFGTSISDALRVYAGEMRDKRVMRAEEAANKLPTKMTLTTMMLTV 300

Query: 308 PVLILVIIGPAILSI--IDTMKDH 329
           P L+++++GP+ + I  +  M  +
Sbjct: 301 PPLLIILVGPSAVGITQMGAMAGN 324


>gi|84687272|ref|ZP_01015152.1| type II/IV secretion system protein, TadC subfamily protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664705|gb|EAQ11189.1| type II/IV secretion system protein, TadC subfamily protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 324

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 85/332 (25%), Positives = 158/332 (47%), Gaps = 19/332 (5%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGS----GELEKRMKSVAVEREILR 56
           +     D F      +A    + +  ++ A+ +          +L+K  K +  E   LR
Sbjct: 5   LTAILTDKFGPFGPLMA-LGGLGVLLIVGALPLLFKREEDPLNKLKKSQKELEEEHMALR 63

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNIL 116
           + +   +                L  +   L  +       I  +L  AG+  + ++   
Sbjct: 64  RTESGGMG-------------DKLEKYKSFLEPEDSEEYSAIQLRLLQAGYPGKNAVRTY 110

Query: 117 LVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQ 176
              +  + +  L  G+I+ F  +   E   Q  +  V++ G VG+ AP  W++  V  R+
Sbjct: 111 HFAQFALGLGLLFAGLIYSFITND-GETSTQKMIMTVLIPGAVGYVAPKYWVTRRVDSRK 169

Query: 177 SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQ 236
             I   +PDALD++L+CVE+G S+DQA+ RVA++I      L++E  +   E+    +R 
Sbjct: 170 EEITNGFPDALDMMLVCVEAGQSLDQAIIRVAKEIRAGYPALADEFEIVSWEIKAGKDRI 229

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
               +   R  +  V++    LIQS  +GTSI ++LRV   E R +R+M AE+KA +L  
Sbjct: 230 QVLRDMGERCGVADVQSFVTVLIQSTSFGTSIAEALRVYAGEMRDKRVMRAEEKANTLPT 289

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           K+T+  ++  +P L++++IGP++  +  T+K+
Sbjct: 290 KMTLATMMLTVPPLLIILIGPSVYEVYKTLKN 321


>gi|188581665|ref|YP_001925110.1| type II secretion system protein [Methylobacterium populi BJ001]
 gi|179345163|gb|ACB80575.1| type II secretion system protein [Methylobacterium populi BJ001]
          Length = 323

 Score =  179 bits (454), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 139/327 (42%), Positives = 204/327 (62%), Gaps = 4/327 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M   F  +  A     A+ T ++  + ++ +V P L   +L KRMK V+ ERE +R+++ 
Sbjct: 1   MLDEFVAIALAPRTVAAVLTGIAAAATVFTLVQPLLEGDQLAKRMKLVSDEREQIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L    + + LR      ++  V++ NL   L  E    KL  AG+R   +    L  R
Sbjct: 61  ERLN---SRASLRVEPKAYMKRVVEQFNLSRWLGTETAKAKLVRAGYRGGGAETAFLFFR 117

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV+PI    + + ++F   ++L+ P  +R G V+  G+ GF  P V++SN+  KRQ+ I+
Sbjct: 118 LVMPIAVTAVALFYLFLL-EVLDQPLMVRAGLVLAAGFFGFKLPEVYLSNMTTKRQAEIR 176

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDL LICVESG+S++ A RRV+ +I  QS  L+EE+ L  AELSFLP R+VA+E
Sbjct: 177 RAWPDALDLCLICVESGMSVENAFRRVSLEIASQSTVLAEELALLTAELSFLPERRVAYE 236

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++ T AL+Q++RYGT +G +LRVL  E+R  R+ EAEKKAA+L PKLTV
Sbjct: 237 NLALRTGLESVKSLTTALMQAERYGTPVGQALRVLAQESRDFRMTEAEKKAAALPPKLTV 296

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMK 327
           PMI+FFLPVL +V++ PA +     M+
Sbjct: 297 PMILFFLPVLFVVLLTPAGIQAYALMQ 323


>gi|193782687|ref|NP_436096.2| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304378|ref|ZP_07584129.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|193073143|gb|AAK65508.2| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306902580|gb|EFN33174.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 321

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 189/315 (60%), Gaps = 2/315 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             E   AI    S FS +  V  P +    L  RM+ V  ERE +R+++   L++ S  S
Sbjct: 9   DPEQLAAIMAGFSAFSAVVVVSWPYVFRDTLSDRMRRVEGERERIRQRERARLEEKSRVS 68

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            LR    +  +  V +  L     D  IV KL  AG+R   ++   L  RL+ P+     
Sbjct: 69  -LRVEPKRLFQAIVDRFRLAKQAEDGEIVRKLSMAGYRGHAAVTAFLAFRLIAPVAIFAA 127

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            +++I       E P  L V     +G +G+ +P++++ N + KRQ SI+R+WP+ALDLL
Sbjct: 128 CLLYILLVV-RPEAPLLLVVAMAAAMGALGYFSPAIFVRNRITKRQQSIRRSWPEALDLL 186

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           LI VE+G+ I+ A R+V E+IG QS   +EE+LLT AELS+L +R+ AFEN   RT ++ 
Sbjct: 187 LITVEAGMGIESAFRKVGEEIGTQSPETAEEILLTTAELSYLQDRRQAFENLGQRTGVEG 246

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR    +LIQ+++YGT +G +LRV+  E R  R+ EAEK+AA+L PKLTVPMI+FFLPVL
Sbjct: 247 VRAVVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEAEKRAAALPPKLTVPMILFFLPVL 306

Query: 311 ILVIIGPAILSIIDT 325
             VII PA++ I+ T
Sbjct: 307 FAVIITPAVIQIMST 321


>gi|149200852|ref|ZP_01877827.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
 gi|149145185|gb|EDM33211.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
          Length = 326

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 80/311 (25%), Positives = 154/311 (49%), Gaps = 1/311 (0%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+     + ++    V+  L +  L  R K   +E+    + Q +S    + +S      
Sbjct: 14  ALGPFGPLIAVGGLGVMLILLTIPLMLRQKQDPLEKLKQ-ENQRSSTSVGTKTSLRAGVQ 72

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
           +K L  +   L  +       I  KL  AG+R   ++      +  + +  LILG+I+  
Sbjct: 73  NKKLDRYATFLEPQDAKQLSQIRLKLMQAGYRHRDAVRYFHFAQFALGVGLLILGVIYYV 132

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                 E   Q  +  ++    +G+  P  W++   QKRQ  I+  +PD+LD++L+C+E+
Sbjct: 133 LVKSGTETSTQETLMYILGPAGIGYMMPKYWVTKRQQKRQEEIQDGFPDSLDMMLVCIEA 192

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G S+DQ++ RVA ++      L++E  +   ++    ++         R  +  + +   
Sbjct: 193 GQSMDQSIIRVASEMRASYPALADEFEIVALQIKAGRDKPSVLGEMAERCGVQDISSFVT 252

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L+QS  +GTSIG++LRV   E R +R+M AE+KA  L  K+T+  ++  +P L+++++G
Sbjct: 253 VLVQSQTFGTSIGEALRVYAGEMRDKRVMRAEEKANKLPTKMTLATMMLTVPPLLIILVG 312

Query: 317 PAILSIIDTMK 327
           P++L I+D + 
Sbjct: 313 PSVLGIMDLLA 323


>gi|163851908|ref|YP_001639951.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|218530659|ref|YP_002421475.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|240139031|ref|YP_002963506.1| hypothetical protein MexAM1_META1p2450 [Methylobacterium extorquens
           AM1]
 gi|254561626|ref|YP_003068721.1| hypothetical protein METDI3213 [Methylobacterium extorquens DM4]
 gi|163663513|gb|ABY30880.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|218522962|gb|ACK83547.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|240009003|gb|ACS40229.1| conserved hypothetical protein; putative membrane protein
           [Methylobacterium extorquens AM1]
 gi|254268904|emb|CAX24865.1| conserved hypothetical protein; putative membrane protein
           [Methylobacterium extorquens DM4]
          Length = 323

 Score =  179 bits (453), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 139/327 (42%), Positives = 202/327 (61%), Gaps = 4/327 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M   F +   A     A+   V+  +  + +V P +    L KRMK V+ ERE +R+++ 
Sbjct: 1   MLDDFVNTAFAPRTIAAVLAGVAAAATAFTLVQPLIEGDPLAKRMKLVSDEREQIRQRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L   +    LR      ++  V++ NL   L  E    KL  AG+R   +    L  R
Sbjct: 61  ERLNSRT---TLRAEPKAYMKRVVEQFNLGRWLGTETAKAKLIRAGYRGAGAETAFLFFR 117

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV+PI    + + ++F   ++L+ PF +R+G V   G+ G   P V++SN+  KRQ+ I+
Sbjct: 118 LVMPITLTAVALFYLFVL-EVLDQPFVIRLGLVFAAGFFGLKLPEVYLSNITSKRQAEIR 176

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDL LICVESG+S++ A RRV+ ++  QS  L+EE+ L  AELSFLP R+VA+E
Sbjct: 177 RAWPDALDLCLICVESGMSVENAFRRVSLEVASQSAVLAEELALLTAELSFLPERRVAYE 236

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++ T AL+Q++RYGT +G +LRVL  E+R  R+ EAEKKAASL PKLTV
Sbjct: 237 NLALRTGLEIVKSLTTALMQAERYGTPVGQALRVLAQESRDYRMTEAEKKAASLPPKLTV 296

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMK 327
           PMI+FFLPVL +V++ PA + + + MK
Sbjct: 297 PMILFFLPVLFVVLLTPAGIQVYEAMK 323


>gi|126733578|ref|ZP_01749325.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
 gi|126716444|gb|EBA13308.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
          Length = 321

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 80/321 (24%), Positives = 154/321 (47%), Gaps = 2/321 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +  +  +          +I  ++   L    L   +K      + ++     +    S 
Sbjct: 1   MENIQTMITDVLGPFGPLMIVGLLGVFLILITLPVLLKKEVDPLDKIKAANSGTKGDKSK 60

Query: 69  SSRLR-TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             +LR       L  +   L  +       +  KL  AG+RS  ++ I   ++  + I  
Sbjct: 61  DKKLRSAAGKDKLEKYSNFLEPQNAEEYSAVKLKLLQAGYRSTNAVRIYNFMQFALGIFG 120

Query: 128 LILGIIWIFG-YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
           L+ G  +        +E   Q  V  +++ G  G+  P  W++   Q RQ +I+ A+PD+
Sbjct: 121 LLCGGAYSLIQMSGTVEVTTQQLVMWIMIPGGAGYLLPKYWVTRRQQMRQEAIENAFPDS 180

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LD++L+CVE+G S+DQ++ RVA ++      L+EE  +   E     ++    ++  +R 
Sbjct: 181 LDMMLVCVEAGQSLDQSIIRVARELKSGFPELAEEFEIVSQEAKAGKDKNTVLKDMSDRC 240

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +  + +    L+QS ++GTSI D+LRV  +E R +R+M AE+KA  L  K+T+  ++  
Sbjct: 241 GVPDIASFVTVLVQSSQFGTSIADALRVYSAEMRDKRVMRAEEKANKLPTKMTLATMMLT 300

Query: 307 LPVLILVIIGPAILSIIDTMK 327
           +P L+ ++IGP+I +I+ ++ 
Sbjct: 301 VPPLMAMLIGPSIYAIVTSLG 321


>gi|254463054|ref|ZP_05076470.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2083]
 gi|206679643|gb|EDZ44130.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 323

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/320 (25%), Positives = 155/320 (48%), Gaps = 11/320 (3%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
              F  F      V +     + +L+    I S     L+K           L++Q    
Sbjct: 9   DMMFATFGPNAQLVLLVVLGGMLALLAVPFIMSKEVDPLDK-----------LKEQMQGK 57

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
              +        + +K L  + K L  K       I  KL  AG+R + ++ +  +++++
Sbjct: 58  AAGEDRQRLRAAKGNKQLGKYAKLLEPKDEAEYSAIRLKLIQAGYRDKDAVRLFHLMQMI 117

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + +IFL++G+++            Q  +  V+  G  G+  P  WI+  +  R+  I+  
Sbjct: 118 LGVIFLVIGLLYYTFVISGENATTQQMLMYVLGPGGAGYFLPKYWITRRIDTRKEQIESG 177

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PD+LD++L+CVE+G S+DQ++ RVA ++      L++E  +   E+    ++     + 
Sbjct: 178 FPDSLDMMLVCVEAGQSLDQSIVRVAAELHHSYPFLADEYEIVAQEMKAGKDKIAVLNDM 237

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  V +    LIQS  +GTSI ++LRV   E R +R+M AE+KA  L  K+T+  
Sbjct: 238 SERCGVQDVASFVTVLIQSTSFGTSIAEALRVYAGEMRDKRVMRAEEKANKLPTKMTLAT 297

Query: 303 IIFFLPVLILVIIGPAILSI 322
           ++  +P L+++++GP+++ I
Sbjct: 298 MMLTVPPLLIILVGPSVVGI 317


>gi|260427288|ref|ZP_05781267.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
 gi|260421780|gb|EEX15031.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
          Length = 324

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/317 (24%), Positives = 161/317 (50%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +FD     +      +   ++ A +   L    +   ++      + L K     +  ++
Sbjct: 1   MFDNLTAMITERLGPAGPLMVVAGLALLLILSTVPLLLRQKPDPMDKLAKSGRARIDAET 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            +    TR +  L  + + L  K+      +  KL  AG+R+  S+ +  + ++V+ +  
Sbjct: 61  KAILRDTRRNAKLNKYAQYLEPKSAEELGQMRLKLLQAGYRTPDSVRLYYLAQMVLGLGL 120

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L  G  +   +    +   Q ++  ++  G VG+ AP  WI+  V++R+  I+  +PDAL
Sbjct: 121 LAAGTAYYVMFKDGPDATMQTKLMYIVGPGAVGYLAPKYWITKRVEERKKQIEEGFPDAL 180

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++L+CVE+G S+DQ++ RV++++      L++E  +   E+    ++     +   R  
Sbjct: 181 DMMLVCVEAGQSLDQSIVRVSKELRASYPALADEFEIISHEMRAGKDKSNVLNDMGERCG 240

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V +    L Q+  +GTSI D+LR+  SE R +R+M AE+KA  L  K+T+  ++  +
Sbjct: 241 VQDVSSFVTVLNQAANFGTSIADALRIYASEMRDKRVMRAEEKANKLPTKMTLTTMMLTV 300

Query: 308 PVLILVIIGPAILSIID 324
           P L+++++GP+++SI +
Sbjct: 301 PPLLIILVGPSVVSISE 317


>gi|89068023|ref|ZP_01155440.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046262|gb|EAR52319.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 987

 Score =  176 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/271 (26%), Positives = 146/271 (53%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           R++   +          + + +  L  +   L  +       I  KL  AG+R++ ++ +
Sbjct: 712 RRESDETKNLMKGEKLRQKKGTDKLDKYSNFLEPQDKAEYSAIQLKLLQAGYRTKNAVRL 771

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
               +  + I+ L+LG+ +    ++  +   Q  + ++++ G  G+  P  W++   Q+R
Sbjct: 772 YHFAQFALGIVMLLLGVAYAIWKNQTGDPTTQSTILSILIPGSAGYMLPKYWVNKRQQER 831

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           Q  I+  +PD+LD++L+CVE+G S+DQ++ RVA ++      L+ E  L   E+    ++
Sbjct: 832 QQEIENGFPDSLDMMLVCVEAGQSLDQSIIRVARELKTGFPALAWEYELVAYEMKAGKDK 891

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
               ++   R  ++ V +    LIQS ++GTSI ++LRV   E R +R+M AE+KA +L 
Sbjct: 892 ISVLKDMSERCGVNDVASFVTVLIQSQQFGTSIAEALRVYAGEMRDKRVMRAEEKANTLP 951

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            K+T+  ++  +P L++++IGP++  I DT+
Sbjct: 952 TKMTLATMMLTVPPLLIILIGPSVFDIYDTL 982


>gi|126737249|ref|ZP_01752984.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721834|gb|EBA18537.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 72/311 (23%), Positives = 152/311 (48%), Gaps = 10/311 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + +           A+ +       L+K  +++A E      ++       +       
Sbjct: 17  LLVLGFFGFALIAFAAIYLIRQPEDPLKKLQRNIAPETRKSASKERLRQNDRNEQ----- 71

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                L+ F   L  +       +  KLR AG+ S+ ++      +L + +I L  G+ +
Sbjct: 72  -----LQKFATFLEPQDAEELSAMELKLRQAGYLSKDAVRFFFFAQLALALIGLAGGMFY 126

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           ++  +  + +  Q  +  ++  G VG+  P  W++  V++R+  I++ +PD+LD++L+CV
Sbjct: 127 VYVLNADMTFDTQQLLIRIVGPGAVGYMLPKYWVTRRVEERRQKIEQGFPDSLDMMLVCV 186

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G S+DQ++ RVA ++      L+ E  +   E+    +++    +   R  +  + + 
Sbjct: 187 EAGQSLDQSIVRVATELRASFPDLAYEFEIVAQEMKAGKDKEKVLRDMGTRCGVQDISSF 246

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +P L++++
Sbjct: 247 VTVMIQSQSFGTSIADALRVYAGEMRDKRVMRAEEAANKLPVKMTLATMMLTVPPLLIIL 306

Query: 315 IGPAILSIIDT 325
           +GP++  I++ 
Sbjct: 307 VGPSVQGILNM 317


>gi|332188365|ref|ZP_08390090.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
 gi|332011594|gb|EGI53674.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
          Length = 332

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 102/310 (32%), Positives = 170/310 (54%), Gaps = 1/310 (0%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+   V +F L+ A  +       +++R++++   RE L+     S ++ +     RT  
Sbjct: 17  AMLWGVCVFCLLVAGYMLIGTRDPMKRRVQALNERREQLKAGIDPSPKRRAQF-IERTDL 75

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
            + +R  +  L +      + +  KL  AG RS+     ++  RL +PI       +W++
Sbjct: 76  LERMRRVLSALKMLQEDQVKAVQLKLLQAGIRSKEMAVAVIFGRLALPIALGGGMALWVY 135

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G +   ++    R   V  +  + + AP + + N + KR  +I++  PDALDL++IC E+
Sbjct: 136 GTEDFAQWSGFSRYMMVAGMLVLSYKAPDLALKNQIDKRTHAIRKGLPDALDLMVICAEA 195

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+++D A  RVA ++      L +E  LT  EL FL +R+ A EN   R  +D +R    
Sbjct: 196 GLTVDAAFARVARELRRAYPELGDEFQLTSVELGFLTDRRQALENLSMRVNLDALRGVVT 255

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            +IQ+++YGT +  SLRVL +E R+ER+M AE+KAA L   +TVP+I+F LP L +VI+G
Sbjct: 256 TMIQTEKYGTPLASSLRVLSAEFRNERMMRAEEKAARLPAIMTVPLILFILPTLFIVILG 315

Query: 317 PAILSIIDTM 326
           PA  SI DT+
Sbjct: 316 PAGCSINDTL 325


>gi|94497258|ref|ZP_01303830.1| type II secretion system protein [Sphingomonas sp. SKA58]
 gi|94423363|gb|EAT08392.1| type II secretion system protein [Sphingomonas sp. SKA58]
          Length = 329

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 105/309 (33%), Positives = 175/309 (56%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +   ++  ++++A+         + KR+K++   RE L+     S  K  A      + +
Sbjct: 21  LLAGLATLAVLFALYAVMTVRDPMAKRVKALNERREQLKAGITASTAKRRAKLVKSNQTT 80

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
             +R+F+  L +      +++  +L  AG RS+     ++  R+++PI    +  I ++G
Sbjct: 81  DQMRSFLSSLKVLQDDQLKDVQVRLAQAGIRSKDLAVAVIFGRMILPIAIGGMAAILLYG 140

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              L E+    R  A  +   + + AP ++I N VQKR ++I++  PDALDLL+IC E+G
Sbjct: 141 VGILPEWGPMKRFFAFAVALLLSYKAPDLFIDNKVQKRSAAIRKGLPDALDLLVICAEAG 200

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +++D A  RVA ++G     L +E  LT  ELSFL  R++AFEN  +R ++D V+     
Sbjct: 201 LTVDAAFARVARELGKAYPELGDEFHLTAIELSFLTERRMAFENLASRVKLDAVKGVVTT 260

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+++YGT +  +LRVL +E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GP
Sbjct: 261 MIQTEKYGTPLASALRVLSAEFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGP 320

Query: 318 AILSIIDTM 326
           A  SI    
Sbjct: 321 AACSISAAF 329


>gi|254475205|ref|ZP_05088591.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
 gi|214029448|gb|EEB70283.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
          Length = 327

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 80/322 (24%), Positives = 160/322 (49%), Gaps = 9/322 (2%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
               + F      +A+   + +F ++ A+ +      +  K+++    E    +K Q   
Sbjct: 9   DLLINQFGPFGPLLAVGL-LGLFMILLAIPLLLNQPEDPMKKLQRSMSESTRDKKPQKER 67

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
           L++   + +L        + F   L  +       +  KLR AG++S+ S+ +    +  
Sbjct: 68  LRQADRNEQL--------QKFASFLEPQNADELSAMELKLRQAGYQSKDSVRLFHFAQFA 119

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + ++ L+ G+++++  +  +EY  Q  +  +I  G   +  P  WI+  +++R+  I   
Sbjct: 120 LGLVGLVAGLVYVYVLNADMEYDSQQMIIRIIGPGAAAYMLPKYWITRRIEERKQEITSG 179

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALD++L+CVE+G S+DQA+ RVA+++      L+EE  +   E+     +     + 
Sbjct: 180 FPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALAEEFEVVAYEMKAGKEKDKVLRDM 239

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  V +    +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  
Sbjct: 240 GTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRAEEAANKLPTKMTLAT 299

Query: 303 IIFFLPVLILVIIGPAILSIID 324
           +   +P L+++++GP+   I +
Sbjct: 300 MTLTVPPLLIILVGPSAQGIAN 321


>gi|85705157|ref|ZP_01036257.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670479|gb|EAQ25340.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 325

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/311 (25%), Positives = 151/311 (48%), Gaps = 3/311 (0%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+     + ++    V+  L +  +  R K    +     KQ  T       ++    + 
Sbjct: 14  ALGPFGPLIAVGGLGVMLVLVTIPMMLRQKQ---DPLDKLKQARTQEALGVKTNLRAGKQ 70

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
           +K L  +   L  +       +  KL  AG+R   ++      +  + I  LILG+I+  
Sbjct: 71  NKKLDRYATFLEPQNEKQLSEMRLKLMQAGYRHRDAVRYFHFAQFALGIGLLILGVIYYV 130

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
            +    E   Q  +  ++    +G+  P  WI+   QKRQ  I+  +PD+LD++L+C+E+
Sbjct: 131 LFKSGTETSTQETLMYILGPAGIGYMMPKYWITKRQQKRQEEIQDGFPDSLDMMLVCIEA 190

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G S+DQ++ RVA ++      L+EE  +   ++    ++         R  +  + +   
Sbjct: 191 GQSMDQSIIRVASEMRASYPALAEEFEIVSLQIKAGRDKPSVLNEMAERCGVQDITSFVT 250

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            ++QS  +GTSIG++LRV  +E R +R+M AE+KA  L  K+T+  ++  +P L+++++G
Sbjct: 251 VMVQSQTFGTSIGEALRVYAAEMRDKRVMRAEEKANKLPTKMTLATMMLTVPPLLIILVG 310

Query: 317 PAILSIIDTMK 327
           P++L I+    
Sbjct: 311 PSVLGIMKLFA 321


>gi|21673275|ref|NP_661340.1| TadC protein [Chlorobium tepidum TLS]
 gi|21646364|gb|AAM71682.1| TadC protein [Chlorobium tepidum TLS]
          Length = 312

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/321 (23%), Positives = 161/321 (50%), Gaps = 12/321 (3%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           + DA +    + +  ++ S+++A+    L    ++KR+  +  +R               
Sbjct: 1   MLDALQFLTIVLSGAAVASVVFALYNWWLS-NTVKKRLSQIVRQRWAPADVASPRKPTP- 58

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
                  +   ++ N + KL+L         +  +   AG R++ +      V+ +  ++
Sbjct: 59  -------QKIDTVINILSKLSLPEEGWQSSTVRTRFLQAGIRNKNAPQYYYAVKTL--LV 109

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
           F +  ++++F      + P  L +  ++L    G+  P + +  + +KR   ++ + PD 
Sbjct: 110 FGLPVMLFLFLRFAQPKLPVILFLIFMLLSAAAGYYLPEIVMDFITKKRVERMRNSLPDM 169

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           ++L+++C ESG+SID A+ R+++++      L++E  L   E+     R  +  N   RT
Sbjct: 170 IELMVVCTESGMSIDAAIARISQEMARTHPDLAQEFYLAGLEMRAGATRIDSLRNMALRT 229

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +D + +    LIQ++++GTS+ +SLRV     R++R   AE+ AA +  KL +P+ +F 
Sbjct: 230 SLDELHDLVSMLIQAEKFGTSMAESLRVQSEVMRTKRTQRAEELAAKIPVKLVLPLGLFI 289

Query: 307 LPVLILVIIGPAILSIIDTMK 327
            P L++V++GPAIL +ID +K
Sbjct: 290 FPTLLIVMLGPAILQLIDVLK 310


>gi|254486075|ref|ZP_05099280.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214042944|gb|EEB83582.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 308

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/308 (24%), Positives = 151/308 (49%), Gaps = 10/308 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + +   + +  +   V++           M+        L++ Q    ++ S     ++
Sbjct: 6   WIVLLGVLGVMMIGMTVIML----------MRQPQDPMAKLKRSQTEPSERPSQQRLRQS 55

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             ++ L+ F K L  + +         LR AG+ S  ++      ++ + I  L+ GI++
Sbjct: 56  DRNEQLQKFAKFLEPENLDELTAKQLMLRQAGYSSRDAVRFFHFAQMALGIGGLVFGIVY 115

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +           Q  +   +  G +G+  P  W++  V+KR+  I R +PDALD++L+CV
Sbjct: 116 VNFLGGGEGLTTQKMMMYTVGPGGIGYYLPKYWVTKRVEKRKEEITRGFPDALDMMLVCV 175

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G S+DQ++ RVA+++      L+EE  +   E+    ++     +  +R  +  V + 
Sbjct: 176 EAGQSLDQSIVRVAKELHASYPALAEEFEVVAYEMKAGKDKVGVLTDMGDRCGVQDVSSF 235

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L QS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +P L++++
Sbjct: 236 VTVLCQSAAFGTSISDALRVYAEEMRDKRVMRAEEAANKLPTKMTLATMMLTVPPLLIIL 295

Query: 315 IGPAILSI 322
           + P++++I
Sbjct: 296 VAPSVMNI 303


>gi|170750194|ref|YP_001756454.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656716|gb|ACB25771.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 325

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 136/325 (41%), Positives = 205/325 (63%), Gaps = 1/325 (0%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M     +          +  AV+  +  YAV  P L +  L KRMK V+ ERE +R+++ 
Sbjct: 1   MIDAIAEKLFDPRFMGTVLAAVAAAATAYAVAQPFLETDRLGKRMKLVSDEREQIRRRER 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            S ++    + LRT     +++ V++  L+  L  +    KL  AG+R + +    L  R
Sbjct: 61  LSAERTGNRATLRTEPKAYMKSIVERYQLRRWLGTDTAKRKLMQAGYRGQGAETAFLFFR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LVVP++ +I  + ++F   ++L+  + +R G VI   Y+G  AP +++ N  +KRQ+ I+
Sbjct: 121 LVVPVVAVIAALFYLFVL-EVLDASYLMRFGLVIGAAYMGIKAPELFLVNTAKKRQTEIR 179

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           +AWPDALDL LICVESG++I+ A R+V+ +I   SV L+EE+ L  AE+SFLP+R+ A+E
Sbjct: 180 KAWPDALDLTLICVESGMAIENAFRKVSTEIATSSVVLAEELALMTAEMSFLPDRRQAYE 239

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V++   ALIQ++RYGT +G +LRVL  E+R  R+ EAEKKAA L PKLTV
Sbjct: 240 NLVMRTGLEPVKSVATALIQAERYGTPVGQALRVLSQESRDMRMNEAEKKAAGLPPKLTV 299

Query: 301 PMIIFFLPVLILVIIGPAILSIIDT 325
           PMI+FFLPVL +VII PA++ I+ T
Sbjct: 300 PMILFFLPVLFVVIITPAVIQIMRT 324


>gi|89053483|ref|YP_508934.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863032|gb|ABD53909.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 326

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 87/330 (26%), Positives = 160/330 (48%), Gaps = 11/330 (3%)

Query: 3   HYFFDLFDATELAVA-----ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK 57
            +  DLFD+    +      +   +++  L   + + +L    ++K+       R+    
Sbjct: 2   EFLTDLFDSANAFLIDQLGELGPLIAVGGLGVLLCLVAL-PTLMKKQKDPYKKLRDE--- 57

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
           +  T   K        +  ++ L  F + L  +          ++  AG+R++ S+ +  
Sbjct: 58  RGGTGKAKGKKDGLRLSSKNEKLERFAQYLEPQDEQELSATQLQMIRAGYRAKSSIQMFN 117

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
             +L + +  L+LG +++           Q  +  VI+ G VG+ AP  WI+   Q R+ 
Sbjct: 118 FAKLALALGGLLLGTLYVLITG--GGGSAQNSILFVIVPGVVGYYAPKYWITKRAQTRED 175

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
            I   +PDALDL+L+CVE+G S+DQA+ +VA +I     PL+EE  +   E+    ++  
Sbjct: 176 QINSGFPDALDLMLVCVEAGQSLDQAIIKVANEIKTSYPPLAEEFEIVSYEMKAGKDKTK 235

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
              +   R  +  V +    LIQS  +GTS+ ++L+V   E R +R+  AE+KA  L  K
Sbjct: 236 VLRDMGERVGIQDVNSFITTLIQSSTFGTSVAEALKVYSDEMRDKRISRAEEKANKLPTK 295

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LT+  ++F +P L++++IGP+I  I   + 
Sbjct: 296 LTLFTMLFCVPPLLVILIGPSIYGIATDLA 325


>gi|294012437|ref|YP_003545897.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675767|dbj|BAI97285.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 330

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 162/295 (54%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
                    + KR+K++   RE L+     S  +  A    + + +  +R+F+  L +  
Sbjct: 36  YAVMTVRDPMAKRVKALNERREQLKAGITASTARRRAKLVKKNQATDQMRSFLSNLKVLQ 95

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
               +    KL  AG RS+     ++  RL++PI+   +  + ++      E+    R  
Sbjct: 96  DDQLKEAQIKLAQAGIRSKDWAVAVIFGRLILPIVIGGMAALLLYAVGIYPEWGGAKRFM 155

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A      + + AP ++I N +QKR ++I++  PDALDLL+IC E+G+++D A  RVA ++
Sbjct: 156 AFAGALLLSYKAPDIFIDNKIQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFSRVAREL 215

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G     L +E  LT  ELSFL  R++AFEN   R ++D ++     +IQ+++YGT +  +
Sbjct: 216 GKAYPELGDEFHLTAIELSFLTERRMAFENLATRVKLDAIKGVVTTMIQTEKYGTPLASA 275

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           LRVL +E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA  SI    
Sbjct: 276 LRVLSAEFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGPAACSISQAF 330


>gi|114705450|ref|ZP_01438358.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540235|gb|EAU43355.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 328

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 141/318 (44%), Positives = 208/318 (65%), Gaps = 2/318 (0%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD--SA 68
             E+  ++  ++++F+ + AVV+P L    L+ RMKSVA+ER+ +R ++   L +D    
Sbjct: 11  EPEVFFSVVLSLAVFASVLAVVLPQLERNRLQSRMKSVAIERDEMRARERARLGRDKGGK 70

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S  +  +   +   V  LNL+  LVD+  + KLR AGFRS+  L + L +R+ + +   
Sbjct: 71  PSLRQVEERGFVSRVVTSLNLRKALVDDATIAKLRVAGFRSQRHLTLFLFLRIALALALF 130

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
               +++ G   L E P  +R+ A +   Y+GF  P +++ N   KRQ+SI+RAWPDALD
Sbjct: 131 AFAALYVLGLGLLAEQPLMMRIVACVGAAYIGFVLPVMYLRNAATKRQASIQRAWPDALD 190

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LLLICVESG SI+ + R+VAE+IG QS+ L+EE++LT AELS+LP R+ A++N   RT +
Sbjct: 191 LLLICVESGKSIEASFRKVAEEIGIQSIALAEELMLTCAELSYLPERRTAYDNLILRTDL 250

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + VR    AL Q++RYGT IG +LR +  E R  R+  AEKKAA+L PKLTVPMI+FFLP
Sbjct: 251 EGVRATMTALTQAERYGTPIGSALRTMAQENRDLRMNAAEKKAAALPPKLTVPMIVFFLP 310

Query: 309 VLILVIIGPAILSIIDTM 326
           VL+ +I+ PA +S+ID M
Sbjct: 311 VLMAIILAPAAISMIDAM 328


>gi|292491527|ref|YP_003526966.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580122|gb|ADE14579.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 320

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 81/300 (27%), Positives = 146/300 (48%), Gaps = 2/300 (0%)

Query: 28  IYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL 87
            +AV++    +  +   +  VA   + +R++  +         +     ++++      +
Sbjct: 21  FFAVIMGVATTLFVLALLLLVAGLSDPVRRRLRSIANSGHHDRKTTDAVAEAIAPLSPYI 80

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
             +          KL  AG+RS  +L +   ++L+  II   + I     +    ++   
Sbjct: 81  LPRQEWERSKTTTKLVHAGYRSGNALTLFYAIKLLSGIILPAIAIFLTTIF--YPKFTTF 138

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             V   + + ++G   P++ +  L++KRQ  I   +PD LDLL+ C E+G+ ++ AL+RV
Sbjct: 139 QIVFLGLFLSFIGLLFPNIVLERLIKKRQRQIYNGFPDVLDLLITCTEAGLGLNAALKRV 198

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           AE+       LS E+ L   E+    NR  A +NF  R  ++ + +    L QS R+GTS
Sbjct: 199 AEECAVSHPVLSGELTLVNMEIRAGVNRVEALKNFSARAGIEEIHSFVAFLSQSLRFGTS 258

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           I D+LR+   E R +R+  AE+ AA +G K+  P+I   LP   LV IGPA+L ++  + 
Sbjct: 259 IADTLRIYSDEFRDKRMQRAEEMAAKMGTKMIFPLIFCILPSFFLVAIGPAVLGVLKALG 318


>gi|258405283|ref|YP_003198025.1| Type II secretion system F domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797510|gb|ACV68447.1| Type II secretion system F domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 320

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 83/318 (26%), Positives = 157/318 (49%), Gaps = 1/318 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
             A  L + +  A+ +   +  + +  L     +KR     ++    +       + DS+
Sbjct: 1   MPADYLPLIMAGAIFVSLFLLMIGVMQLVRSNSKKRAILEKIQTSNQQSAFGDPQRLDSS 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S    +    +    +K+    +     +  +   AG RS  +  +   +++++P+   
Sbjct: 61  RSGFFGKIFGFVGLVGQKVAKDRVSDHTVLRPRFLKAGIRSPLAPAVFWGLKVIMPLALP 120

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +   ++ +    L   P    +   +L    GF  P +W++N  QKR+ +I + +PDALD
Sbjct: 121 LCFGLFYYLIPDLTLSPTNTLLIITVL-AVAGFYVPDLWLTNKRQKRRQTILKGFPDALD 179

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RVA++    +  LSEE+     E      R+ A +N   RT +
Sbjct: 180 LMVVCVEAGMGLDAAISRVAKESKSNNATLSEELHFFTLETRAGMPRKDALKNLAMRTDL 239

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             ++N T  LIQ++++GTS+  +L+V     R+ER   AE+KAA +  KL  P+I+F  P
Sbjct: 240 QQMQNLTTLLIQTEKFGTSVSQALKVFSESMRTERFQRAEEKAAKIPVKLLFPLIMFIFP 299

Query: 309 VLILVIIGPAILSIIDTM 326
            L + I+GPA++ I  T+
Sbjct: 300 SLFVAILGPAVIRISQTL 317


>gi|224824220|ref|ZP_03697328.1| type II secretion system protein [Lutiella nitroferrum 2002]
 gi|224603639|gb|EEG09814.1| type II secretion system protein [Lutiella nitroferrum 2002]
          Length = 314

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 79/318 (24%), Positives = 151/318 (47%), Gaps = 12/318 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            + ++        V++F +   + +       ++ R+  ++         +  +     +
Sbjct: 1   MNTSQWIYLGIIFVAVFGVALTISMQI-APNRVKARLDKIS---------ETETPIDSDS 50

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +S    +  K      K            I  +   AG+R + ++ +    +  + ++F 
Sbjct: 51  ASAWVAKAVKIATPLAKLSVPAEGWETSPIRIRFMNAGYRGQSAVPLFFGAKTFLALLFP 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            +  +++       +      +  ++L   +G+  P++ +S  V+ RQ  I   +PDA+D
Sbjct: 111 TILFLYLGLTGGHKDGTNF--LLFMLLAAGIGYYLPNILLSRRVENRQREIFNNFPDAID 168

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LLL+CVE+G+ +D AL +V E++  +S  L++E+ L   EL     ++ A  N   RT +
Sbjct: 169 LLLVCVEAGLGLDAALLKVGEEMRIKSPILADELHLVNLELRAGSTKERALRNLAIRTGV 228

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             V      LIQSDR+GTSIG+SLRV   + R++R + AE+ AA +  KL  P+I    P
Sbjct: 229 QEVDTLVAMLIQSDRFGTSIGESLRVHADDLRTKRRLRAEEAAAKIPLKLLFPLIFCIFP 288

Query: 309 VLILVIIGPAILSIIDTM 326
            L+LV++GPA + I   +
Sbjct: 289 ALLLVLLGPAFIQIYRVL 306


>gi|193213109|ref|YP_001999062.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
 gi|193086586|gb|ACF11862.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
          Length = 313

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/321 (22%), Positives = 151/321 (47%), Gaps = 11/321 (3%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
              ++   + +  ++ S+++A           +KR+  +                   +S
Sbjct: 3   TTLQILTIVLSGAAVASVVFAFYS-LGVDNAFKKRLTQI-------FSGSGAPPADKPSS 54

Query: 70  SRLRTRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
             ++++   ++ N + KL+L         +  K   AG R++ +      ++ ++ ++F 
Sbjct: 55  KPVKSQRVATVVNILSKLSLPDEGWQSSAVRVKFLQAGIRNQNAPQYYFAIKTLLTLVFP 114

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  + +F      +      +   +L    G+  P + +  + Q+R   ++   PD ++
Sbjct: 115 VL--LALFLVLNQPKLQLIHIILFALLTAAAGYYLPELLLRFITQRRIERMRNGLPDMIE 172

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L++IC E+G+SID A  R++ ++      LS+E  L+  E+     R  A  N   R  +
Sbjct: 173 LMVICTEAGMSIDAASTRISREMARSYPDLSQEFYLSSLEMRAGATRLDALRNMALRVGL 232

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + + +    LIQ+D++GTS+ DSLRV     R+ R   AE+ A  +  K+ +P+I+F  P
Sbjct: 233 EELEDLVSVLIQADKFGTSLADSLRVHSDVMRTRRSQRAEELANKVPVKMLLPLILFIFP 292

Query: 309 VLILVIIGPAILSIIDTMKDH 329
            L++V++GPAI+ ++D +   
Sbjct: 293 TLLMVLLGPAIIQLLDVLSKQ 313


>gi|294676064|ref|YP_003576679.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474884|gb|ADE84272.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 337

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 82/329 (24%), Positives = 155/329 (47%), Gaps = 5/329 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           +              +A+    ++  L     + S     L+K  KS+A     +   Q 
Sbjct: 6   ITDMLTAWLGPMGPVIALAALGAVLVLAALPALVSRREDPLDKLRKSLAPGSGTVGAAQA 65

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
           TS     A     T     L+ F   L  ++          L  AG+R  + +     V+
Sbjct: 66  TS---KKAQKLRNTAGPDKLQKFAGFLEPQSKEEMSESRKWLHKAGYRGPHVVRHFHAVQ 122

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPF--QLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
             + I  L LG++++  Y+   E P      + A++  G  G+ AP  W++  V  R   
Sbjct: 123 FALAISLLGLGVLYVLFYNAGHEVPLESTNAIAAILGPGIGGYYAPRRWVNQRVAARTQE 182

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+  +PDALD+LL+CVE+G S+DQ + RV++++      L+EE      E+    ++   
Sbjct: 183 IQDGFPDALDMLLVCVEAGQSLDQGIIRVSKELSSSYPALAEEFATVAHEIKAGLDKPTV 242

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
              F  R+ +  V +    +IQS ++GTSI ++LR+  ++ R +R+M AE+ A  +  K+
Sbjct: 243 LRAFAERSGVSDVASFVTVMIQSQQFGTSIAEALRLYAADMRDKRIMRAEEAANKIPTKM 302

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           T+  ++F +P L+++++GP++  +++   
Sbjct: 303 TLGTMMFTVPPLLIILVGPSVHDMMENFA 331


>gi|83950071|ref|ZP_00958804.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837970|gb|EAP77266.1| type II/IV secretion system protein, TadC subfamily  protein
           [Roseovarius nubinhibens ISM]
          Length = 323

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 76/324 (23%), Positives = 160/324 (49%), Gaps = 12/324 (3%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
            +           +A+ T   +  +I  V++ +     L+K  KS   +    + +  + 
Sbjct: 6   DFLTANLGEFGPLIAVGTLGLLLIMITVVLMINQPEDPLDKLKKSQKQQGLETKAKLRSG 65

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
            + +             L  +   L  +       +  KL  AG+R+  ++      +  
Sbjct: 66  SRNE------------KLDKYANFLEPQDEKQMSEMRKKLLQAGYRNRDAVRYYHFAQFA 113

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + +  L++G+I+   + +  +      +  +++ G +G+ AP  W++   Q+RQ  I+  
Sbjct: 114 LGLGLLVVGVIYFLLFVQGPDTTTTQTILYILVPGAIGYLAPKYWVTKRQQQRQEEIQDG 173

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PD+LD++L+CVE+G S+DQ++ RV+E+I      L++E  L   ++    ++       
Sbjct: 174 FPDSLDMMLVCVEAGQSMDQSIVRVSEEIRASYPALADEYQLVAQQIKAGRDKASVLNEM 233

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
            +R  +  + +    L+QS  +GTS+GD+LRV  +E R +R+M AE+KA  +  K+T+  
Sbjct: 234 GDRCGVQDISSFVTVLVQSQTFGTSVGDALRVYAAEMRDKRVMRAEEKANKIPTKMTLCT 293

Query: 303 IIFFLPVLILVIIGPAILSIIDTM 326
           +   +P L+++++GP++L I+D M
Sbjct: 294 MGLTVPPLLIILVGPSVLGIMDLM 317


>gi|307293454|ref|ZP_07573300.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881520|gb|EFN12736.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 330

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 160/295 (54%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
                    + KR+K++   RE L+     S  +  A    + + +  +R+ +  L +  
Sbjct: 36  YAVMTVRDPMAKRVKALNERREQLKAGITASTARRRAKLVKKNQATDQMRSLLSSLKVLQ 95

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
               +    KL  AG RS+     ++  R+++PI    +  + ++      E+    R  
Sbjct: 96  DDQLKEAQIKLAQAGIRSKDWAVAVIFGRMILPIAIGGMAALLLYAVGIFPEWGGAKRFM 155

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A      + + AP ++I N VQKR ++I++  PDALDLL+IC E+G+++D A  RVA ++
Sbjct: 156 AFAAALLLSYKAPDLFIDNKVQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFSRVAREL 215

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G     L +E  LT  ELSFL  R++AFEN   R ++D V+     +IQ+++YGT +  +
Sbjct: 216 GKAYPELGDEFHLTAIELSFLTERRMAFENLATRVKLDAVKGVVTTMIQTEKYGTPLASA 275

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           LRVL +E R ER+M AE+KAA L   +TVP+I+F LP L +VI+GPA  SI    
Sbjct: 276 LRVLSAEFRHERMMRAEEKAARLPAIMTVPLILFILPTLFVVILGPAACSISKAF 330


>gi|254466278|ref|ZP_05079689.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
 gi|206687186|gb|EDZ47668.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
          Length = 326

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 80/323 (24%), Positives = 155/323 (47%), Gaps = 10/323 (3%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
            Y    F      +A+  A     L+   ++ +     L+K  K++  E   + K++   
Sbjct: 9   DYLTSHFGEFGPLLALGIAGLFMILLAVPLLLNQPEDPLKKLQKNIKPETRNVPKKERLR 68

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
               +            L+ F   L  +       +  KLR AG+ S+ S+ +    +  
Sbjct: 69  QANRNEQ----------LQKFAGFLEPQNADELSAMELKLRQAGYHSKDSVRLFHFAQFA 118

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + ++ L+ G+ +++     ++Y  Q     ++  G  G+  P  WI+  +++R+  I   
Sbjct: 119 LGLLGLMGGLFFVYVLKADIDYDSQQMAIRIVGPGAAGYLLPKYWITRRIEERKQKITEG 178

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALD++L+CVE+G S+DQA+ RVA+++      L+EE  +   E+     +     + 
Sbjct: 179 FPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPDLAEEFEVVAYEMKAGKEKDRVLRDM 238

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  + +    +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  
Sbjct: 239 GTRCGVQDISSFVTVMIQSASFGTSIADALRVYAGEMRDKRVMRAEEAANKLPVKMTLAT 298

Query: 303 IIFFLPVLILVIIGPAILSIIDT 325
           +   +P L+++++GP+I  I++ 
Sbjct: 299 MGLTVPPLLIILVGPSIQGIMNM 321


>gi|78357408|ref|YP_388857.1| hypothetical protein Dde_2365 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219813|gb|ABB39162.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 324

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 79/316 (25%), Positives = 144/316 (45%), Gaps = 3/316 (0%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILR-KQQITSLQKDSASSRL 72
           L VA   + S+    + +     G    ++  + V       R     ++        +L
Sbjct: 9   LLVAALASASVMLAFFGLRGLLNGRQRAKQLQRRVRHHISPTRISGMQSAADTQQGRQQL 68

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + +  +    ++L  +           L  AG+RS  +  IL   +    ++ L  G+
Sbjct: 69  TAKLNDLMSTIGERLAPRNEEQMGQTNLALVRAGYRSRKAPLILWGAKAGCMLLGLTCGL 128

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +      +    P  +     I    +G   P  W+S+ V+ R+  ++ + PDALDLL++
Sbjct: 129 LIRLAAGE--TIPAGMLALLFICPAVLGLYLPDAWVSSKVRTRRRLMEDSLPDALDLLVV 186

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVE+G+ +DQA+ RVA ++   S  L EE+ + ++EL     R  + +N  +R  ++ V 
Sbjct: 187 CVEAGMGLDQAIGRVARELSLSSPVLGEELSMLVSELRAGKTRSESLKNLAHRVGLEDVN 246

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    +IQ+D +GTSI  +LRV     R+ R   AE+ AA +  KL  P++   LP L +
Sbjct: 247 SLVTLIIQADAFGTSIAHTLRVYSDTMRTTRFQRAEEIAAKMPVKLLFPLVFCILPALFV 306

Query: 313 VIIGPAILSIIDTMKD 328
            I+GPA + ++     
Sbjct: 307 AIMGPAGIRLMQVFSQ 322


>gi|84516638|ref|ZP_01003997.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
 gi|84509674|gb|EAQ06132.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
          Length = 316

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/319 (23%), Positives = 149/319 (46%), Gaps = 3/319 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
             A +  +          ++  +V   +    L    +      + L+     + + +  
Sbjct: 1   MQAIQTLIIDILGPFGPLMVIGLVGFFMILLTLPVVFRRKQDPLDRLKAANRPTNKTER- 59

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                     +L  +   L  +       +  KL  +G+RS+ ++ I   V+  + I  L
Sbjct: 60  --LRAASSKDTLEKYSNFLEPQNAAEYSAVKLKLLQSGYRSKNAVRIYHFVQFALGITGL 117

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
             G I+            Q  +  +++ G +G+  P  W++  V+ R+ +I  A+PD+LD
Sbjct: 118 FGGGIYSLIEMAQRTVNTQELIMMILVPGGIGYMFPKYWVTRRVEVRKEAIINAFPDSLD 177

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+L+CVE+G S+DQ++ RV+ ++      L+EE  +   E     ++    ++   R  +
Sbjct: 178 LMLVCVEAGQSLDQSILRVSNELRTGFPELAEEFEIVSQEAKAGKDKTTVLKDMAERCGV 237

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             + +    ++QS ++GTSI D+LRV  SE R +R+M AE+ A  L  K+T+  ++  +P
Sbjct: 238 PDISSFVTVMVQSAQFGTSISDALRVYASEMRDKRVMRAEEAANKLPTKMTLATMMLTVP 297

Query: 309 VLILVIIGPAILSIIDTMK 327
            L+ ++IGP+I +I  ++ 
Sbjct: 298 PLMAILIGPSIYAITTSLG 316


>gi|163733537|ref|ZP_02140980.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
 gi|161393325|gb|EDQ17651.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
          Length = 327

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/319 (23%), Positives = 147/319 (46%), Gaps = 11/319 (3%)

Query: 4   YFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
              +        + + T   I   +   ++ +     +EK           L+KQ  T  
Sbjct: 10  LIVEFLGPLGPIILLGTLGLIMIGVTVALMLAQPEDPMEK-----------LKKQIQTPG 58

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
                    +   ++ L+ F   L  + +         LR AG++S+ ++      +  +
Sbjct: 59  SSAPEQRLRQGERNEQLQKFASFLEPQDVAELSARQLMLRQAGYQSQDAVRFFHFAQFAL 118

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            +  L+L  +++        +  Q  +   I+ G VG+  P  W+   V  R+  I R +
Sbjct: 119 GLAGLLLAFVYLNLLGHGEGFTTQKMMIYTIIPGAVGYYLPVYWVRRRVDTRKDEITRGF 178

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD+LD++L+CVE+G S+DQ + RV++++      L++E  +   E+    ++     +F 
Sbjct: 179 PDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAYEMKAGKDKTTVLNDFG 238

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  V +    L QS ++GTSI ++LRV   E R +R+M AE+ A  L  K+T+  +
Sbjct: 239 ERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAGEMRDKRVMRAEEAANKLPTKMTLATM 298

Query: 304 IFFLPVLILVIIGPAILSI 322
           +  +P L+++++GP++  I
Sbjct: 299 MLTVPPLLIILVGPSVHGI 317


>gi|86137998|ref|ZP_01056574.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
 gi|85825590|gb|EAQ45789.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
          Length = 326

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 69/271 (25%), Positives = 142/271 (52%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
            R Q   +  K       +   ++ L+ F   L  +       +  KLR AG+ S+ ++ 
Sbjct: 51  QRAQAPETRGKPQKERLRQNNRNEQLQKFASFLEPQNAEELSAMELKLRQAGYHSKDAVR 110

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           +    ++ + +  L LG+ +++  +   E+  Q  +  +I  G  G+  P  W++  + +
Sbjct: 111 LFHFAQMSLGLAGLALGLFYVYVMNAGFEFDTQALMIRIIGPGGAGYMLPKYWVTRRIAE 170

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R+  I+  +PD+LD++L+CVE+G S+DQ++ RVA ++      L  E  +   E+    +
Sbjct: 171 RKEEIEAGFPDSLDMMLVCVEAGQSLDQSIVRVASELKASYPQLDYEFDIVAHEMKAGKD 230

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           ++    +   R  +  + +    +IQS  +GTSI ++LRV  SE R +R+M AE+ A  L
Sbjct: 231 KEKVLRDMGTRCGVQDISSFVTVMIQSAAFGTSIAEALRVYASEMRDKRVMRAEEAANKL 290

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
             K+T+  ++  +P L+++++GP++ +I++ 
Sbjct: 291 PVKMTLATMMLTVPPLLIILVGPSVKNIMNM 321


>gi|260574611|ref|ZP_05842614.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023028|gb|EEW26321.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 326

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 146/275 (53%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E L+ Q+ T       ++      +  L+ F   L  +          K+  AG+R++ S
Sbjct: 48  EKLKAQRTTGTAATPGAALRLGDKADKLQKFANFLEPQDEAELSASRLKMLRAGYRAKNS 107

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           + +    +LV+ I  L+LG+I+            Q  + + I  G VG+  P  W+++ V
Sbjct: 108 VRMFHFAQLVLGIGLLVLGVIYTLFMSAQGTVSTQTMILSTIGPGAVGYYLPQYWVNSRV 167

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           +KRQ+ I   +PDALD++L+CVE+G S+DQ++ RVA +       L++E  +   E+   
Sbjct: 168 KKRQAEIVSGFPDALDMMLVCVEAGQSMDQSIIRVARESRAGYPALADEFDMVAQEIKAG 227

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
             R     +   R  +  V +    L+QS  +GTSI ++LRV  +E R +R+M AE+KA 
Sbjct: 228 KERTTVMRDMSERVGIADVASFVTTLVQSATFGTSIAEALRVYSAEMRDKRVMRAEEKAN 287

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +L  KLT+  ++F LP L++++IGP+I +I  T+ 
Sbjct: 288 TLPTKLTLGTMLFTLPPLLIILIGPSIHNIAVTLS 322


>gi|254511547|ref|ZP_05123614.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221535258|gb|EEE38246.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 325

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 79/305 (25%), Positives = 146/305 (47%), Gaps = 5/305 (1%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              V I  L   +V   L   + E  +K +             + +K+          ++
Sbjct: 21  LIVVGILGLFMILVTIPLMLNQPEDPLKKL-----QKSNSAPKNNKKEKKERLRTASRNE 75

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L  F   L  K       +  KLR AG++S+ ++      +  + I+ +++G+  +  +
Sbjct: 76  QLEKFANFLEPKDQEEYSAVQLKLRQAGYQSKDAVRFYHFAQFALGIVGILIGVSLVTVF 135

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
               E+     +  V++ G VG+  P  WI+  V++R+ +I   +PD LDL+L+CVE+G 
Sbjct: 136 AGDQEFDSTQLLIRVLVPGVVGYFVPKYWITRRVEERKEAIVNGFPDTLDLMLVCVEAGQ 195

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQA+ RVA ++      ++ E  +   E+     +     +F  R  +  V      +
Sbjct: 196 SLDQAIVRVAAEMKASYPDIALEFEVVAYEMKAGKEKDTVLRDFATRCGVQDVSAFVTVM 255

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  ++  +P L+++++GP+
Sbjct: 256 IQSAAFGTSIADALRVYSDEMRDKRVMRAEEAANKLPTKMTLATMMLTVPPLLVILVGPS 315

Query: 319 ILSII 323
              I+
Sbjct: 316 AKGIM 320


>gi|194335919|ref|YP_002017713.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308396|gb|ACF43096.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 316

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/318 (24%), Positives = 156/318 (49%), Gaps = 9/318 (2%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             ++   + +  ++ SL++A++   + +  L+KR+  +  +        ++        +
Sbjct: 4   TLQILTIVLSGAAVASLVFALLNWLVDNNALKKRLTKIIRQSRAPAATSLSKTANTGKVA 63

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            +    SK           +       +  K   AG R++ +      V+ +  ++  ++
Sbjct: 64  TVINILSKLS-------LPEEGWQSSGVQIKFLQAGIRNKNAPQNFFAVKTLFTLVLPVV 116

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             +++     L+  P    +  V+     G+  P + +  + Q R   ++ + PD LDL+
Sbjct: 117 LALFLHFTQPLM--PLARVMILVLFTAAAGYYLPEMLLRFITQNRIERMRNSLPDMLDLM 174

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           ++C ESG+ ID A+ R++ ++   +  L+EE  L+  E+    NR  A  N   R+++D 
Sbjct: 175 VVCTESGMGIDAAIARISREMVRTNPDLAEEFYLSTLEMRAGANRIDALRNLALRSRLDD 234

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           ++N    L+Q+DR+GTS+ DSLRV     R+ R   AE+ AA +  K+T+P+++F  PVL
Sbjct: 235 LQNLVSVLVQADRFGTSLVDSLRVHSDMMRTCRTQRAEELAAKIPVKMTLPLVLFIFPVL 294

Query: 311 ILVIIGPAILSIIDTMKD 328
           +LV++GPAI+ +I     
Sbjct: 295 MLVLLGPAIIQVIQIFSQ 312


>gi|83943934|ref|ZP_00956391.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83954507|ref|ZP_00963218.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840791|gb|EAP79962.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845181|gb|EAP83061.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 305

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/296 (24%), Positives = 142/296 (47%)

Query: 27  LIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKK 86
            I   +  ++    L   ++        L++ Q  +          ++  ++ L+ F K 
Sbjct: 5   AILGALGLTMVGATLVMILRQPEDPLAKLKRSQTEAADAGKQQRLRQSDRNEKLQKFAKF 64

Query: 87  LNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
           L  + +         LR AG+ S  ++      ++ + I  L++G ++I           
Sbjct: 65  LEPEDVEELSAKALLLRQAGYSSRDAVRFFHFAQMALGIAGLVIGTVYINFLGGGEGMTT 124

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
              +   +  G +G+  P  W++  V +R+  I R +PDALD++L+CVE+G S+DQ + R
Sbjct: 125 NKMMLYTVGPGGIGYFLPRYWVTRRVAERKEEITRGFPDALDMMLVCVEAGQSLDQCIVR 184

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           VA ++      L+EE  +   E+    ++         R  +  V +    L+QS  +GT
Sbjct: 185 VARELRASYPALAEEFEIVAYEMKAGKDKVSVLNAMGERCGVQDVSSFVTVLVQSAAFGT 244

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           SI D+LRV  +E R +R+M AE+ A  L  K+T+  ++  +P L+++++ P++++I
Sbjct: 245 SIADALRVYAAEMRDKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVAPSVMNI 300


>gi|163738365|ref|ZP_02145780.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742218|ref|ZP_02149606.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384548|gb|EDQ08929.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388286|gb|EDQ12640.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 326

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 154/309 (49%), Gaps = 9/309 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + +   + +F ++ A+ +      +  K+++         +    ++  K       +  
Sbjct: 21  LLVVGLIGLFMILLAIPLLLNQPEDPLKKLQ---------KSMSASTQTKPKKERLRQAD 71

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            ++ L+ F   L  +       +  KLR AG++S+ S+      +  + +I L LG+ ++
Sbjct: 72  RNEQLQKFASFLEPQDAAELSKMELKLRQAGYQSKDSVRFFHFAQFALGLIGLALGLFYV 131

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           +  +  +EY  Q  V  +I  G   +  P  WI+  +++R+  I   +PDALD++L+CVE
Sbjct: 132 YVLNADMEYDSQQMVIRIIGPGAAAYMLPKYWITRRIEERKQEITSGFPDALDMMLVCVE 191

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G S+DQA+ RVA+++      L++E  +   E+    ++     +   R  +  V +  
Sbjct: 192 AGQSLDQAIVRVAKELHASYPALADEFDIVAQEMKAGKDKDKVMRDMGTRCGVQDVSSFV 251

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             +IQS  +GTSI ++LRV   E R +R+M AE+ A  L  K+T+  +   +P L+++++
Sbjct: 252 TVMIQSATFGTSIAEALRVYAGEMRDKRVMRAEEAANKLPTKMTLATMTLTVPPLLIILV 311

Query: 316 GPAILSIID 324
           GP+   I +
Sbjct: 312 GPSAQGIAN 320


>gi|77919352|ref|YP_357167.1| Flp pilus assembly protein TadC [Pelobacter carbinolicus DSM 2380]
 gi|77545435|gb|ABA88997.1| Flp pilus assembly protein TadC [Pelobacter carbinolicus DSM 2380]
          Length = 326

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 90/312 (28%), Positives = 162/312 (51%), Gaps = 10/312 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           AV I T +++  ++  + +  L     E+R++ +    +I  K++   L+ +        
Sbjct: 19  AVLILTFLTVALIVMGIYLLFLRKSREEERLEKLLPSSKIPFKKKPKLLEGEGN-----G 73

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             ++  +   + +  K   + ++I  +L  AG+RS  +    +  ++++ +IF +  +I 
Sbjct: 74  FVTRFAKPIDEIVANKPGALHKSIRLRLIQAGWRSNAAYYNFITTKVLLGLIFPLSYLIS 133

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
            F +   L++     V   +L+  +GF  P   +  +V+ RQ+ I RA PDALDL+++CV
Sbjct: 134 RFFFTFSLQF-----VLLCLLLAIIGFGLPDSILGFVVRSRQNRIMRALPDALDLMVVCV 188

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+ +D   RRV E+I   S  LS+E  LT  E+     R   F+N   RT +  V N 
Sbjct: 189 EAGLGLDMTFRRVGEEIRPLSHDLSDEFHLTNLEIRAGKPRNECFKNMSLRTGVPEVSNL 248

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              LIQ+ R+GTS+  +LRV     R +R   AE+KAA    KL  P++ F  P + +V+
Sbjct: 249 MTILIQTSRFGTSLAKALRVHSDAMRIKRRQIAEEKAAKSTVKLIFPLVFFIFPAIFVVL 308

Query: 315 IGPAILSIIDTM 326
           +GP ++ II+ +
Sbjct: 309 VGPGVIRIINVL 320


>gi|149911401|ref|ZP_01900019.1| hypothetical putative tight adherence TadC-related
           transmembraneprotein [Moritella sp. PE36]
 gi|149805509|gb|EDM65514.1| hypothetical putative tight adherence TadC-related
           transmembraneprotein [Moritella sp. PE36]
          Length = 325

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 84/327 (25%), Positives = 152/327 (46%), Gaps = 10/327 (3%)

Query: 3   HYFFDLFDATELA-VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
             F   F   E+   AI     I  +  AV + SL SG      K +    +        
Sbjct: 6   QLFETTFADPEMMKWAIYLIAGIAGITLAVALSSLASGLYSPVKKQLNKLSKESTSHDDL 65

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           + + +S+      + +            K    D +    L  AGF S+ +L I   ++L
Sbjct: 66  AKEYESSLEHTIDKLNHV------PFINKRYQGDSSTKKLLIHAGFHSQDALKIFNSIKL 119

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++    LI G +     +++  Y     V  ++ +    +  P + +  + ++R + +KR
Sbjct: 120 LLL---LISGALVTLLINQISSYSTTKTVYIILFVLGAAYLLPGIILKKIAKRRMADLKR 176

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
            +PDALDLL++C ESG+ + ++ +RVA+++      LS E+ L  +++ +    Q A + 
Sbjct: 177 YFPDALDLLIVCCESGLGLLESFQRVAKELQLAHPYLSYELNLVCSKVRYGLTLQQALKE 236

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
           F +RT ++ +R     ++QS R GT +  ++R+   E R +RL  AE+ AA LG K+  P
Sbjct: 237 FSDRTGLEDIRGLNSVIVQSLRLGTGVAATIRIYSDEYREKRLQAAEENAAKLGVKMIFP 296

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMKD 328
           M+    P   +V IGPA+L ++    D
Sbjct: 297 MMCCIWPSFFIVAIGPAVLKVMSVWGD 323


>gi|145219378|ref|YP_001130087.1| type II secretion system protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205542|gb|ABP36585.1| type II secretion system protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 313

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/316 (23%), Positives = 153/316 (48%), Gaps = 8/316 (2%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           EL   + +  ++ S+++ +   +L    L+KR+  +A      +    T  +   + +  
Sbjct: 6   ELLAIVLSGATVASIVFVLYNWALAH-TLQKRLTGIAG-----KNPDPTQNEPSGSEAFK 59

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + +  +    K    +       +  K   AG RS+ +      V+ ++ ++  ++  
Sbjct: 60  SAKVTSVINTLSKLSLPEEGWQSSAVQLKFLQAGIRSKNAPRYYFAVKTLLTVVLPVVLG 119

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           ++++        PF   +  V+     G+  P + +  + QKR   ++ + PD +DL++I
Sbjct: 120 LFLYFL--RPGVPFTQSMMLVLSTAAAGYYLPELALRFITQKRHERMRDSLPDMIDLMVI 177

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+ ID A+ R++ ++   +  L++E  L++ E+     R  A  N   RT++  + 
Sbjct: 178 CTESGMGIDSAIARISREMARGNPDLAQEFYLSVLEIRAGATRIEALRNLALRTRLKDMD 237

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +     +Q+ ++GT I  +LRV     RS R   AE+ AA +  K+TVP+++F  P L++
Sbjct: 238 DLVTMFVQAHKFGTGIAQALRVQSDMLRSRRTQRAEEMAAKIPVKMTVPLVLFIFPTLLM 297

Query: 313 VIIGPAILSIIDTMKD 328
           V++GPAI+ I++    
Sbjct: 298 VLLGPAIIQIMEIFSK 313


>gi|27365114|ref|NP_760642.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|320155497|ref|YP_004187876.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
 gi|27361260|gb|AAO10169.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|319930809|gb|ADV85673.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
          Length = 314

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 142/320 (44%), Gaps = 17/320 (5%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            F+   + +A+    +   ++   V+ S     ++K+++ +  E                
Sbjct: 12  QFNEQWVLLALILISTSLLVVTVAVVFSGNRAPVKKKLEQIHKEVS------------GK 59

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           A  +   +   +L +    +  K     E+I ++L  AGF +  +L +   +++   ++ 
Sbjct: 60  ALKKKSRKVENTLESLAPIVVGKDSKEKESIRSQLMHAGFHNRDALTVFYAIKIFFAVLG 119

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
                   F    +      +     ++    G   P++ +++ V+KRQ  I+   PDAL
Sbjct: 120 FGGAAAVFFLLPDMDNSTLVM-----VVAVAGGLYIPNIGLNHFVKKRQRMIRAGVPDAL 174

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL++C ESG+  + ALR+VA+++       ++E+    A++        AFE    RT 
Sbjct: 175 DLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCAKIKAGVEMSTAFEELVTRTG 234

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +      L  + + G S+  +LR    + R +R  E E+ AA +  K+  P+++F  
Sbjct: 235 LSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIW 294

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P   +V +GPA+LS+ D + 
Sbjct: 295 PCFFIVAVGPALLSLSDALG 314


>gi|37680835|ref|NP_935444.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37199584|dbj|BAC95415.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 329

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 142/320 (44%), Gaps = 17/320 (5%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            F+   + +A+    +   ++   V+ S     ++K+++ +  E                
Sbjct: 27  QFNEQWVLLALILISTSLLVVTVAVVFSGNRAPVKKKLEQIHKEVS------------GK 74

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           A  +   +   +L +    +  K     E+I ++L  AGF +  +L +   +++   ++ 
Sbjct: 75  ALKKKSRKVENTLESLAPIVVGKDSKEKESIRSQLMHAGFHNRDALTVFYAIKIFFAVLG 134

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
                   F    +      +     ++    G   P++ +++ V+KRQ  I+   PDAL
Sbjct: 135 FGGAAAVFFLLPDMDNSTLVM-----VVAVAGGLYIPNIGLNHFVKKRQRMIRAGVPDAL 189

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL++C ESG+  + ALR+VA+++       ++E+    A++        AFE    RT 
Sbjct: 190 DLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCAKIKAGVEMSTAFEELVTRTG 249

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +      L  + + G S+  +LR    + R +R  E E+ AA +  K+  P+++F  
Sbjct: 250 LSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIW 309

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P   +V +GPA+LS+ D + 
Sbjct: 310 PCFFIVAVGPALLSLSDALG 329


>gi|56697924|ref|YP_168295.1| TadC family type II/IV secretion system protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679661|gb|AAV96327.1| type II/IV secretion system protein, TadC subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 326

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 80/306 (26%), Positives = 157/306 (51%), Gaps = 6/306 (1%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
             AV +  L   ++   L   + E  +K +       R+    +L K       ++  ++
Sbjct: 21  LIAVGVLGLFMVLLAVPLLMSQPEDPLKKL------KREMNPNTLAKPKKEQLRQSGRNE 74

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L+ F   L  +       +  KLR AG++S+ ++      ++ + ++ L+LG++++F  
Sbjct: 75  QLQRFANFLEPQDADELSAMQLKLRQAGYQSKDAVRFFHFAQMALGLVGLVLGVLYVFVI 134

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
           +   +   Q  +  V+  G   +  P  WI+  V  R+ +I RA+PDALD+LL+CVE+G 
Sbjct: 135 EADKDLDGQAMLIRVLGPGGAAYFLPRYWITRRVDTRKENITRAFPDALDMLLVCVEAGQ 194

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ++ RV++++      L++E  +   E+     +     +   R  +  V +    +
Sbjct: 195 SLDQSIVRVSKELRASYPDLADEFEMVAYEMKAGKEKDKVLRDMGTRCGVVDVSSFVTVM 254

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS ++GTSI ++LRV   E R +R+M AE+ A  L  K+T+  ++  +P L+++++GP+
Sbjct: 255 IQSSQFGTSIAEALRVYAGEMRDKRVMRAEEAANKLPTKMTLATMMLTVPPLLIILVGPS 314

Query: 319 ILSIID 324
              I+D
Sbjct: 315 AKGIMD 320


>gi|114764951|ref|ZP_01444124.1| Putative Flp pilus assembly protein TadC [Pelagibaca bermudensis
           HTCC2601]
 gi|114542663|gb|EAU45687.1| Putative Flp pilus assembly protein TadC [Roseovarius sp. HTCC2601]
          Length = 323

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 76/321 (23%), Positives = 160/321 (49%), Gaps = 10/321 (3%)

Query: 2   PHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQIT 61
            +            + +   ++   ++ A+ +   G               + L K    
Sbjct: 5   LNTMITDMLGPAGPLMVVAGLAFLLIVAAIPLMLAGKP----------DPMDKLAKSGRD 54

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
            +  ++ +     R +  L  + + L  K+      +  KL  AG+R+  ++ +  + ++
Sbjct: 55  RVDAETKAILRDKRKNAKLNKYAQYLEPKSAEELGEVRMKLLQAGYRTRDAVRLYYLAQM 114

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           V+ +  L+ G+ +   +    E   Q ++  +IL G +G+ AP  WI+  V++R+  I+ 
Sbjct: 115 VLGLGLLVAGLTYYLMFIDGPESTMQQKLMYIILPGALGYLAPKYWITKRVEERKKQIEE 174

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
            +PDALD++L+CVE+G S+DQ++ RV+++I      L++E  +   E+    ++     +
Sbjct: 175 GFPDALDMMLVCVEAGQSLDQSIVRVSKEIRASYAALADEFEIISHEMKAGKDKASVLND 234

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              R  +  V +    L Q+  +GTSI D+LR+  SE R +R+M AE+KA  L  K+T+ 
Sbjct: 235 MGERCGVADVSSFVTVLNQASTFGTSIADALRIYASEMRDKRVMRAEEKANKLPTKMTLT 294

Query: 302 MIIFFLPVLILVIIGPAILSI 322
            ++  +P L+++++GP++++I
Sbjct: 295 TMMLTVPPLLIILVGPSVVNI 315


>gi|87312288|ref|ZP_01094386.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
 gi|87284992|gb|EAQ76928.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
          Length = 309

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 87/306 (28%), Positives = 149/306 (48%), Gaps = 8/306 (2%)

Query: 22  VSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           +++F LI A V   +        R +      + ++       ++D + + +     K+ 
Sbjct: 3   LAVFGLITAGVWWLIDSWSPSATRAE---DRLDDIKDPIGKKNREDRSGNAVSKVLEKAT 59

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
             F   L  K       +  +L  AGFRSE + NI L ++    +I LI+G   +     
Sbjct: 60  PAFAAPLQPKNAKDANALKERLTHAGFRSEAAPNIFLGLKFASLLIGLIVGGGLVVLLGN 119

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
             +      +        + F  PS+ +  L +KR+  I R  PDALDL+++CVE+G+ +
Sbjct: 120 YNQSDLFKGIAI----AGISFYIPSIGLWYLGKKRKEQIFRGLPDALDLMVVCVEAGLGL 175

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           DQA+RRV+E++      ++EE  L   +L     R        NRT +D +R+    LIQ
Sbjct: 176 DQAMRRVSEEMKKTYRVIAEEFGLCNFQLQVGRQRSDVLHELGNRTGVDDLRSLAAILIQ 235

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           +D++G+SI  +LRV     R+ R   AE+KAA    K+  P++ F  P + +V++GPA +
Sbjct: 236 ADKFGSSISQALRVQSDSMRTRRRQIAEEKAAKTAVKMIFPLVFFIFPGIFVVLVGPAAI 295

Query: 321 SIIDTM 326
           ++I  M
Sbjct: 296 TVIREM 301


>gi|283779212|ref|YP_003369967.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437665|gb|ADB16107.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 329

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 90/325 (27%), Positives = 159/325 (48%), Gaps = 6/325 (1%)

Query: 4   YFFDLFDATELAVAITTAVSIFSLIYAVVIPS--LGSGELEKRMKSVAVEREILRKQQIT 61
             F  F A+     I   +++F LI A+V  +    S    +  + +   ++ + +++  
Sbjct: 1   MIFTTFFASLQLSPIMVQIAVFGLIAALVWVAVDFFSARNSRAEQRLEDYKDPIARKRRE 60

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
              K   S  +      +     K L  K      N+  KL  AGFR E +  I L  + 
Sbjct: 61  EAAKKGGSDAMTRMLEAASPALAKPLQPKTAKEATNLKMKLSYAGFRGEGAPQIFLGAK- 119

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
               + LI+G+    G    +    Q  +  V+LI    F  P   +  L +KR+ SI  
Sbjct: 120 ---FVCLIIGLFLGGGTTVAIMGLSQGALMRVVLIAGGMFYFPDGIVWWLGRKRKESIFL 176

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             PDALDL+++CVE+G+ +DQA+R+V+E++      ++EE  L   +L     R    + 
Sbjct: 177 GLPDALDLMVVCVEAGLGLDQAMRKVSEEMRKSYRVIAEEFSLCNLQLQMGRGRTQVLQE 236

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
             +R+ +D +++ +  LIQ+D++G+SI  +LRV     R+ R   AE+KAA    KL  P
Sbjct: 237 LGSRSGVDDLKSLSSILIQADKFGSSIAQALRVQSDAMRTRRRQIAEEKAAKTAVKLIFP 296

Query: 302 MIIFFLPVLILVIIGPAILSIIDTM 326
           +++F  P + +V++GPA ++++  M
Sbjct: 297 LVLFIFPGIFVVLVGPAAITMVREM 321


>gi|148557757|ref|YP_001265339.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148502947|gb|ABQ71201.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 330

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 97/317 (30%), Positives = 162/317 (51%), Gaps = 1/317 (0%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
             FD             +  ++   ++ S+    + +R++++   RE L+     S  + 
Sbjct: 8   QFFDTLLSIGIALATAIVMLVVGHALVKSIARDPMARRVRALNDRREQLKAGVAASKTRR 67

Query: 67  SASSRLRTRD-SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
                 +       ++  +  + +      +     L  AG R++ +   ++  RLV P+
Sbjct: 68  RQKMDKKASISVDRMKAILGSMKMLQDSQLKAASLSLTRAGIRTKDAAITVIFFRLVSPV 127

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           +     ++ ++      E     +   V       + AP V++ NL+ KRQ +I++A PD
Sbjct: 128 LIGGTAVVGVYVLHWFPEASAFKQYMIVAGALIASYKAPDVYVKNLITKRQQAIRKALPD 187

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC E+G+S+D A  RVA ++      L +E  LT  EL FL +R+ AFEN   R
Sbjct: 188 ALDLLVICAEAGLSVDLAFNRVARELSKAYPELGDEFALTAIELGFLTDRRQAFENLAQR 247

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +D +R     +IQ+++YGT +  +LRVL +E R ER+M AE+KAA L   +TVP+I+F
Sbjct: 248 VNLDSIRGVVTTMIQTEKYGTPLAAALRVLSAEFRHERMMRAEEKAARLPAIMTVPLIMF 307

Query: 306 FLPVLILVIIGPAILSI 322
            LPVL +VI+GPA  SI
Sbjct: 308 ILPVLFIVILGPAACSI 324


>gi|254506677|ref|ZP_05118817.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
 gi|219550258|gb|EED27243.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
          Length = 314

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 67/329 (20%), Positives = 139/329 (42%), Gaps = 19/329 (5%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQ 59
           +  +        +        ++   +++ + +  LG    ++ R++ +           
Sbjct: 4   LLQFLDSFQINEQTFFLSVILIATVLVMFTLFLVVLGTRAPMKVRLEEL----------- 52

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
                      +   R   +L +    L        +++  +L  AG+    +L +   +
Sbjct: 53  --KKTAPGEKLKKGRRLGNTLDSIAPTLTPSNSKESQSLRQQLMHAGYHDANALTVFYAI 110

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           + +  ++ + +  +  F    +          A++    VG   P++ ++  V KRQS I
Sbjct: 111 KGMAILVGVGIAAMLYFFVPDMSNLK-----LAMVASVAVGLYTPNIGLNYFVNKRQSRI 165

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +   PDALDLL++C ESG+    ALRRVA+++       ++E+     ++        AF
Sbjct: 166 RGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFADELDTVCVKIKAGVEMSDAF 225

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           ++   RT +  +      L  + R G S+  +LR    + R +R  E E+ AA +  K+ 
Sbjct: 226 DDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDFRDKRNQEIEEIAAKIPTKMI 285

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            P+++F  P   +V IGP++LSI  T+ +
Sbjct: 286 FPLLLFIWPCFFIVAIGPSMLSITSTLGN 314


>gi|253996761|ref|YP_003048825.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983440|gb|ACT48298.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 312

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 81/318 (25%), Positives = 152/318 (47%), Gaps = 13/318 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +  ++   +   +++F +   ++     +  L  R+K +  ++            ++  
Sbjct: 1   MNTIQIIYLVLIFITVFVVAMVII-GQFSTSPLGARLKVLKDDKP----------DENDD 49

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                +R  K      K    K       +  +   AG RS     +    + ++ +   
Sbjct: 50  EPVWISRIVKLTGPIAKLSLPKEGWEHSQLRIRFMNAGLRSPSVPILFFAAKTILTLALP 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L +++      +        +  +IL+  +G+  P+  +S+ +  R+  I  ++PDALD
Sbjct: 110 SLFLLYTVISGSV--VKPNNLMMMLILLAAIGYFLPNAVLSHRIDSRKREIFESFPDALD 167

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVESG+ +D AL RV E++  +S  L EE+ L   EL    +R+ A  N   RT +
Sbjct: 168 LIIVCVESGLGLDAALARVGEEMHVRSPTLGEELHLINLELRAGSSRERALRNLALRTGV 227

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      L+QSDR+GT+I DSLRV     R++R + AE+ AA +  KL  P+I F  P
Sbjct: 228 EEVDTLVAMLVQSDRFGTNISDSLRVHADSLRTKRRLLAEEAAAKIAVKLLFPLIFFIFP 287

Query: 309 VLILVIIGPAILSIIDTM 326
            ++LV++GPA ++I + +
Sbjct: 288 SMLLVLLGPAFINIHNIL 305


>gi|86147459|ref|ZP_01065771.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
 gi|85834752|gb|EAQ52898.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
          Length = 323

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/296 (21%), Positives = 125/296 (42%), Gaps = 19/296 (6%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
            +       L+K++K ++  R                SSR     + +L +    +    
Sbjct: 41  FLFVGTRSPLDKKLKQISSGRHT--------------SSRKPYDFTNTLESLTPFIGRGN 86

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
              +E    KL  AG+  + +L++    +++  ++  +   +  +           +   
Sbjct: 87  KKDNETYSEKLMHAGYHEKSALSVFYAFKVLSALVGFVCAFMVFYLAIGGSYNNLLIVTC 146

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
                 +VG   P+  +S + + RQ  IK   PDALDLL++C ESG+  + AL RVA ++
Sbjct: 147 I-----FVGTFLPNFILSKMQKDRQRKIKNGVPDALDLLVVCTESGLGFNAALGRVANEL 201

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 L++E+    A++        A      RT +  +      L  + R G S+  +
Sbjct: 202 YISQPELADELDTVFAKIQAGVTMPDALSQLVERTGLHELDGLVSLLSHASRMGGSLAQT 261

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LR    + R +R   AE+ AA +  K+  PM++F  P   +V +GP ++ ++D + 
Sbjct: 262 LRDYTEDFRDKRQQAAEEIAAKIPTKMLFPMLLFIWPCFFIVALGPGMMIVMDALS 317


>gi|146276356|ref|YP_001166515.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554597|gb|ABP69210.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 323

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 150/326 (46%), Gaps = 12/326 (3%)

Query: 4   YFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
           Y  D        +A+   + I  +   + +      E   R+K+           Q T  
Sbjct: 10  YLIDSLGPLGPLMAMG-MLGILLIALTLPVMLKKRDEPFDRIKA-----------QRTVG 57

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
               + +  R+  ++ L  F   L  K          K+  AG+RS+ ++      +  +
Sbjct: 58  AAPVSQALRRSSGTEKLDRFANLLEPKTAEELSASRLKMMRAGYRSKGAVRAFHAAQFAL 117

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            + FL+LG+++            Q  V   +L G +G+  P  WI    Q+R   I   +
Sbjct: 118 GVGFLVLGVLYALLASATAPLTMQQMVIYTLLPGAIGYYLPVYWIKRRAQERHDQIVAGF 177

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALD++L+CVE+G S+DQ++ RVA +       L+EE  +   E+     R    ++  
Sbjct: 178 PDALDMMLVCVEAGQSLDQSILRVARESASGYPALAEEFEMVAHEVKAGKERVAVLKDMA 237

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  V +    LIQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  +
Sbjct: 238 ERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTM 297

Query: 304 IFFLPVLILVIIGPAILSIIDTMKDH 329
           +  +P L+L++IGP++  I   +   
Sbjct: 298 LLTVPPLMLILIGPSVYGIATQLGGQ 323


>gi|148976656|ref|ZP_01813343.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
 gi|145964007|gb|EDK29265.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
          Length = 323

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/296 (21%), Positives = 129/296 (43%), Gaps = 19/296 (6%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
            +       L+K++K +A                ++ASSR     + +L +    +    
Sbjct: 41  FLFVGARSPLDKKLKQIAG--------------GNNASSRKPYDFANTLESLTPFIGRGN 86

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
              +E    KL  AG+  + +L++   ++++  +I  +   +  +           +   
Sbjct: 87  QKDNETYSEKLMHAGYHEKSALSVFYALKILSMLIGFVCAFVVFYLSIGGSYNNLLIITC 146

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
                 +VG   P+  ++ + ++RQ  I+   PDALDLL++C ESG+  + AL RVA ++
Sbjct: 147 I-----FVGTFLPNFLLNKMQKERQRKIRNGVPDALDLLVVCTESGLGFNAALGRVANEL 201

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 L++E+    A++        A      RT +  +      L  + R G S+  +
Sbjct: 202 YISQPELADELDTVCAKIQAGVTMPDALTQLVERTGLHELEGLVSLLSHASRMGGSLAQT 261

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           LR    + R +R   AE+ AA +  K+  PM++F  P   +V +GP ++ ++D + 
Sbjct: 262 LRDYTDDFRDKRQQAAEEIAAKIPTKMLFPMLLFIWPCFFIVALGPGMMIVMDALS 317


>gi|163745841|ref|ZP_02153200.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161380586|gb|EDQ04996.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 326

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 76/308 (24%), Positives = 139/308 (45%), Gaps = 10/308 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I   + +  +   +V+           ++        L++         +     ++
Sbjct: 21  LIIIIGTLGVTLVALTLVMM----------LRQPEDPLSKLKRTSSAPAADGARQQLRQS 70

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             +  L+ F K L  + +         LR AG+RS  ++ +    +  + I+ L+ G+++
Sbjct: 71  DQNAQLQKFAKFLEPEDVAELSAKQLMLRQAGYRSRDAVRLYYFAQFALGILGLVGGLVY 130

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                       Q  +   I  G +G+  P  W+   V  R+  I R +PDALD++L+CV
Sbjct: 131 TKVLGGGEGMTTQQTMMWAIGPGAIGYYLPKYWVRRRVDSRKEEITRGFPDALDMMLVCV 190

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G S+DQ + RV  ++      L+EE  +   E+    +R     +   R  +  V + 
Sbjct: 191 EAGQSLDQCIVRVGRELRASYPALAEEFEMVAYEMKAGKDRITVLNDMSERCGVQDVSSF 250

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              LIQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  +   +P L++++
Sbjct: 251 VTVLIQSAAFGTSIADALRVYAEEMRDKRVMRAEEAANKLPTKMTLATMGLTVPPLLIIL 310

Query: 315 IGPAILSI 322
           IGP+   I
Sbjct: 311 IGPSAHGI 318


>gi|32473987|ref|NP_866981.1| secretion system protein TadC [Rhodopirellula baltica SH 1]
 gi|32444524|emb|CAD74523.1| probable secretion system protein TadC [Rhodopirellula baltica SH
           1]
          Length = 328

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 150/314 (47%), Gaps = 12/314 (3%)

Query: 19  TTAVSIFSLIYAVVIPSLGS------GELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
            T ++IF+ + +     L           E R++ +   +  +R   I + +K    +  
Sbjct: 19  LTTIAIFASVTSFAWFVLSKVGGDDQAPAESRLERMKDAKRGIR--DIAADEKQRTKNEA 76

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            T   +     +             +  KL  AGFR E +  I  +++LV   + L+LG 
Sbjct: 77  LTEALEKAATPIASSVSGNEEEMGKLREKLINAGFRRESAPVIFKLIQLVCTGVGLMLGG 136

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +     D L +      +  ++L    GF  PS+ +  +  KR+  I    PDALDL+++
Sbjct: 137 VTGAVLDGLTQG----MIIKLLLGMIGGFMIPSLILGFMASKRREKIFLGLPDALDLMVV 192

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVE+G+ +DQALR+VAE++      + EE  ++  +L     R         R+ +D ++
Sbjct: 193 CVEAGLGLDQALRKVAEEMQKSHKAIGEEFSISNHQLQLGSPRSEVLSGLGYRSGVDDLK 252

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                LIQ+D++G+S+  +LRV     R++R   AE+KAA    K+  P+++F  P + +
Sbjct: 253 QLASILIQADKFGSSVAQALRVQSDSMRTKRRQIAEEKAAKTAVKMIFPLVLFIFPGIFV 312

Query: 313 VIIGPAILSIIDTM 326
           V++GPA +++   M
Sbjct: 313 VLVGPAAINMYRQM 326


>gi|327543264|gb|EGF29697.1| flp pilus assembly protein TadC [Rhodopirellula baltica WH47]
          Length = 328

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 150/314 (47%), Gaps = 12/314 (3%)

Query: 19  TTAVSIFSLIYAVVIPSLGS------GELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
            T ++IF+ + +     L           E R++ +   +  +R   I + +K    +  
Sbjct: 19  LTTIAIFTSVTSFAWFVLSKVGGDDQAPAESRLERMKDAKRGIR--DIAADEKQRTKNEA 76

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            T   +     +             +  KL  AGFR E +  I  +++LV   + L+LG 
Sbjct: 77  LTEALEKAATPIASSVSGNEEEMGKLREKLINAGFRRESAPVIFKLIQLVCTGVGLMLGG 136

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +     D L +      +  ++L    GF  PS+ +  +  KR+  I    PDALDL+++
Sbjct: 137 VTGAVLDGLTQG----MIIKLLLGMIGGFMIPSLILGFMASKRREKIFLGLPDALDLMVV 192

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVE+G+ +DQALR+VAE++      + EE  ++  +L     R         R+ +D ++
Sbjct: 193 CVEAGLGLDQALRKVAEEMQKSHKAIGEEFSISNHQLQLGSPRSEVLSGLGYRSGVDDLK 252

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                LIQ+D++G+S+  +LRV     R++R   AE+KAA    K+  P+++F  P + +
Sbjct: 253 QLASILIQADKFGSSVAQALRVQSDSMRTKRRQIAEEKAAKTAVKMIFPLVLFIFPGIFV 312

Query: 313 VIIGPAILSIIDTM 326
           V++GPA +++   M
Sbjct: 313 VLVGPAAINMYRQM 326


>gi|260776710|ref|ZP_05885605.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607933|gb|EEX34198.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 314

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 70/318 (22%), Positives = 137/318 (43%), Gaps = 17/318 (5%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             +        ++   +++ + +  +G          + ++ E LR+   +   K S   
Sbjct: 14  DEQTVFLSLILLATVLVVFTLSLLLVGPKS------PLKLKLEQLRQSTRSDKLKKSR-- 65

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
               R   +L +    +        E+I  KL  AG+    +L +    + +   + L L
Sbjct: 66  ----RLDHTLESLAPVMKPSNSKESESIRQKLMHAGYHDANALTVFYAFKGMTVAVGLGL 121

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
              + F    +      +     +     G   P++ + +LV+KRQS I+   PDALDL+
Sbjct: 122 AAGFYFLTPDMAMLNLVM-----VASVGGGLYVPNILLGHLVKKRQSRIRGGIPDALDLM 176

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           ++C ESG+  + ALRRVA+++       ++E+     +++       AF +   RT +  
Sbjct: 177 VVCTESGLGFNSALRRVADEVAISHPDFADELDTVCVKINAGVEMSDAFNDLIERTGLIE 236

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +      L  + R G S+  +LR    + R +R  E E+ AA +  K+  P+++F  P  
Sbjct: 237 IAGLVTMLAHASRIGGSLAQTLREYTDDYRDKRNQEVEEIAAKIPTKMIFPLLLFIWPCF 296

Query: 311 ILVIIGPAILSIIDTMKD 328
            +V IGP++L    T+ +
Sbjct: 297 FIVAIGPSMLLFTSTLGN 314


>gi|220922784|ref|YP_002498086.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947391|gb|ACL57783.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 319

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 202/322 (62%), Gaps = 5/322 (1%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M      L D      ++  AV+  +  + ++ P L    L +RMKSV  ER+ +R ++ 
Sbjct: 1   MLDLLSSLID-PRFVGSMLAAVAAAATAFTLLQPFLEPDRLARRMKSVGEERDRIRLRER 59

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
             L +      LR +    ++  V++  L   L  ++  N+L  AG+R   +    L  R
Sbjct: 60  ERLNQRGN---LRQQPKAYMKRVVERFKLDNWLATDDAKNRLMMAGYRGPQAETAFLFFR 116

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LV+P++F ++ + ++F    L + PF +R+  VI   Y G  AP +++ N   KRQ+ IK
Sbjct: 117 LVMPVVFFVVSVFYLFVLHAL-DQPFSIRLMIVIAAVYAGIKAPEIFLKNQTTKRQAEIK 175

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           + WPDALDL+LICVESG++I+ + RRV+ ++  QS+ L+EE+ LT AELS+L +R++A+E
Sbjct: 176 KHWPDALDLMLICVESGMAIEHSFRRVSAEMANQSIVLAEELALTTAELSYLTDRRIAYE 235

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           N   RT ++ V+  + AL+Q++RYGT +G +LRVL  E+R +R+ EAEKKAA+L PKLTV
Sbjct: 236 NLAMRTGLESVKAVSTALVQAERYGTPVGQALRVLAQESRDQRMNEAEKKAAALPPKLTV 295

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           PMI+FFLPVL +VI+ PA++ I
Sbjct: 296 PMILFFLPVLFVVILTPAMVQI 317


>gi|94309584|ref|YP_582794.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353436|gb|ABF07525.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Cupriavidus metallidurans CH34]
          Length = 323

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 87/323 (26%), Positives = 156/323 (48%), Gaps = 12/323 (3%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
               F A +L V     V+ F  +  V +       +  RM+ +A E          ++ 
Sbjct: 4   IMQGFRADQLIVLALVFVAAFGTVLGV-LYVFSPDRMRGRMEQIASET--------GTVP 54

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
            ++   +            V +L+L      +  +  +   AG+R   +  +    + ++
Sbjct: 55  GNAGQQQAWVEKLVKWAQPVSRLSLPKEGWENSQLRVRFMNAGWRDASAAPLYFAAKTLL 114

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            +   ++G+I         E      V AV+    +G+  P++ +S  V  RQ ++   +
Sbjct: 115 AVALPMIGLIATSSVPAFQEQSTTFAVLAVL--AAIGYYIPNIVLSRKVTARQRTVFEEF 172

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L + EL    +++ A  N  
Sbjct: 173 PDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRSGFSKEKALSNLS 232

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R M AE++AA +  KL  P+I
Sbjct: 233 LRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQAAKIALKLLFPLI 292

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
               P L+LV++GPA + I   +
Sbjct: 293 FTIFPTLLLVLLGPAFIQIYRVL 315


>gi|269966900|ref|ZP_06180973.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           alginolyticus 40B]
 gi|269828567|gb|EEZ82828.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           alginolyticus 40B]
          Length = 313

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 69/316 (21%), Positives = 133/316 (42%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  +     ++   ++  +    +G     KR             +           S  
Sbjct: 16  ETLLMGLILITTVLVVMTLGSIIIGVNSPIKR-------------KLAELSGDKKEVSHH 62

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + S +L +     +  +    +   NKL  AGF    +L++   ++ V  I+ +++  
Sbjct: 63  NKKMSDTLESLAPLTSPTSEKERQTTRNKLMHAGFHESNALSMFYAIKSVTTILGVMVAA 122

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +  F   +       + +       ++G   P   +  +V KRQ +I+   PD LDLL++
Sbjct: 123 LVYFSVPESKYLYTYMAL-----SVFIGLLFPDFILRRMVNKRQQAIRAGVPDMLDLLVV 177

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+     ++        A      RT ++ + 
Sbjct: 178 CTESGLGFNAALRRVADELVISHPELADEIDTVCNKIKAGKPMPEALRELVLRTGLEELM 237

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+ +SLR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 238 GLVSMLSHASRIGGSLVNSLREYTEDYRDKRQQAAEEIAAKIPVKMMFPMVLFIWPCFFI 297

Query: 313 VIIGPAILSIIDTMKD 328
           V IGPA++S+ +   +
Sbjct: 298 VAIGPALISLAEAFSN 313


>gi|168702877|ref|ZP_02735154.1| probable secretion system protein TadC [Gemmata obscuriglobus UQM
           2246]
          Length = 319

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 86/313 (27%), Positives = 149/313 (47%), Gaps = 10/313 (3%)

Query: 17  AITTAVSIFS-LIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            I   V+I +   + + + S  + + E+R+     ER    K  +        S      
Sbjct: 14  PILVFVAIMAGTFWLLSLISSRNSQAEERL-----ERIGRPKSLVEIEMSQGESGNRFKG 68

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
              +  N    +  +  L   +I  +L  AGFRSE +  +   +R    ++ L++ ++  
Sbjct: 69  IKDAFSNLGGVMEPRTELEKNSIRIQLANAGFRSENAAGVYQGIR----VVCLVVFLLPA 124

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
             +  L +      +   + +G +GF  P + + +L   RQ  I    PDALDLL++CVE
Sbjct: 125 LFFFLLKDGFTLKSIEWTVALGGMGFYLPQMGLYHLRSTRQKEIFLTLPDALDLLVVCVE 184

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG+ +D ALR+V +++ G +  + EE  L   +L     R+    +   RT +D VR+  
Sbjct: 185 SGLGLDAALRKVTDEMKGHAKTICEEFSLANLQLQMGRPRREVLHDLGVRTGVDDVRSLA 244

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQ+DR+G+SI  +LRV     R  R   AE+KAA    +L  P+++F  P + +V++
Sbjct: 245 AILIQADRFGSSIAQALRVQSDSMRVRRRQIAEEKAAKTAVQLIFPLVLFIFPSIFVVLV 304

Query: 316 GPAILSIIDTMKD 328
           GPA + I   +  
Sbjct: 305 GPAAIQIHKNLLK 317


>gi|254229337|ref|ZP_04922754.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262393424|ref|YP_003285278.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio sp. Ex25]
 gi|151938145|gb|EDN56986.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262337018|gb|ACY50813.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio sp. Ex25]
          Length = 313

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 68/316 (21%), Positives = 133/316 (42%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  +     ++   ++  +    +G     KR             +           S  
Sbjct: 16  ETLLMGLILITTVLVVMTLGSVIIGVNSPIKR-------------KLAELSGDKKEVSHH 62

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + + +L +     +  +    +   NKL  AGF    +L++   ++ V  I+ +++  
Sbjct: 63  NKKMADTLESLAPLTSPTSEKERQTTRNKLMHAGFHESNALSMFYAIKSVTTILGVMVAA 122

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +  F   +       + +       ++G   P   +  +V KRQ +I+   PD LDLL++
Sbjct: 123 LVYFSIPESKYLYTYMAL-----SVFIGLLIPDFILRRMVNKRQQAIRAGVPDMLDLLVV 177

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+     ++        A      RT ++ + 
Sbjct: 178 CTESGLGFNAALRRVADELVISHPELADEIDTVCNKIKAGKPMPEALRELVLRTGLEELM 237

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+ +SLR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 238 GLVSMLSHASRIGGSLVNSLREYTEDYRDKRQQAAEEIAAKIPVKMMFPMVLFIWPCFFI 297

Query: 313 VIIGPAILSIIDTMKD 328
           V IGPA++S+ +   +
Sbjct: 298 VAIGPALISLAEAFSN 313


>gi|78186531|ref|YP_374574.1| TadC protein [Chlorobium luteolum DSM 273]
 gi|78166433|gb|ABB23531.1| TadC protein [Chlorobium luteolum DSM 273]
          Length = 313

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/318 (22%), Positives = 151/318 (47%), Gaps = 10/318 (3%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            EL   + +  +  +L+Y +   +     L KR+  +A +            +  ++   
Sbjct: 5   LELLAIVLSGAAAVALVYVLYDWAAA-YALNKRISGIAGKDTARTPAVSAGTKAANS--- 60

Query: 72  LRTRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                  ++ N + +L+L         +  K   AG RS+ +      V+ ++ ++    
Sbjct: 61  ---ATVGNVINILSRLSLPEEGWQSSAVQLKFLQAGIRSKNAPRYYFAVKTLLTVVLPAA 117

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             ++++ +      P    +  V+     G+  P + +  + Q+R   ++ + PD +DL+
Sbjct: 118 LGLFLYFF--RPGVPLTQSLLLVLSTAAAGYYIPELALRFITQQRHERMRNSLPDMIDLM 175

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           ++C ESG+ ID A+ R++ ++   +  L++E  L++ E+     R  A  N   RT +  
Sbjct: 176 VVCTESGMGIDSAIARISREMARGNPDLAQEFYLSVLEIRAGATRIEALRNLALRTNLKD 235

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           + +     +Q+D++GT + +SLRV     RS R   AE+ AA +  K+T+P+++F  P L
Sbjct: 236 MNDLVTMFVQADKFGTGMAESLRVQSDMLRSRRTQRAEEMAAKIPVKMTIPLVLFIFPTL 295

Query: 311 ILVIIGPAILSIIDTMKD 328
           ++V++GPAI+ I++    
Sbjct: 296 LMVLLGPAIIQIMEVFSK 313


>gi|113866736|ref|YP_725225.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525512|emb|CAJ91857.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 324

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 87/322 (27%), Positives = 157/322 (48%), Gaps = 10/322 (3%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
               F A +  V     V+ F  ++ V +       L  R + +A +   L         
Sbjct: 4   IIQGFQADQFVVLALIFVAAFGTVFGV-LYVFSPNRLRGRAEQIAGQAGQLG-------A 55

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                + L  +  +  +   +    K       +  +   AG+R+  +  +    + V+ 
Sbjct: 56  DPGKQNPLYEKLVQWAQPVSRLSLPKEGWESSQLRVRFMNAGWRNASAAPLYFAAKTVLA 115

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I   ++G++   G   L +      + AV+  G +G+  P+V ++  V +RQ ++   +P
Sbjct: 116 IALPMIGLLAAAGQPGLQDRNIMFALLAVL--GAIGYYLPNVVLARKVAQRQRTVFEEFP 173

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L + EL    +++ A  N   
Sbjct: 174 DVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRSGFSKEKALSNLSL 233

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 234 RTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQAAKIALKLLFPLIF 293

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+LV++GPA + I   +
Sbjct: 294 TIFPSLLLVLLGPAFIQIYRVL 315


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 69/313 (22%), Positives = 140/313 (44%), Gaps = 18/313 (5%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + I  A  +  L+Y +V+       +++R+K +  E       +++  +K ++   L   
Sbjct: 346 LGIIAASGVLFLVYGLVLAQ-RPSPIQRRLKKLLHEEHQDTPPEVSVTKKKTSIVDLIKP 404

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +   V +           IV+KL AA +     L   + +++++            
Sbjct: 405 LVPLVSVTVVRWIPGKWQRF--IVDKLIAAAYPHGIRLAHFITIQVLL------------ 450

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                +L       +   +++   G   P  W+S  + +R+  I    PDALDLL I VE
Sbjct: 451 GLTGLVLGLLLTHNLILGLVLLAAGVYLPLFWLSREITQRRRRILLQMPDALDLLTISVE 510

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+  D A+    E +      ++ E  L ++E+    +R+ A  +   R Q+D ++   
Sbjct: 511 AGLGFDAAML---EIVQKWDNDIAREFALVLSEMKLGKSRRDALRSMAERVQLDEMKLLV 567

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            +++Q+D  G SIG +L +   + R  R   AE+       K+ +PM++F  P + +V++
Sbjct: 568 SSIVQADEIGASIGRTLSIQSEQMRLRRRQRAEELGHKAVIKIIIPMVLFIFPAVFVVLL 627

Query: 316 GPAILSIIDTMKD 328
           GPAI +I++ + +
Sbjct: 628 GPAIPTILNALGN 640


>gi|77462448|ref|YP_351952.1| putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
 gi|77386866|gb|ABA78051.1| Putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
          Length = 326

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 85/311 (27%), Positives = 145/311 (46%), Gaps = 2/311 (0%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              +     +  ++I       L+KR++    +R   ++    +       +  R   S+
Sbjct: 18  LGPLIAVGSLGILLIALTLPVMLKKRVEPF--DRIRAQRTAAVAAPVQKGQALRRASGSE 75

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L  F   L  K          K+  AG+RS+ ++      +  + + FL  G+++    
Sbjct: 76  KLDRFANLLEPKTAEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLAAGLLYAMVA 135

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                   Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++L+CVE+G 
Sbjct: 136 SAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMMLVCVEAGQ 195

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  V +    L
Sbjct: 196 SLDQSILRVARESAAGYPALAEEFEIVAHEVKAGKERVAVLKDMSERVGIPDVSSFVTTL 255

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L+L++IGP+
Sbjct: 256 IQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPLMLILIGPS 315

Query: 319 ILSIIDTMKDH 329
           +  I   +   
Sbjct: 316 VYGIATQLGGQ 326


>gi|260771470|ref|ZP_05880395.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
 gi|260613596|gb|EEX38790.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
          Length = 318

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/315 (22%), Positives = 144/315 (45%), Gaps = 13/315 (4%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +        ++   LI +V +  +G+    +R        ++   ++  +++     ++ 
Sbjct: 16  QTVFLGLILIATVLLIMSVALIVVGTKAPIQR--------QLEEIRKEGTVKTPGNLAKK 67

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R +   +L +    ++ K I   E++ ++L  AG+    +LN    ++++  +  + +  
Sbjct: 68  RDKIHNTLESIAPIMSPKNIKERESVRHQLMHAGYHDASALNTFYALKVLSTLAGVSISA 127

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +  F Y  +           V+    +G   P+  +  +V+KR+S IK   PDALDLL++
Sbjct: 128 LMYFLYPDMKNLK-----LIVVFSVAMGLFLPNFLLDRMVKKRKSRIKGGIPDALDLLVV 182

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+    A++        A      RT +  + 
Sbjct: 183 CTESGLGFNAALRRVADELMISHPDLADELDTVCAKIKAGVEMSEAMAQLVERTGLTEIS 242

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G SI  +LR    + R +R  E E+ AA +  K+  P+++F  P   +
Sbjct: 243 GLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEIEEIAAKIPTKMIFPLLLFIWPCFFI 302

Query: 313 VIIGPAILSIIDTMK 327
           V +GP++LS+     
Sbjct: 303 VAVGPSMLSLTAHFG 317


>gi|332560332|ref|ZP_08414654.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
 gi|332278044|gb|EGJ23359.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
          Length = 326

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 85/311 (27%), Positives = 146/311 (46%), Gaps = 2/311 (0%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              +     +  ++I       L+KR++    +R   ++    +       +  R   S+
Sbjct: 18  LGPLIAVGSLGILLIALTLPVMLKKRVEPF--DRIRAQRTAAVAAPVQKGQALRRASGSE 75

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L  F   L  K          K+  AG+RS+ ++      +  + + FL+ G+++    
Sbjct: 76  KLDRFANLLEPKTAEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLVAGLLYAMVA 135

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                   Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++L+CVE+G 
Sbjct: 136 SAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMMLVCVEAGQ 195

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  V +    L
Sbjct: 196 SLDQSILRVARESAAGYPALAEEFEMVAHEVKAGKERVAVLKDMSERVGIPDVSSFVTTL 255

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L+L++IGP+
Sbjct: 256 IQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPLMLILIGPS 315

Query: 319 ILSIIDTMKDH 329
           +  I   +   
Sbjct: 316 VYGIATQLGGQ 326


>gi|325108941|ref|YP_004270009.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324969209|gb|ADY59987.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 310

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 81/318 (25%), Positives = 154/318 (48%), Gaps = 11/318 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T++     +  +I +LI+ V              + V    E +R       +  + 
Sbjct: 1   MDFTQIL-PYASFGAIVALIWFVFSLLGNKQ------ERVEERLEDIRDPSRRFKESSAE 53

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
              +    +K+     K L  K  L +  +  ++  AGF S  +    L ++ +  I  L
Sbjct: 54  RDGVGNMLNKAAPTLSKALKPKTELEESALKIRMANAGFNSPNAPQAYLAIKFISMIGGL 113

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++G  + F    + +  +     AV++   +GF  P + ++ ++ KR+ +I    PDALD
Sbjct: 114 LVGSSFGFLQYGMTQNGWT----AVVIGAGLGFYLPELILAYVISKRKQAIFLTMPDALD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL++CVESG+ +DQ + RV  ++   +  +  E  L   +L    NR+    +   RT +
Sbjct: 170 LLVVCVESGLGLDQGMNRVTAELSDTAPEICAEFSLCNFQLQMGRNRREVLHDLGVRTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D ++     LIQ+DR+G+SI  +LRV     R +R+  AE+KA     ++  P+++F  P
Sbjct: 230 DDMKALAAILIQADRFGSSIAQALRVQSDSMRVKRMQIAEEKAQKTAVQMIFPLVLFIFP 289

Query: 309 VLILVIIGPAILSIIDTM 326
            + +V++GPA +S++D++
Sbjct: 290 GIFVVLVGPAAISMMDSL 307


>gi|258621455|ref|ZP_05716489.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|258627496|ref|ZP_05722277.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|262171240|ref|ZP_06038918.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
 gi|258580302|gb|EEW05270.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|258586843|gb|EEW11558.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|261892316|gb|EEY38302.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
          Length = 314

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/316 (21%), Positives = 137/316 (43%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           +        VS   L+  V +   G    ++K+++ +  E               +   +
Sbjct: 16  QWVFLALILVSTSLLVVTVALVFSGNRAPMKKKLEQINKELS------------GNTLKK 63

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
              +   +L +       K      +I  +L  AGF +  +L++   ++    I+     
Sbjct: 64  KNRKVDNTLESLAPISAGKESKERASIRTQLMHAGFHNRDALSLFYALKTSFAILGFSGA 123

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +  F    +      +     ++    G   P++ + + V++RQ +I+   PDALDLL+
Sbjct: 124 ALVFFLLPDMDNGTLVM-----LVSVAGGLYLPNMGLHHFVKERQRTIRAGVPDALDLLV 178

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +C ESG+  + ALR+VA+++       ++E+    A++        AF+    RT +  +
Sbjct: 179 VCTESGLGFNAALRKVADELAISHPEFADELDTVCAKIKAGVEMHTAFDELVARTGLTEI 238

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R     L  + + G S+  +LR    + R +R  E E+ AA +  K+  P+++F  P   
Sbjct: 239 RGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIWPCFF 298

Query: 312 LVIIGPAILSIIDTMK 327
           +V IGPA+LS+ D + 
Sbjct: 299 IVAIGPALLSLSDALG 314


>gi|315181052|gb|ADT87966.1| Flp pilus assembly protein TadC [Vibrio furnissii NCTC 11218]
          Length = 318

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 71/315 (22%), Positives = 144/315 (45%), Gaps = 13/315 (4%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +        ++   LI +V +  +G+    +R        ++   ++  +++     ++ 
Sbjct: 16  QTVFLGLILIATVLLIMSVALIVVGTKAPIQR--------QLEEIRKAGTVKTPGNLTKK 67

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R +   +L +    ++ K I   E++ ++L  AG+    +LN    ++++  +  + +  
Sbjct: 68  RDKIHNTLESIAPIMSPKNIKERESVRHQLMHAGYHDASALNTFYALKVLSTLAGVSISA 127

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +  F Y  +           V+    +G   P+  +  +V+KR+S IK   PDALDLL++
Sbjct: 128 LMYFLYPDMKNLK-----LIVVFSVAMGLFLPNFLLDRMVKKRKSRIKGGIPDALDLLVV 182

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+    A++        A      RT +  + 
Sbjct: 183 CTESGLGFNAALRRVADELMISHPDLADELDTVCAKIKAGVEMSEAMAQLVERTGLTEIS 242

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G SI  +LR    + R +R  E E+ AA +  K+  P+++F  P   +
Sbjct: 243 GLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEIEEIAAKIPTKMIFPLLLFIWPCFFI 302

Query: 313 VIIGPAILSIIDTMK 327
           V +GP++LS+     
Sbjct: 303 VAVGPSMLSLTAHFG 317


>gi|126461326|ref|YP_001042440.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638311|ref|YP_002524573.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
 gi|126102990|gb|ABN75668.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159092|gb|ACM00072.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
          Length = 326

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 85/311 (27%), Positives = 145/311 (46%), Gaps = 2/311 (0%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              +     +  ++I       L+KR++    +R   ++    +       +  R   S+
Sbjct: 18  LGPLIAVGSLGILLIALTLPVMLKKRVEPF--DRIRAQRTAAVAAPVQKGQALRRASGSE 75

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            L  F   L  K          K+  AG+RS+ ++      +  + + FL  G+++    
Sbjct: 76  KLDRFANLLEPKTAEEMSASRLKMMRAGYRSKGAVRAFHAAQFALGVGFLAAGLLYAMVA 135

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                   Q  V   IL G +G+  P  WI    Q+R   I   +PDALD++L+CVE+G 
Sbjct: 136 SAAAPLTMQQMVLYTILPGAIGYYLPVYWIKRRAQERYDQIVSGFPDALDMMLVCVEAGQ 195

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ++ RVA +       L+EE  +   E+     R    ++   R  +  V +    L
Sbjct: 196 SLDQSILRVARESAAGYPALAEEFEMVAHEVKAGKERVAVLKDMSERVGIPDVSSFVTTL 255

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           IQS  +GTSI ++LRV  SE R +R+M AE+KA +L  KLT+  ++  +P L+L++IGP+
Sbjct: 256 IQSATFGTSIAEALRVYSSEMRDKRVMRAEEKANTLPTKLTLGTMLLTVPPLMLILIGPS 315

Query: 319 ILSIIDTMKDH 329
           +  I   +   
Sbjct: 316 VYGIATQLGGQ 326


>gi|78186665|ref|YP_374708.1| TadC protein [Chlorobium luteolum DSM 273]
 gi|78166567|gb|ABB23665.1| TadC protein [Chlorobium luteolum DSM 273]
          Length = 315

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/309 (22%), Positives = 149/309 (48%), Gaps = 10/309 (3%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
           +  ++ S++ A+         ++KR+ S+  E  +  +            + +       
Sbjct: 13  SGAAVASVVLAIYNW-GAGNAIKKRLISILHESRLPDEGARPKSAAARKITPV------- 64

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           +    K    +       +      AG RS  +      ++ ++ ++  +L  ++++   
Sbjct: 65  IDVLSKLSIPEKGWQSSGVQLLFLQAGIRSINAPRYYFALKTLLSVVLPVLLGLFLYV-- 122

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
           +    P    +  V+     G+  P + +  + +KR   ++ + PD +DL++IC ESG+ 
Sbjct: 123 RAPGVPPTRTMIFVVCTAAAGYYLPEMLLGFITRKRIGRLRDSLPDMIDLMVICTESGMG 182

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           ID A+ R+++++ G +  L++E  L+  E+     R  A  N   R++++ + +    L 
Sbjct: 183 IDAAITRISKEMAGTNPDLAQEFYLSALEIRAGATRIEALRNLALRSRLEDLDDLVSVLA 242

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q+DR+GTS+ +SLRV     RS R   AE+ AA +  K+ +P+I+F  P L++V++GPA+
Sbjct: 243 QADRFGTSLAESLRVQSDMMRSRRTQRAEELAAKIPVKMLLPLILFIFPTLMMVLLGPAV 302

Query: 320 LSIIDTMKD 328
           + ++  + +
Sbjct: 303 IQVMHALSN 311


>gi|323499916|ref|ZP_08104875.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
 gi|323315157|gb|EGA68209.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
          Length = 314

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/330 (20%), Positives = 136/330 (41%), Gaps = 21/330 (6%)

Query: 3   HYFFDLFDATEL----AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQ 58
            + + +    ++           V+   +++ + +              V     +  + 
Sbjct: 2   DFIYQILADLQIEEQTFFLGVILVATVLVMFTLFLVV------------VGTRAPMSVRL 49

Query: 59  QITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLV 118
           +           +   R   +L +    L       ++++  +L  AG+    +L +   
Sbjct: 50  EELKKTAPGEKLKKGRRLGNTLDSIAPTLTPSNSKENQSVRQQLMHAGYHDANALTVFYA 109

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
           ++    ++ + +     F    +          A+I     G   P+V ++ +V+KRQS 
Sbjct: 110 IKGAAILVGVGMAATLYFLVPDMSNLN-----LAMIFSVAFGLYIPNVGLNYVVKKRQSR 164

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I+   PDALDLL++C ESG+    ALRRVA+++       ++E+     ++        A
Sbjct: 165 IRGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFADELDTVCVKIKAGVEMSDA 224

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
           FE+   RT +  +      L  + R G S+  +LR    + R +R  E E+ AA +  K+
Sbjct: 225 FEDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDFRDKRNQEIEEIAAKIPTKM 284

Query: 299 TVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             P+++F  P   +V IGP++L +  T+ +
Sbjct: 285 IFPLLLFIWPCFFIVAIGPSMLFLTATLGN 314


>gi|28899184|ref|NP_798789.1| putative tight adherence TadC-like transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836802|ref|ZP_01989469.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|260361577|ref|ZP_05774604.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|260876734|ref|ZP_05889089.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|260898188|ref|ZP_05906684.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|260900405|ref|ZP_05908800.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|28807408|dbj|BAC60673.1| putative tight adherence TadC-related transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749948|gb|EDM60693.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|308089100|gb|EFO38795.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|308091488|gb|EFO41183.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|308109137|gb|EFO46677.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|308113997|gb|EFO51537.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|328474278|gb|EGF45083.1| putative tight adherence TadC-like transmembrane protein [Vibrio
           parahaemolyticus 10329]
          Length = 313

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/316 (21%), Positives = 132/316 (41%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  +     V+   ++  +    +G     KR             +              
Sbjct: 16  ETLLMGLILVTTVLVVMTLGSIIVGVNSPIKR-------------KLAELSGDKKPLPTH 62

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + + +L +     +  +    +   NKL  AGF    SL++   ++ +  I+ +++ +
Sbjct: 63  NKKMADTLESLAPLTSPTSEKERQTTRNKLMHAGFHQSNSLSMFYAIKSITTILGIMIAV 122

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +      +       + +       ++G   P   +  +V KRQ +I+   PD LDLL++
Sbjct: 123 LVYLTVPESKYLYTYMAL-----SAFIGLLIPDFMLRRMVNKRQQAIRAGVPDMLDLLVV 177

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA++I      L++E+     ++        +      RT ++ + 
Sbjct: 178 CTESGLGFNAALRRVADEIVISHPELADEVDTVCNKIQAGKPMPESLRELVVRTGLEELM 237

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+ +SLR    + R +R   AE+ AA +  K+  PM+IF  P   +
Sbjct: 238 GLVSMLSHASRIGGSLVNSLREYTEDYRDKRQQAAEEIAAKIPVKMMFPMVIFIWPCFFI 297

Query: 313 VIIGPAILSIIDTMKD 328
           V IGPA++S+ +   +
Sbjct: 298 VAIGPALISLAEAFSN 313


>gi|262165914|ref|ZP_06033651.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
 gi|262025630|gb|EEY44298.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
          Length = 314

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 69/316 (21%), Positives = 138/316 (43%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           +        VS   L+  V +   G    ++K+++ +  E               +   +
Sbjct: 16  QWVFLALILVSTSLLVVTVALVFSGNRAPMKKKLEQINKELS------------GNTLKK 63

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
              +   +L +       K      +I  +L  AGF +  +L++   ++    I+ +   
Sbjct: 64  KNRKVDNTLESLAPISAGKESKERASIRTQLMHAGFHNRDALSLFYALKTSFAILGVSGA 123

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +  F    +      +     ++    G   P++ + + V++RQ +I+   PDALDLL+
Sbjct: 124 ALVFFLLPDMDNGTLVM-----LVSVAGGLYLPNMGLHHFVKERQRTIRAGVPDALDLLV 178

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +C ESG+  + ALR+VA+++       ++E+    A++        AF+    RT +  +
Sbjct: 179 VCTESGLGFNAALRKVADELTISHPEFADELDTVCAKIKAGVEMHTAFDELVARTGLTEI 238

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R     L  + + G S+  +LR    + R +R  E E+ AA +  K+  P+++F  P   
Sbjct: 239 RGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEVEEIAAKIPTKMIFPLLLFIWPCFF 298

Query: 312 LVIIGPAILSIIDTMK 327
           +V IGPA+LS+ D + 
Sbjct: 299 IVAIGPALLSLSDALG 314


>gi|259418040|ref|ZP_05741959.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346946|gb|EEW58760.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 323

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 76/322 (23%), Positives = 148/322 (45%), Gaps = 10/322 (3%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           M              +A+     +  ++  V   +     L+K          + R    
Sbjct: 7   MQDLLIYYLGDFGPLLAVGFIGLVLIIVAVVFALNQPEDPLKK----------LQRDLAS 56

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
               K       +   ++ L+ F   L  +       +  KLR AG++S+ ++ +   ++
Sbjct: 57  NQSAKPQNERLRQASRNEQLQKFANFLEPQDAEELSAMQLKLRQAGYQSKDAVRLFHFLQ 116

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
             + +  L LG+ +++  +  ++Y        V+  G   +  P  WI+  +++R+ +I 
Sbjct: 117 FALGLSGLGLGLFFVYVMNADVDYTTNQMAMRVLGPGAACYYLPRYWITRRIEERKQAIT 176

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RA+PDALD++L+CVE+G S+DQA+ RV +++      L+EE  +   E+     +     
Sbjct: 177 RAFPDALDMMLVCVEAGQSLDQAIVRVGKELRASYPELAEEFEIVAYEMKAGKEKDKVLR 236

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           +   R  +  V +    +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+
Sbjct: 237 DMGTRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRAEEAANKLPTKMTL 296

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
             +   +P L+ ++I P++  +
Sbjct: 297 ATMGLTVPPLLAILIAPSVQGL 318


>gi|73542334|ref|YP_296854.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119747|gb|AAZ62010.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 323

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 86/322 (26%), Positives = 158/322 (49%), Gaps = 10/322 (3%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
               F + +L V     V+ F +++ V+     +     RM+  A +      Q      
Sbjct: 4   IIQGFQSDQLIVLTLIFVAAFGMVFGVLYAFSPN-----RMRGRAEQLAGQPGQASGRSG 58

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           +  A      + ++ +         K       +  +   AG+RS  +  +    + ++ 
Sbjct: 59  RQQAWIDKLVQWTQPVSRLS---LPKEGWEGSQLRVRFMNAGWRSTSAAPLYFTAKTILA 115

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I   ++G+I +     L +    L +  +  +  +G+  P+  +S+ V +RQ ++   +P
Sbjct: 116 IALPMIGLIAVSNQPALQQQHIMLALLTL--LAAIGYYLPNTVLSHKVAERQRAVFEEFP 173

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L + EL    +++ A  N   
Sbjct: 174 DVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRSGFSKEKALSNLSL 233

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT ++ V      LIQ+DR+GTS+GDSLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 234 RTGVEDVDKFASMLIQADRFGTSLGDSLRVLSDMLRTKRRMRAEEQAAKIALKLLFPLIF 293

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+LV++GPA + I   +
Sbjct: 294 TIFPSLLLVLLGPAFIQIYRVL 315


>gi|91788419|ref|YP_549371.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697644|gb|ABE44473.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 314

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 86/318 (27%), Positives = 148/318 (46%), Gaps = 12/318 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               +LA      V++F ++  + +    +  ++ R+               ++   +  
Sbjct: 1   MTTLQLAFLGLIFVAVFGVVM-LALRLFAANPVQDRLDVAVGR---------STPIANDE 50

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            +    R  K      K            +  +   AGFR   +  I    +  +     
Sbjct: 51  PNPWVARIIKLSGPLAKLSLPSDGWEMSALRTRFMNAGFRQPSAPAIYFAAKTTLAAGLP 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++    +       +Y     +  ++     G+  P+V + NL+ +RQ  I  ++PDALD
Sbjct: 111 LMAFFILSTGGA--KYGTNTLLFWLLSAAAFGYYLPNVLLKNLISRRQREIFESFPDALD 168

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+ +CVE+G+++D AL RVA +IG +S  LSEE+ L   EL    +++ A  N   RT +
Sbjct: 169 LMTVCVEAGLAMDAALARVASEIGLKSAVLSEELQLVTLELRAGSSKEKALRNLALRTGV 228

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V      LIQS+R+GTSI DSLRV   + R++R   AE++AA +  KL  P+I F  P
Sbjct: 229 DDVDALVAMLIQSERFGTSIADSLRVQSDQLRTKRRQRAEEQAAKIALKLLFPLIFFIFP 288

Query: 309 VLILVIIGPAILSIIDTM 326
            L++V++GPA + I   +
Sbjct: 289 SLLVVLMGPAFIQIYRVL 306


>gi|269960464|ref|ZP_06174836.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834541|gb|EEZ88628.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 314

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 71/315 (22%), Positives = 133/315 (42%), Gaps = 18/315 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  +     ++   ++  +   +LG     KR             +              
Sbjct: 18  ETLLFALILITTILVVMTIGSIALGVNSPVKR-------------KLAELSGDKREKVSA 64

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            ++ + +L +     +  +    +   NKL  AGF    SL++   ++ V  II +++  
Sbjct: 65  NSKVADTLESLAPLTSPTSEKERQTTRNKLMHAGFHQSNSLSMFYAIKSVTTIIGVMIAT 124

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +      +       + +       +VG   P   +  ++ KRQ +I+   PD LDLL++
Sbjct: 125 LVYLTIPESKYLYTFMAL-----AVFVGLVLPDFILRRMIDKRQRAIRAGVPDMLDLLVV 179

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+     ++        A      RT +D + 
Sbjct: 180 CTESGLGFNAALRRVADELVISHPELADEVDTVCNKIQAGKPMPEALRELVYRTGLDELM 239

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+ +SLR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 240 GLVSMLSHASRIGGSLVNSLREYTEDYRDKRQQAAEEMAAKIPVKMMFPMVLFIWPCFFI 299

Query: 313 VIIGPAILSIIDTMK 327
           V IGPA++S+ +  K
Sbjct: 300 VAIGPALISLAEAFK 314


>gi|303248308|ref|ZP_07334570.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490333|gb|EFL50245.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 314

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 88/314 (28%), Positives = 152/314 (48%), Gaps = 7/314 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +++  + S+   +YAV++      E EKR +       +L        ++      L 
Sbjct: 4   ILISLLVSASVGFFVYAVMVL---RDEREKRREIAERAMAVLHPAGPEGGRRPGVIGWLA 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                    F + +  K           L  AGFR   ++ I   +++   ++ L++G+ 
Sbjct: 61  GLGRGLAARFGEAVKPKEAEELSKTRTTLIHAGFRQPGAVEIYWGLKVGAALVGLLVGVF 120

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                      P Q ++ A +     GF  P V + + V+KRQ +I    PDALDLL++C
Sbjct: 121 L----AASGRIPAQYKMFAALACVAGGFYLPGVVLDSRVKKRQKAILHGLPDALDLLVVC 176

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D A+ RV  ++  +   LS E+ L   EL    +R+ A +N  NR  ++ + +
Sbjct: 177 VEAGMGLDAAIYRVCLEMTHKEPILSSELRLLTLELRAGKSRREALKNLSNRVGLEDMGS 236

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               LIQ+D +GTSI  +LRV     R++R   AE+ AA L  KL  P+++F  P L++V
Sbjct: 237 LVAMLIQTDMFGTSIAQTLRVYADSMRTKRFQLAEELAAKLPVKLLFPLVLFIFPTLLIV 296

Query: 314 IIGPAILSIIDTMK 327
           I+GPA +S++    
Sbjct: 297 ILGPAGISLMRMFS 310


>gi|157961842|ref|YP_001501876.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846842|gb|ABV87341.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 320

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 83/329 (25%), Positives = 150/329 (45%), Gaps = 21/329 (6%)

Query: 4   YFFDLFDATE-LAVAITTAVSIFSLIYAVVIPSLGS---GELEKRMKSVAVEREILRKQQ 59
            F   FD  + +  AI +  +I  +  A+ I  L S     +  R+KS+  E+     Q 
Sbjct: 7   LFGQFFDDPQHVEWAIYSISAIAGVTLAISISYLISGVYSPIRSRLKSLNGEKVTKNSQD 66

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
           +T   +       +                     +      L  AGF SE +L +    
Sbjct: 67  VTGTLEHGIGEMAKKPFLNF--------------SNHETRRLLIHAGFHSENALAVFNAS 112

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           RL++ +   I  ++ +  +  +  +         I      F APS+ + +L ++R   +
Sbjct: 113 RLLLILFGFITSLLILNLFPNISGFWTFYIFCLFIGGA---FIAPSMVLQSLSKRRMRKL 169

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +  +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L  +++      +VA 
Sbjct: 170 RVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELELVCSKVRAGLTIKVAL 229

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           + F  RT ++ ++    A+ QS R GT I ++LRV   E R++RL  AE++AA L  K+ 
Sbjct: 230 QEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRNKRLQAAEEQAAKLAVKMI 289

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            PM+    P   +V +GPA+L ++     
Sbjct: 290 FPMMCCIWPSFFIVAVGPAVLKVMKVWGQ 318


>gi|153834029|ref|ZP_01986696.1| Flp pilus assembly protein TadC [Vibrio harveyi HY01]
 gi|148869584|gb|EDL68574.1| Flp pilus assembly protein TadC [Vibrio harveyi HY01]
          Length = 315

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/316 (20%), Positives = 131/316 (41%), Gaps = 18/316 (5%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           E  +     ++   ++  V    +G     KR             +          +   
Sbjct: 18  ETLLFALILITTVLVVMTVGSVVMGVNSPIKR-------------KLAELSGDKKEALPT 64

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             + + +L +     +  +    +   NKL  AGF    SL++   ++ +  II +++  
Sbjct: 65  NNKMTDTLESLAPLTSPTSEKERQTTRNKLMHAGFHQSNSLSMFYAIKSITTIIGVMMAT 124

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +      +       + +        +G   P + +  +V KRQ +I+   PD LDLL++
Sbjct: 125 LIYLTIPESKYLYTYMAL-----AALIGLITPDMILRRMVNKRQKAIRAGIPDMLDLLVV 179

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C ESG+  + ALRRVA+++      L++E+     ++        A      RT ++ + 
Sbjct: 180 CTESGLGFNAALRRVADELVISHPELADEIDTVCNKIQAGKPMPEALRELVVRTGLEEIM 239

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L  + R G S+ +SLR    + R +R   AE+ AA +  K+  PM++F  P   +
Sbjct: 240 GLVSMLSHASRIGGSLVNSLREYTEDYRDKRQQAAEEVAAKIPVKMMFPMVLFIWPCFFI 299

Query: 313 VIIGPAILSIIDTMKD 328
           V +GPA++++ +    
Sbjct: 300 VAVGPALITLAEAFSK 315


>gi|218710398|ref|YP_002418019.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
 gi|218323417|emb|CAV19594.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
          Length = 323

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/276 (25%), Positives = 129/276 (46%), Gaps = 5/276 (1%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEY 111
           R  L K+     +  S ++R     S +L +    ++      +E    KL  AGF  + 
Sbjct: 47  RSPLDKKLKQISETGSPNNRKPYDFSNTLESLSPFISKGNKKDNETYSQKLMHAGFHEKN 106

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           +L++   ++++  ++ +I G +  +           +         ++G   P++ +S L
Sbjct: 107 ALSVFYALKVLSSLVGIIAGFMVYYISFGGSYNNLLIMTCV-----FLGTFTPNIILSKL 161

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            ++RQ  I+   PDALDLL++C ESG+  + AL RVA ++      L++E+    A++  
Sbjct: 162 QKERQKKIRNGVPDALDLLVVCTESGLGFNAALGRVASELYVSQPELADELETVFAKIQA 221

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                 A   F +RT +  +      L  + R G S+  +LR    + R +R   AE+ A
Sbjct: 222 GVTMPDALRQFIDRTGLVELEGLVSLLSHASRMGGSLAQTLRDYTVDFRDKRQQAAEEIA 281

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           A +  K+  PM++F  P   +V +GP I+ +ID + 
Sbjct: 282 AKIPTKMLFPMLLFIWPCFFIVALGPGIIIVIDALG 317


>gi|325109819|ref|YP_004270887.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970087|gb|ADY60865.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 333

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/311 (19%), Positives = 138/311 (44%), Gaps = 6/311 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + +   V + ++   V   +      + R+ S   E E +     T++++     R    
Sbjct: 12  IPLLPFVVVIAVTGLVYSVTALMTGRDSRIDSRLEELEAM--SGSTTVERAGWKRRFLAP 69

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
             + +   + ++  +       +  +L  AG+     + +    R  + ++ + + ++  
Sbjct: 70  LQELMPQSLVRVATETTEGGSRVQKRLMQAGYYGHDYVPLFAAARCGLALLPVAVAVVCY 129

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                              +   +G   P +W+   V++RQ++  +A PD  DLL+ C+ 
Sbjct: 130 ----AKGWGTTSTIAMWTAVGSGIGVVLPGLWLDRAVRRRQATFMKAIPDLFDLLVTCLS 185

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG++I+ +++RVAE++      L+ E+     E+    +   A ++F  R  ++ +R+  
Sbjct: 186 SGLTIEASIKRVAEELRLAHPDLANELARVQNEIHLGISVVDALKHFAERCNLNPIRSLA 245

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
               Q+ +YGT   ++LRV  +  R++R   AE++A     K+  P ++   P + +V+ 
Sbjct: 246 MMCEQTRQYGTRAIEALRVHANMMRTQREQRAEERARKAAVKILAPTVLLIFPSVFVVVA 305

Query: 316 GPAILSIIDTM 326
           GPA + I +TM
Sbjct: 306 GPAAIQIAETM 316


>gi|99082191|ref|YP_614345.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038471|gb|ABF65083.1| hypothetical protein TM1040_2351 [Ruegeria sp. TM1040]
          Length = 323

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 73/320 (22%), Positives = 147/320 (45%), Gaps = 10/320 (3%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
                        +A+   + +  ++ A  +      +  K+++         R      
Sbjct: 9   DLLIQHLGEFGPLMAVG-FLGLLLVVVAAFLLFNQPEDPLKKLQ---------RNLSADQ 58

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
             K       +   ++ L+ F   L  +       +  KLR AG++S+ ++ +   ++  
Sbjct: 59  NAKPQNERLRQASRNEQLQKFANFLEPQDAEELSAMQLKLRQAGYQSKDAVRLFHFLQFA 118

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + +  L  G+  ++  +  +EY        V+  G   +  P  WI+  +++R+ +I RA
Sbjct: 119 LGLAGLGFGLFLVYVLNADVEYTTNQLAMRVLGPGAAAYYLPRYWITRRIEERKQAITRA 178

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PDALD++L+CVE+G S+DQ++ RV +++      L+EE  +   E+     +     + 
Sbjct: 179 FPDALDMMLVCVEAGQSLDQSIVRVGKELQASYPELAEEFEIVAHEMKAGKEKDKVLRDM 238

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  V +    +IQS  +GTSI D+LRV   E R +R+M AE+ A  L  K+T+  
Sbjct: 239 ATRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRAEEAANKLPTKMTLAT 298

Query: 303 IIFFLPVLILVIIGPAILSI 322
           +   +P L+ ++I P++  +
Sbjct: 299 MGLTVPPLLAILIAPSVQGL 318


>gi|167624197|ref|YP_001674491.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354219|gb|ABZ76832.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 320

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 81/329 (24%), Positives = 147/329 (44%), Gaps = 21/329 (6%)

Query: 4   YFFDLFDATE-LAVAITTAVSIFSLIYAVVIPSLGS---GELEKRMKSVAVEREILRKQQ 59
            F   FD  + +  AI +  +I  +  A+ I  L S     + KR+KS+           
Sbjct: 7   LFGQFFDDPQHVEWAIYSVAAIAGVTLAISISYLISGVYSPIRKRLKSLNAAEGTKVTHD 66

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
           +T   +       +                     +      L  AGF SE +L +    
Sbjct: 67  VTGTLEHGMGEMAKKPFLNF--------------SNHETRRLLIHAGFHSENALAVFNAS 112

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           RL++ ++  ++ ++     +   E      +    L     F  PS+ + +L  +R   +
Sbjct: 113 RLLLILLGFVISLV---ILNLFPEISGIWTIYIFCLFIGGAFIVPSMVLQSLANRRMRQL 169

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +  +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L  +++      +VA 
Sbjct: 170 RVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELDLVCSKVRAGLTIKVAL 229

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           + F +RT ++ ++    A+ QS R GT I ++LRV   E R +RL  AE++AA L  K+ 
Sbjct: 230 QEFTDRTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAAEEQAAKLAVKMI 289

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            PM+    P   +V +GPA+L ++     
Sbjct: 290 FPMMCCIWPSFFIVAVGPAVLKVMKVWGQ 318


>gi|299067812|emb|CBJ39023.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CMR15]
          Length = 315

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 83/319 (26%), Positives = 150/319 (47%), Gaps = 9/319 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + +   T   +F  + A  +  L    L++R+  +  E    + +       D  
Sbjct: 1   MHTVHIVLLAGTFAIVFGAVLA-AMTLLRPSTLDRRLGQIDRELPRTQPRD------DGH 53

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                 R  +  +   K    K      ++  +   AG+R+  ++ +   ++ ++     
Sbjct: 54  DRAWLRRLEQLAKPLAKASLPKEGWEGSSLRQRFVHAGWRAPEAIAVYFGIKTILTFGLP 113

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  +W     ++        +  +     VGF  P+V +S  ++ RQ  I  ++PD+LD
Sbjct: 114 LL--LWAGLVGRINADQQSQFMSLLFGAAVVGFYLPNVLLSLKIKYRQREIFESFPDSLD 171

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+S+D A+ RV +++      ++EE  L   EL     R+ A  N   RT +
Sbjct: 172 LIMVCVEAGLSLDAAILRVVDEMRTARPVMAEEYELLTLELRAGLPREKALRNLAARTGV 231

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V      LIQ+DR+GTS+ DSLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 232 DDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERAAKIGTKVLFPLIFCIFP 291

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA L +I  + 
Sbjct: 292 SLYVVLLGPAALQMIAALG 310


>gi|120602154|ref|YP_966554.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|120562383|gb|ABM28127.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|311234268|gb|ADP87122.1| Type II secretion system F domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 323

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 81/300 (27%), Positives = 141/300 (47%), Gaps = 3/300 (1%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
           +  V    GS     RM+S        R     +    + S  +R   +       +++ 
Sbjct: 24  FFGVQGMRGSRRRIDRMQSRVARHL-DRNAPTAAASATTLSDDMRRGINAMAERLGQRVI 82

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
            +           L  AG+R+  +  +   V+  + +  L++G+          + P  +
Sbjct: 83  NEGDTELTEAGMALARAGYRNRTAPRVFWGVKAGLTVAGLLMGLTVRLLLGD--DVPAGM 140

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
                I     G   P++W+S+ +++R+  I  A PDALDLL++CVE+G+ +DQAL RVA
Sbjct: 141 VALLFIGPAVTGLYLPNIWLSSRIKERRQEIINALPDALDLLVVCVEAGMGLDQALARVA 200

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +++   S  L+EE+ L+I EL    +R    +N   R  ++ V +    +IQ+D +GTSI
Sbjct: 201 KELQSTSPVLAEELQLSILELRAGKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSI 260

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             +LRV     R+ R   AE+ AA +  KL  P++   LP L + I+GPA + ++     
Sbjct: 261 ASTLRVYSDTMRTTRFQRAEEIAAKMPVKLLFPLVFCILPALFVTIMGPAFIKLMQVFAQ 320


>gi|17545369|ref|NP_518771.1| tight adherence TadC-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427661|emb|CAD14180.1| probable pilus assembly tadc transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 315

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 84/319 (26%), Positives = 150/319 (47%), Gaps = 9/319 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + +   T   +F  + A  +  L    L++R+  +  E    + +       D  
Sbjct: 1   MHTVHIVLLAGTFAIVFGAVLA-ALTLLRPSTLDRRLGQIDRELPRSQPRD------DGR 53

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                 R  +  +   K    K      ++  +   AG+R+  ++ +   ++ ++     
Sbjct: 54  DRAWLRRLEQLAKPLAKASLPKEGWEGSSLRQRFVHAGWRAPEAIAVYFGIKTILTFGLP 113

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  +W     +         +  +     VGF  P+V +S  ++ RQ  I  ++PD+LD
Sbjct: 114 LL--LWAGLVGRFNADQQSQFMSLLFGAAVVGFYLPNVLLSLKIKYRQREIFESFPDSLD 171

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+S+D A+ RV +D+      ++EE  L   EL    +R+ A  N   RT +
Sbjct: 172 LIMVCVEAGLSLDAAILRVVDDMRTARPVMAEEYELLTLELRAGLSREKALRNLAARTGV 231

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V      LIQ+DR+GTS+ DSLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 232 DDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERAAKIGTKVLFPLIFCIFP 291

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA L +I  + 
Sbjct: 292 SLYVVLLGPAALQMIAALG 310


>gi|194288828|ref|YP_002004735.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222663|emb|CAQ68666.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 324

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 84/324 (25%), Positives = 152/324 (46%), Gaps = 10/324 (3%)

Query: 3   HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS 62
              F  F   ++ V     V+ F  ++ V+               +    E +  Q    
Sbjct: 2   QEIFQGFQGDQVIVLALIFVAAFGTVFGVLYALAPH--------RLRGRAEQIAGQAGPF 53

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
                    L  +  K  +   +    K    +  +  +   AG+RS  +  +    + V
Sbjct: 54  EADQGRQQALIEKLVKWAQPISRLSLPKEGWENSQLRVRFMNAGWRSASAAPLYFGAKTV 113

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           + +   +LG++ +              + A++  G  G+  P+V ++  V +RQ ++   
Sbjct: 114 LAVALPMLGLLAVSSQPGQQSQQLMFALLALL--GATGYYLPNVVLARKVSQRQRTVFEE 171

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
           +PD +DLL +CVE+G+ +D AL RVA+++  +   L++E+ L + EL    +++ A  N 
Sbjct: 172 FPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRSGFSKEKALTNL 231

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             RT ++ V      LIQ+DR+GTS+G+SLRVL    R++R M AE++AA +  KL  P+
Sbjct: 232 SLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQAAKIALKLLFPL 291

Query: 303 IIFFLPVLILVIIGPAILSIIDTM 326
           I    P L+LV++GPA + I   +
Sbjct: 292 IFTIFPSLLLVLLGPAFIQIYRVL 315


>gi|212635449|ref|YP_002311973.1| Tight adherence TadC-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556933|gb|ACJ29387.1| Tight adherence TadC-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 321

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 84/329 (25%), Positives = 152/329 (46%), Gaps = 17/329 (5%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQ 59
           +   FFD     E A+     ++  +L  A+     G    L KR+K++           
Sbjct: 7   LLGQFFDNPTHVEWAIYAVAGIAGVTLAIAISYLISGFYSPLRKRLKTLNT-------GD 59

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
             +   D+ S  L     +  +      +      +      L  AGF SE SL I   +
Sbjct: 60  SGAPSGDAVSETLEHGMVEMAKKPFLNFS------NHETRRLLIHAGFHSENSLAIFNAI 113

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           RL++ ++  ++ ++ +  + K+            I      F  PS+ + +L ++R   +
Sbjct: 114 RLLLLLLGAVISVLILNFFPKIAGIWIIYIFCMFIGGA---FILPSMVLQSLAKRRMRLL 170

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +  +PDALDLL++C E+G+ +  AL+RVA+++      L+ E+ L  +++      +VA 
Sbjct: 171 RVGFPDALDLLVVCCEAGLGLMAALQRVAKELAFSHPSLASELELVCSKVRAGLTIKVAL 230

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           + F  RT ++ ++    A+ QS R GT I ++LRV   E R +RL  AE++AA L  K+ 
Sbjct: 231 QEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAAEEQAAKLAVKMI 290

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            PM+    P   +V +GPA+L ++     
Sbjct: 291 FPMMCCIWPSFFIVAVGPAVLKVMKVWGQ 319


>gi|116748937|ref|YP_845624.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698001|gb|ABK17189.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 319

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 82/319 (25%), Positives = 144/319 (45%), Gaps = 3/319 (0%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           +   L VA    V    L+ +V +        ++ M+ +  +   L             +
Sbjct: 4   ENLALIVAAMVFVIACLLVLSVALYWRHRETRKRIMEKIRQDGLEL-SGVEAEPAVQEIT 62

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
              R           K++  +          +   AG R E +  + +  + +  +    
Sbjct: 63  GAKRGPIVSFFDRVGKRMKTEKPSELRAQQLRFLRAGIRMENAPAVFMGAKCLGGLGLAF 122

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             ++    +  L+    +L   A      VGF  P +W+     +R+  ++R  PDALDL
Sbjct: 123 GFLLLKTVFFSLM--SARLTAVAACATALVGFYLPDLWLRLKTSRRRKQLRRGLPDALDL 180

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +++CVE+G+ ID A  RV+E++   + P+S+E+     EL     R+ A  N   RT ++
Sbjct: 181 MVVCVEAGMGIDSATYRVSEEMKLTNAPMSDELKYLNLELRAGKARRDALRNLALRTDLE 240

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V + T  LIQ+D++GTS+  +LRV     R++R   AE+ AA L  KL +P+I+F  P 
Sbjct: 241 DVNSLTTLLIQTDKFGTSVAQALRVHSDSFRTKRHQMAEELAAKLPVKLVLPLILFIFPS 300

Query: 310 LILVIIGPAILSIIDTMKD 328
           L +VI+GPA++    T   
Sbjct: 301 LFVVIMGPAMIRAFRTFMK 319


>gi|328953758|ref|YP_004371092.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454082|gb|AEB09911.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 302

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 76/312 (24%), Positives = 141/312 (45%), Gaps = 13/312 (4%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
            I   + +  L + ++   +      +  +  +     +   +          S+     
Sbjct: 3   LILFGIMVAGLFFFLIAYLIQKTTPSQGRRLFSSNSAAIEVNKRRHNIISEQFSKRLNSI 62

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
               ++ V           + +  KL  AG     + +  L  +L  P+  +I+G     
Sbjct: 63  MGFAKDPV---------KAKELKKKLMLAGCYGSRAFSRFLFFKLTSPLAAIIIG----I 109

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                L     ++   + L+   GF  P++ +++ +  RQ  I    PDALDLL++CVE+
Sbjct: 110 PLSLNLNVGLIMKPVFLYLLLAFGFYLPNLVLNHKISARQKKISEGLPDALDLLVVCVEA 169

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+ ++ A++RVA+D+   +  LS E  +   E+    +R+ A  N   RT ++ +     
Sbjct: 170 GLGLNAAMKRVADDLKMNNPVLSLEFNMLNLEILAGLDREQALRNLAERTGVEELSTLCA 229

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            LIQ+DR+GTSI  +LRV     R+ R    E+ AA    KL  P+I+F  P L++VI+G
Sbjct: 230 ILIQADRFGTSIAQALRVQSDTMRTNRRQRLEELAARTPVKLVFPLILFIFPALVVVILG 289

Query: 317 PAILSIIDTMKD 328
           PA++ + ++M  
Sbjct: 290 PAVIQVAESMAK 301


>gi|54302281|ref|YP_132274.1| tight adherence TadC-like transmembrane protein [Photobacterium
           profundum SS9]
 gi|46915703|emb|CAG22474.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum SS9]
          Length = 322

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 72/314 (22%), Positives = 138/314 (43%), Gaps = 15/314 (4%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
                  +S+ +    + +        L+KR+ S++   +   K+   S   D       
Sbjct: 21  IFLGLAFISVVTFTLCLALLITNLLNPLKKRLHSLSHISKDTTKKSAESSALD------- 73

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                +L +  K ++  ++         L  AG+  + +L     +++++ I      +I
Sbjct: 74  ----NTLESMDKYISPSSMKERNQTKTLLMHAGYEQKQALTNFYAIKIILVIFAFFGVLI 129

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                  L E   Q  +   +L   +    P+  +    +KR  ++  A+PDALDLL++ 
Sbjct: 130 ---SSKFLPELSTQKILFYTLLAMAIATFLPNFVLQKKAKKRIQTLSNAFPDALDLLVVT 186

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
            E+G+    AL RVA +I   S  LS E+ +   ++       +A   F  RT +  ++ 
Sbjct: 187 TEAGLGFLAALNRVANEIDALSPELSSELQIVCRKVRLGVPLPIALSQFIERTGLLELQG 246

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               + QS + G+S+GD+LR    E R  R+ +AE++AA +G K+  P++    P    V
Sbjct: 247 LVSIISQSVKLGSSMGDTLREYAIEFRDRRMQKAEEEAAKIGTKMIFPLVTCIWPGFFTV 306

Query: 314 IIGPAILSIIDTMK 327
            IGPAI+++++   
Sbjct: 307 AIGPAIIAVLEAFG 320


>gi|218887822|ref|YP_002437143.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758776|gb|ACL09675.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 326

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 81/325 (24%), Positives = 142/325 (43%), Gaps = 7/325 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ---- 64
               E  +    A+     +  V     G     +R++ +                    
Sbjct: 1   MPFDETMIPFLAALLASGAVLLVAQALRGMFGNRQRVQRMHGRLTRHAAGARAVAVAAPA 60

Query: 65  -KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             +S  S L+   +       +++              L  AG+R+  +  +   V+  +
Sbjct: 61  LPESPLSSLKAALNAVAERVGQRVVKDDGEEVNEAGLALVRAGYRNRRAPLVFWGVKAGL 120

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            +  L+LG++         + P  +     I    VG  AP+VW+S  ++ R+  I  + 
Sbjct: 121 TLCGLLLGLVVRLLAGN--DIPLGMVALLFICPAVVGLYAPNVWLSRRIKARRLDIINSL 178

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLL++CVE+G+ +DQA  RVA ++   +  L+EE+ L I EL    +R  A +N  
Sbjct: 179 PDALDLLVVCVEAGMGLDQAFSRVAREMAATNPVLAEELNLVILELRAGKSRAEALKNLA 238

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  ++ V +    ++Q+D +GTSI  +LRV     R+ R   AE+ AA +  KL  P++
Sbjct: 239 ARVALEDVNSLVTLIVQADAFGTSISSTLRVYSDTMRTTRFQRAEEIAAKMPVKLLFPLV 298

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
              LP L + I+GPA + ++     
Sbjct: 299 FCILPALFVTIMGPAFIKLMQVFAQ 323


>gi|84387237|ref|ZP_00990258.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
 gi|84377884|gb|EAP94746.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
          Length = 323

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/275 (24%), Positives = 124/275 (45%), Gaps = 5/275 (1%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEY 111
           R  L K+     +  + + R     S +L +    ++      +E    KL  AGF  + 
Sbjct: 47  RSPLDKKLRQISEDGAPTGRKPYDFSNTLESLSPFISKGNKKDNETYSEKLMHAGFHEKS 106

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           SL++   ++++  +I ++   +  +           +         ++G   P++ +S L
Sbjct: 107 SLSVFYALKVLSSLIGIVAAFMVYYIALGGDYNNLLIMTCV-----FLGTFTPNIILSKL 161

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            ++RQ  I+   PDALDLL++C ESG+  + AL RVA ++       ++E+    A++  
Sbjct: 162 QKERQKKIRNGVPDALDLLVVCTESGLGFNAALGRVASELYVSQPEFADELETVFAKIQA 221

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
                 A      RT +  +      L  + R G S+  +LR    + R +R   AE+ A
Sbjct: 222 GVTMPDALRQLIERTGLVELEGLVSLLSHASRMGGSLAQTLRDYTEDFRDKRQQAAEEIA 281

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           A +  K+  PM+IF  P   +V +GP +L ++D +
Sbjct: 282 AKIPTKMLFPMLIFIWPCFFIVALGPGLLIVMDAL 316


>gi|323491540|ref|ZP_08096719.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
 gi|323314116|gb|EGA67201.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
          Length = 313

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/325 (23%), Positives = 142/325 (43%), Gaps = 19/325 (5%)

Query: 5   FFDLFD-ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
           FF  F+   +        ++   +I+ + +  +GS             +  ++ +     
Sbjct: 7   FFASFNLDEQTVFLGLILLATVLIIFTLSLLLVGS-------------KSPIKAKLSQLK 53

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             +        R   +L +    +        E+I  KL  AG+    +L +   ++ + 
Sbjct: 54  SANGTEKHKTKRLENTLESLAPAMQPSNSKESESIREKLMHAGYLDANALTVFYALKGMS 113

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            +I L++   + F    +      +R  A+++   VG   P+V +  +V KRQS I+   
Sbjct: 114 TVIGLLMAAGFFFFAPDMS-----MRNLAMVVSVAVGLYGPNVVLGFMVDKRQSKIRGGI 168

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLL++C ESG+  + ALRRVA+++       ++E+     +++       AF +  
Sbjct: 169 PDALDLLVVCTESGLGFNAALRRVADELTISHPEFADELDTVCVKVNAGVEMSDAFNDLI 228

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            RT +  +      L  + + G S+  +LR    + R +R  E E+ AA +  K+  P++
Sbjct: 229 QRTGLKEIAGLVTMLAHASKIGGSLSQTLREYTEDYRDKRNQEIEEVAAKIPTKMIFPLL 288

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
           IF  P   +V IGP++L    TM  
Sbjct: 289 IFIWPCFFIVAIGPSMLLFTATMGK 313


>gi|187927682|ref|YP_001898169.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|187724572|gb|ACD25737.1| type II secretion system protein [Ralstonia pickettii 12J]
          Length = 320

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 77/321 (23%), Positives = 152/321 (47%), Gaps = 10/321 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                + +  + +   V+ F     + +          R++ +  +        + +   
Sbjct: 1   MQALYSNQYFILVLIFVAAFGGALGL-LHLFSPNRARGRIQQIGGQT-------VGADLA 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
                    + +   +   +    K    +  +  +   AG+R  ++ ++   V+ V+ I
Sbjct: 53  GGPDHAWVEKLATWAKPVSQLSLPKDGWENSQLRIRFMNAGWRQPWAPSLYFAVKTVLAI 112

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           +  +  ++ +    +  +    L V  ++    +G+  P+  ++  V+ RQ  +   +PD
Sbjct: 113 LLPLAALLVLSSRPEHHDQEVVLAVLGLL--SAIGYYLPNAALARKVEHRQRDVFEEFPD 170

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
            LDLL +CVE+G+ +D A+ RV++++  +   ++EEM LT+ EL     ++ A  N   R
Sbjct: 171 MLDLLTVCVEAGLGLDAAMMRVSDELALRCPVMAEEMELTLLELRSGFPKEKALTNLALR 230

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ V      LIQ+DR+GTS+ DSLRVL    R++R M AE++AA +  KL  P+I F
Sbjct: 231 TGVEDVDRFASMLIQADRFGTSLADSLRVLSDMLRTKRRMRAEEQAAKIALKLLFPLIFF 290

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L+LV++GPA + I   +
Sbjct: 291 IFPTLLLVLLGPAFIQIYRVL 311


>gi|225872758|ref|YP_002754215.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225793390|gb|ACO33480.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 299

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/299 (23%), Positives = 138/299 (46%), Gaps = 11/299 (3%)

Query: 28  IYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL 87
           +   ++    S  L   + +        R  ++T  +     S  +      L       
Sbjct: 7   LALAIMLFSVSALLVNLLLAAPERTAARRIAEVTQHEVVRGPSPTKVLGKSMLHAMKGLR 66

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
               ++ ++ + ++  AAG R    + + L  RL+ P++ +++G  +             
Sbjct: 67  VTLGMVENQKLRDRFMAAGMRKPEHMELYLGARLLAPLLGVLIGTFF-----------PS 115

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
                 + +   G+  P  W+   V+ R+  I R+ PDA+DLL+ICV++G+ +DQA+ RV
Sbjct: 116 NTFLWAVALAGAGYLGPDFWLERKVKGRRHRISRSMPDAIDLLVICVDAGLGLDQAMLRV 175

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            +++      ++EE L    E      R  A++ F  RT++  ++N    L+Q++R+GT 
Sbjct: 176 GQELAVSHPEINEEFLQINREQRAGRPRVDAWKGFAERTRLPEIQNFVSMLVQTERFGTP 235

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           I  +L       R +R   AE+KAA    K+  P+++F  P + +V++GPA ++I   +
Sbjct: 236 ITRALNTFSDSMRLKRKQIAEEKAAKTTVKMLFPLVLFIFPCIFIVLLGPAFITISKGL 294


>gi|46580529|ref|YP_011337.1| hypothetical protein DVU2124 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449948|gb|AAS96597.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 284

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 76/277 (27%), Positives = 135/277 (48%), Gaps = 2/277 (0%)

Query: 52  REILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEY 111
           R + R     +    + S  +R   +       +++  +           L  AG+R+  
Sbjct: 7   RHLDRNAPTAAASATTLSDDMRRGINAMAERLGQRVINEGDTELTEAGMALARAGYRNRT 66

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
           +  +   V+  + +  L++G+          + P  +     I     G   P++W+S+ 
Sbjct: 67  APRVFWGVKAGLTVAGLLMGLTVRLLLGD--DVPAGMVALLFIGPAVTGLYLPNIWLSSR 124

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
           +++R+  I  A PDALDLL++CVE+G+ +DQAL RVA+++   S  L+EE+ L+I EL  
Sbjct: 125 IKERRQEIINALPDALDLLVVCVEAGMGLDQALARVAKELQSTSPVLAEELQLSILELRA 184

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
             +R    +N   R  ++ V +    +IQ+D +GTSI  +LRV     R+ R   AE+ A
Sbjct: 185 GKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSIASTLRVYSDTMRTTRFQRAEEIA 244

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           A +  KL  P++   LP L + I+GPA + ++     
Sbjct: 245 AKMPVKLLFPLVFCILPALFVTIMGPAFIKLMQVFAQ 281


>gi|134299964|ref|YP_001113460.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052664|gb|ABO50635.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 310

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/317 (19%), Positives = 137/317 (43%), Gaps = 11/317 (3%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            +L V +      F+ +    +      ++ +RM  V      +  +++          R
Sbjct: 5   LQLIVGMIFFAVTFATLVLYRLVFGERIQVAQRMDQVVGSPAPIPVRELELSVP--LYQR 62

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                  ++  ++ +        ++ +  K+  AG          +VV+ +  +      
Sbjct: 63  AIHPALSTMARWLTRFIPS--AREKELQKKIIYAGNPGHLDAKEWVVVKYLGAVGLG--- 117

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
             + + +  +        +        +G+  P +++++ ++ R++ ++++ PDALDLL 
Sbjct: 118 -FFFWSWAGMAGKALPQCLLLGATGVPLGWLLPDLYLNSRIRNRKTQVEKSLPDALDLLT 176

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           + VE+G+  D AL +VAE   G    +++E +L + E      R+ A  +   R  +D +
Sbjct: 177 VSVEAGLGFDGALMKVAEKTKGI---MADEFILMLQECHMGKPRREALRDMATRLDVDDL 233

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
            +   ++I +D  G SIG+ LR    + R +R  + E+ A     K+  PM+ F  P + 
Sbjct: 234 SSFCGSIILADTLGISIGNVLRTQSQQMRQKRRQKTEELAMKAPIKMLFPMVFFIFPAIF 293

Query: 312 LVIIGPAILSIIDTMKD 328
           ++++GPA L I+    +
Sbjct: 294 VILLGPAALQIMKAFAN 310


>gi|157375501|ref|YP_001474101.1| putative putative tight adherence TadC-like transmembrane protein
           [Shewanella sediminis HAW-EB3]
 gi|157317875|gb|ABV36973.1| conserved hypothetical putative tight adherence TadC-related
           transmembrane protein [Shewanella sediminis HAW-EB3]
          Length = 321

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 87/329 (26%), Positives = 155/329 (47%), Gaps = 20/329 (6%)

Query: 4   YFFDLFDAT-ELAVAITTAVSIFSLIYAVVIPSLGS---GELEKRMKSVAVEREILRKQQ 59
            F  LFD   ++  AI     I  +++A+ +  L S     L +R+KS+  E +I   Q 
Sbjct: 7   LFGSLFDDPEQIKWAIFAVAGIAGVMFALSLAFLISGIYSPLRQRLKSLNKEEQIKTVQT 66

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
             +   +     +  +   ++ N             +     L  AG  SE ++ I   +
Sbjct: 67  DVNATLEHGIGSMVEKSPLNMSN-------------DETRRLLIHAGLHSENAMAIFSSI 113

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           R+   I+ LI     +       +    + V  V L+    F  PS+ +  +  +R   +
Sbjct: 114 RI---ILLLIGAGSSVLVLSLYPDLSTMMSVYIVALLVGGAFLLPSLVLQKIASRRMRML 170

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +  +PDALDLL++C E+G+ +  A++RVA ++      L+ E+ L  +++      +VA 
Sbjct: 171 RTGFPDALDLLVVCCEAGLGLMAAMQRVARELALSHPTLASELDLVCSKVRAGLTVKVAL 230

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
             F +RT ++ ++    A+ QS R GT I ++LRV   E R++RL EAE++AA L  K+ 
Sbjct: 231 NEFTDRTGLEDIKGLNSAISQSIRLGTGIAETLRVFSDEYRNKRLQEAEEQAAKLAVKMI 290

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            PM++   P   +V IGPA+L ++     
Sbjct: 291 FPMMLCIWPSFFIVAIGPAVLKVMKVWGQ 319


>gi|149175288|ref|ZP_01853910.1| probable secretion system protein TadC [Planctomyces maris DSM
           8797]
 gi|148845897|gb|EDL60238.1| probable secretion system protein TadC [Planctomyces maris DSM
           8797]
          Length = 308

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 77/318 (24%), Positives = 152/318 (47%), Gaps = 13/318 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D  +L       + I  +I  +   +        R+  +         +   S      
Sbjct: 1   MDFVQLLPWAIFGMVIVGVIALINKLNFDHSRANARLDELRNPHLRNNPEDANSAS---- 56

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                +   K+     K L  K+ L +  +  +L  AG+ SE + +I L +++ + ++ +
Sbjct: 57  -----SLFEKAAPALSKALTPKSELEENQLKVRLANAGYNSEAAPSIFLSLKVALGLLGV 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +LG  + F    + +  +      +++ G +GF  P + +  L++ R   I  + PDALD
Sbjct: 112 VLGSGYGFYNFGMTQNGWTS----LVIAGGIGFYLPEIALRLLIKGRVERIFLSLPDALD 167

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL++CVE+G+ +D A+RRV+E++   +  +  E  L   +L     R+    +   R+ +
Sbjct: 168 LLVVCVEAGLGLDAAMRRVSEELEETAPDVCSEFALCNLQLQMGRPRREVLHDLGIRSGV 227

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D +R     LIQ+D++G+SI  +LRV     R +R   AE++AA    K+  P+++F  P
Sbjct: 228 DDMRALAAILIQADKFGSSIAQALRVQSDSMRVKRSQLAEEQAAMTAVKMIFPLVLFIFP 287

Query: 309 VLILVIIGPAILSIIDTM 326
            + +V++GPA + +I+ +
Sbjct: 288 GIFVVLVGPAAIMMINGL 305


>gi|260463899|ref|ZP_05812095.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030274|gb|EEW31554.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/310 (20%), Positives = 142/310 (45%), Gaps = 9/310 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
             +  A+   ++ + +V       ++++R+K        +    + +  +          
Sbjct: 20  AILLLALGTVAVGWPMVAAKGDRNDVKRRLK--------VDHGPVAARPEPVQKKNANVV 71

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
             K+++   +            +  KL  AG+    ++ +  ++R    +I   +G   +
Sbjct: 72  REKAVKRAQEFYAKSDPENVARLRMKLIQAGYMEPRAVGMFFIIRF-SALIGGAIGAFVL 130

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
             +    +     R   +IL G  G+  P + +S   +++    +  +PD +DL+++C +
Sbjct: 131 NRWLASADATMTSRWAFIILSGVAGYFLPGLVLSQKTREKMREYRNGFPDFMDLMIVCSD 190

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+S++  + RV++++      LS+ + L   EL    +   A +   +R  +D VR+  
Sbjct: 191 AGMSMEAGIERVSKELARTYPALSQNLQLVSLELRAGRSLDDALKALADRLSLDEVRSFA 250

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             L QS   GTS+  +LRV   E R +R+  AE+KA +L  K+++P+ +  LPV++++ I
Sbjct: 251 TLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAKMSIPVTVCILPVVLMIAI 310

Query: 316 GPAILSIIDT 325
            P I+ +  T
Sbjct: 311 IPIIVKMTGT 320


>gi|283852078|ref|ZP_06369352.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
 gi|283572468|gb|EFC20454.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
          Length = 317

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 85/316 (26%), Positives = 142/316 (44%), Gaps = 4/316 (1%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
              A+ +  A S+    YAV           +                  +L +      
Sbjct: 2   LLFAITLCVAASVGLFAYAVGAMREERRRRREFAVRAMAVLHPAGGPGGEALGRPGLVGW 61

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           L          F + +  K           L  AGFR   ++ I   ++    ++ L++G
Sbjct: 62  LIGLGQGLATRFGEAVKPKEAKELSKTRANLVHAGFRQPGAVEIYWGIKAGAGLVGLVVG 121

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +           P Q ++   +     GF  P + +   V+KRQ +I+R  PDALDLL+
Sbjct: 122 ALLAL----SGRLPGQYKMFVALACVAGGFYLPGLLLDARVKKRQKAIQRGLPDALDLLV 177

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CVE+G+ +D A+ RV  ++  +   LS E+ L   EL    +R+ A +N  +R  ++ +
Sbjct: 178 VCVEAGMGLDAAIYRVCVEMASKEPVLSSELRLLTLELRAGKSRREALKNLSSRIGLEDM 237

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
            +    LIQ+D +GTSI  +LRV     R++R   AE+ AA L  KL  P+I F  P L+
Sbjct: 238 GSLVAMLIQTDMFGTSIAQTLRVYADSMRTKRFQLAEELAAKLPVKLLFPLIFFIFPTLL 297

Query: 312 LVIIGPAILSIIDTMK 327
           +VI+GPA++S++    
Sbjct: 298 IVILGPAVISLMKMFG 313


>gi|148655425|ref|YP_001275630.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567535|gb|ABQ89680.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 311

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 74/316 (23%), Positives = 137/316 (43%), Gaps = 14/316 (4%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             +   +   + +  ++  +   S     +  R+         L + ++           
Sbjct: 6   PMIGFGVLMLLGVGLIMIGMRR-SSQPDMISDRLSQFTERTMTLEEMELQQPFSQRVLVP 64

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           L       L  +  K +       E +   L  AG     +      +RL + ++  I+ 
Sbjct: 65  LTKSILAKLGQYGPKQS------AERLRISLAQAGNPGNLTPMQFSGIRLALAVVLFIVV 118

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
               F    L        +    +   +G+  P +W+   ++KR+ +I +A PDALDLL 
Sbjct: 119 GAVTF----LQGMDVAQAMMYTAIGAGMGYLLPGIWLGQQIKKRKKAIVKALPDALDLLC 174

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVE+G+S DQA++R+ E       PLS+E    +++      R+ A ++  +R  +D V
Sbjct: 175 ICVEAGLSFDQAMQRLTEKWDD---PLSKEFKRVLSDTRLGRPRRDAMKDMIDRCGVDDV 231

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +    A+IQ+++ G SIG  LR+   + R  R   AE++A     K+  PM+    P L 
Sbjct: 232 QTFIGAVIQAEQLGVSIGRILRIQSDQMRIRRRQRAEEEAHKAPIKMLFPMVFLIFPALF 291

Query: 312 LVIIGPAILSIIDTMK 327
           +VI+GPA+  I+ ++ 
Sbjct: 292 IVILGPAVPRIMKSLG 307


>gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722223|gb|ABC77166.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 317

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 80/318 (25%), Positives = 148/318 (46%), Gaps = 3/318 (0%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
             T + +++    +    +  + +      E  + +  +      +    + S    S +
Sbjct: 1   MNTLILISVMIFGATILFLTGLYLYIRYVREHAQLLDKIEKGSS-IPSMDLDSGSDVSPA 59

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
            +LR    +      + +  K      N    L   G+R  ++      +++++ ++   
Sbjct: 60  RQLRALFVRITGRLGELVKPKKEDEVANFQKPLARIGYRGAHATLFFFGIKVLLAVLLPA 119

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           L ++                +   + +  VGF  P++W+   +  R+  I   +PDALDL
Sbjct: 120 LFLMAKLLAGI--AVNPLAVMIITLALALVGFYLPNLWLRLKIGARKEKIMEGFPDALDL 177

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++ICVE+G+ +DQA+ RV E++     P+S+E      E+    +R+ A  N  NRT++D
Sbjct: 178 MVICVEAGMGLDQAINRVGEEMKLSCPPISDEFRTLNMEMRMGKSRREALRNMANRTELD 237

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V +    LIQ+D++GTSIG +LRV     R +R   AE+KAA L  KL  P+I F  P 
Sbjct: 238 DVTSLVTLLIQTDQFGTSIGQALRVHSDSMRVQRRQRAEEKAAKLPLKLLFPLIFFIFPS 297

Query: 310 LILVIIGPAILSIIDTMK 327
           L +VI+GPA++ +   + 
Sbjct: 298 LFVVIMGPAMIQVFHALS 315


>gi|13471027|ref|NP_102596.1| integral membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021771|dbj|BAB48382.1| probable integral membrane protein [Mesorhizobium loti MAFF303099]
          Length = 305

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/301 (21%), Positives = 136/301 (45%), Gaps = 2/301 (0%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLR 81
           V+I  L+    +         K  ++    R  +    + +  +            ++++
Sbjct: 3   VAILLLVLG-SVAVAWPMVAAKGDRNDVKRRLKVDHGAMAAKPEPPQKKNANVVRERAVK 61

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
              +            +  KL  AG+    ++    ++R    ++   +G   +  +   
Sbjct: 62  RAQEFYAKSDPENVARLRMKLIQAGYMEPRAVGTFFIIRF-SALVGGAIGAFVLNQWLAS 120

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
            E     R   VIL G  G+  P + ++  V+++    +  +PD +DL+++C ++G+S++
Sbjct: 121 AEATMTSRWAFVILSGVAGYFLPGLVLTQQVREKMREYRNGFPDFMDLMIVCSDAGMSME 180

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
             + RV++++      LS+ + L   EL    +   A +   +R  +D VR+    L QS
Sbjct: 181 AGIERVSKELAKTYPALSQNLQLVSLELRAGRSLDDALKALADRLSLDEVRSFATLLQQS 240

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
              GTS+  +LRV   E R +R+  AE+KA +L  K+++P+ +  LPV++++ I P I+ 
Sbjct: 241 KELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAKMSIPVTVCILPVVLMIAIIPIIVK 300

Query: 322 I 322
           +
Sbjct: 301 M 301


>gi|56477520|ref|YP_159109.1| type II secretion system protein [Aromatoleum aromaticum EbN1]
 gi|56313563|emb|CAI08208.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Aromatoleum aromaticum EbN1]
          Length = 315

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 81/318 (25%), Positives = 144/318 (45%), Gaps = 13/318 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T++       V++ +  +  V+          R++++   +  +             
Sbjct: 1   MDYTQIGFLGLLFVAVTAGAF-FVMSLFSRSAAADRLQALGGGKSTVGAGADA------- 52

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                 R  K  + F K    +       +  +   AG R   +      V+ V+ +   
Sbjct: 53  ---WIERTVKLTKPFAKLSTPEDSEDMSALRARFMHAGIRHAAAPLAFFGVKTVLALGLP 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L   +           FQ  +  V+L   +G+  P++ ++ L+  RQ  I   +PDALD
Sbjct: 110 LLA--YSTVLVSTPSLQFQGTLLVVLLAAAIGYYVPNIILNRLIFVRQREIFETFPDALD 167

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+ +CVE+G+ ++ AL RVA+++  +S  L+EE+ L   EL     R  A  N   RT +
Sbjct: 168 LMTVCVEAGLGVEAALVRVADEMQHKSEALAEELHLVTLELRAGLERARALRNLAARTGV 227

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      +IQ++R+GTSI  SLR+     R+ R   AE+ AA +  KL  P+I F  P
Sbjct: 228 EEVEGFVAMVIQAERFGTSIATSLRIHSDMLRTRRRQRAEEAAAKIALKLLFPLIFFIFP 287

Query: 309 VLILVIIGPAILSIIDTM 326
            L+LV++GPA++ +   +
Sbjct: 288 SLMLVLLGPAMIQVYRIL 305


>gi|239814537|ref|YP_002943447.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801114|gb|ACS18181.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 301

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 77/311 (24%), Positives = 142/311 (45%), Gaps = 20/311 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   I   V++   +    +  L     E+R+++VA                 +  S   
Sbjct: 1   MLFPILVFVAVSLAVGGFAVWML-PTRTEQRLRAVAP----------------AGKSAWI 43

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K +  F +  +         +  K   AG R   +      ++ ++P+ F  L  +
Sbjct: 44  ETAVKIVGPFAQLSSPTGEGETSPLRLKFLNAGVRHPDASLFYFGLKTLLPLGFAALAFV 103

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +            L +  V L+   G   P++ +  +++ RQ  I   +PDA DL+L+C
Sbjct: 104 TVRAAGADDGVTTLLWLAVVALL---GCYLPNIVLRMMIKSRQREIFENFPDAADLMLVC 160

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D AL +V E+I  +S  L++E+  T  E+     R+ +  N   RT ++ +  
Sbjct: 161 VEAGLGLDAALVKVTEEIRVKSEALAQELHWTNLEMRAGSTREKSLRNLALRTGVEEIGT 220

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L Q+DR+GTSIG+SLRV   + R +R + AE+ AA +  K+ +P+++   P +  V
Sbjct: 221 FATMLTQADRFGTSIGESLRVFSEDLRHKRQVRAEELAAKVPTKMLLPLVVCIFPCISAV 280

Query: 314 IIGPAILSIID 324
           I+ PA + I+ 
Sbjct: 281 ILTPAAIRIVR 291


>gi|327539548|gb|EGF26158.1| Flp pilus assembly protein TadC [Rhodopirellula baltica WH47]
          Length = 311

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/325 (18%), Positives = 128/325 (39%), Gaps = 14/325 (4%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            FD F A++    +    ++  L Y   +         + +     E       +     
Sbjct: 1   MFDFFMASQWIALVGIFATVSILFYLAFLLW---DPYWRIVDGRVAEMLREDDSEEAGTD 57

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           + +     +            K  L       N+ ++L  AG         L ++R    
Sbjct: 58  QSTDFGDPKETPKSGTTWLGGKSAL-------NLESQLINAGIHHHGMHRKLTMLRW--- 107

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            +  ++  I         E P    V +   +  + +  P +W+   V+K    ++ A P
Sbjct: 108 -LLFLVPPIVFGSLCYRGEMPLNWAVMSSSFLMLLAYSLPVMWLKRAVRKYHQMLRAALP 166

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D LDL+++C+++G+S+ +++++V E++       + E+ L   ++        A   F +
Sbjct: 167 DFLDLMVVCLDAGLSLQESIKQVGEELRWIHPAFTHEIDLVQHDIDLGSPVDKAIRRFAD 226

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R+  D +R  +  + +  R+GT++ +SL       R +R   AE+ A     K+ +P ++
Sbjct: 227 RSGYDALRTLSSLIREGQRFGTNVSESLSGHADMLRFQREQAAEENAQKASVKIILPTML 286

Query: 305 FFLPVLILVIIGPAILSIIDTMKDH 329
           F  P + +V++ PA   I +     
Sbjct: 287 FIFPAIFIVLVSPAAFKIQEAFAAQ 311


>gi|241662160|ref|YP_002980520.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864187|gb|ACS61848.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 313

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 80/319 (25%), Positives = 151/319 (47%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                  +   T + +F  +  + +  +    L++R+  +         ++   L    A
Sbjct: 1   MQIAHTLLLAGTFIVVFGAVL-IALFVVRPTILQQRLGQID--------RESPGLAPKQA 51

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S    +  +  R   +    K    D  +  +   AG+RS  ++ I   ++    +   
Sbjct: 52  PSDWLRKLGRLARPLARASLPKEGWEDSALKARFVHAGWRSPEAVPIYFGIK--TALAGG 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I  ++ +    +         + A++     GF  P+V ++  +++R+  I  A+PD+LD
Sbjct: 110 IPLVLSLLLVRRFDSDHETAYLAALLAGALFGFYLPNVVLAMKIKRRKRDIFEAFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV ED+      ++ E  L   EL     R+ A  NF  RT +
Sbjct: 170 LIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYELLTLELRAGLAREKALRNFAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      LIQ+DR+GTS+ +SLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 230 EDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRQMLAEERAAKIGTKVLFPLIFCLFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA + I+  ++
Sbjct: 290 ALYVVLLGPAGIQIMAGLR 308


>gi|319783869|ref|YP_004143345.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169757|gb|ADV13295.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 320

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 129/272 (47%), Gaps = 1/272 (0%)

Query: 51  EREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSE 110
            R  +    + +  +            K+++   +            +  KL  AG+   
Sbjct: 47  RRLRVDNGPVAAKPEPVQKKNTGIVREKAVKRAQEFYARSDPENVARLRMKLIQAGYMEP 106

Query: 111 YSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISN 170
            ++    ++R    +I   +G+  +  +    +     R   VIL G  G+  P + +S 
Sbjct: 107 RAVGTFFLIRF-TAMIGTAIGVFVLNRWMASPDATMASRWTFVILSGAAGYFLPGLVLSQ 165

Query: 171 LVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS 230
            V++R+   +  +PD +DL+++C ++G+S++  + RV++++      LS+ + L   EL 
Sbjct: 166 KVRERRREYRNGFPDFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELR 225

Query: 231 FLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKK 290
              +   A +   +R  +D VR+    L QS   GTS+  +LRV   + R +R+  AE+K
Sbjct: 226 AGRSLDDALKALADRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDDMRHKRMSLAEEK 285

Query: 291 AASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           A +L  K++VP+++  LPV++++   P I+ +
Sbjct: 286 AHALPAKMSVPVVVCILPVVLMIAAIPVIVKM 317


>gi|32471258|ref|NP_864251.1| integral membrane protein [Rhodopirellula baltica SH 1]
 gi|32396960|emb|CAD71930.1| probable integral membrane protein [Rhodopirellula baltica SH 1]
          Length = 313

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/325 (18%), Positives = 128/325 (39%), Gaps = 14/325 (4%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            FD F A++    +    ++  L Y   +         + +     E       +     
Sbjct: 3   MFDFFMASQWIALVGIFATVSILFYLAFLLW---DPYWRIVDGRVAEMLREDDSEEAGTD 59

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           + +     +            K  L       N+ ++L  AG         L ++R    
Sbjct: 60  QSTDFGDPKETPKSGTTWLGGKSAL-------NLESQLINAGIHHHGMHRKLTMLRW--- 109

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            +  ++  I         E P    V +   +  + +  P +W+   V+K    ++ A P
Sbjct: 110 -LLFLVPPIVFGSLCYRGEMPLNWAVMSSSFLMLLAYSLPVMWLKRAVRKYHQMLRAALP 168

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D LDL+++C+++G+S+ +++++V E++       + E+ L   ++        A   F +
Sbjct: 169 DFLDLMVVCLDAGLSLQESIKQVGEELRWIHPAFTHEIDLVQHDIDLGSPVDKAIRRFAD 228

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R+  D +R  +  + +  R+GT++ +SL       R +R   AE+ A     K+ +P ++
Sbjct: 229 RSGYDALRTLSSLIREGQRFGTNVSESLSGHADMLRFQREQAAEENAQKASVKIILPTML 288

Query: 305 FFLPVLILVIIGPAILSIIDTMKDH 329
           F  P + +V++ PA   I +     
Sbjct: 289 FIFPAIFIVLVSPAAFKIQEAFAAQ 313


>gi|309780755|ref|ZP_07675496.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308920437|gb|EFP66093.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 313

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 80/319 (25%), Positives = 150/319 (47%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                  +   T + +F  +  + +  +    L +R+  +         ++   L    A
Sbjct: 1   MQIAHTLLLAGTFIVVFGAVL-IALFVVRPTILRQRLGQID--------RESPGLAPKQA 51

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S    +  +  R   +    K    D  +  +   AG+RS  ++ I   ++    +   
Sbjct: 52  PSDWLRKLGRLARPLARASLPKEGWEDSALKARFVHAGWRSPEAVPIYFGIK--TALAGG 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I  ++ +    +         + A++     GF  P+V ++  +++R+  I  A+PD+LD
Sbjct: 110 IPLVLSLLLVRRFDSDHETAYLAALLAGALFGFYLPNVVLAMKIKRRKRDIFEAFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV ED+      ++ E  L   EL     R+ A  NF  RT +
Sbjct: 170 LIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYELLTLELRAGLAREKALRNFAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      LIQ+DR+GTS+ +SLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 230 EDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRQMLAEERAAKIGTKVLFPLIFCLFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA + I+  ++
Sbjct: 290 ALYVVLLGPAGIQIMAGLR 308


>gi|296122167|ref|YP_003629945.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014507|gb|ADG67746.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 312

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 80/312 (25%), Positives = 149/312 (47%), Gaps = 4/312 (1%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            +     +   ++  ++ +    + ++  R +S A +R       +   Q+    + +  
Sbjct: 1   MMIDFATIVPLAIFASITLAVFAALQIFSREQSRASQRLDEFNNPLLREQQRGQKNGMSN 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              K+     K L  K+ L    +  +L  AGF S  +  I L ++ V  ++ L+L    
Sbjct: 61  LLEKAAPALSKALEPKSELEQSQLKIRLANAGFHSPQAPMIYLAIKTVCLVVGLVL---- 116

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
             G         Q  +  +I+    GF  P   ++ L+ KR+ +I    PD LDLL++CV
Sbjct: 117 GGGLGMYRYGTTQAGLTTLIIAAGAGFYLPEGVLAYLISKRKQAIFLQLPDVLDLLVVCV 176

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+ +D  LRRVAE++   +  +  E+ +   +L    NR+    +   RT +D V+  
Sbjct: 177 EAGLGLDAGLRRVAEELKDTAPEICGELAMCNLQLQMGRNRRDMLHDLGVRTGVDDVKAL 236

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              +IQ+D++G+SI  +LRV     R +R   AE+KA     ++  PM+IF  P + +V+
Sbjct: 237 VAIMIQADKFGSSIAQALRVQSDSMRVKRRQIAEEKAQKTAVQMLFPMVIFIFPGIFVVL 296

Query: 315 IGPAILSIIDTM 326
           +GPA + ++D +
Sbjct: 297 VGPAAIKMMDQL 308


>gi|300692336|ref|YP_003753331.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
 gi|299079396|emb|CBJ52067.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
          Length = 313

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 74/319 (23%), Positives = 151/319 (47%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + +        F  I A+ +  +    L++R+  +  E   LR +          
Sbjct: 1   MQIAHIVLLAGAFSIAFCAILAI-LVVMRPHTLQRRLGQIDRETPQLRPKIEE------- 52

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                    +  +   +    K    D ++  +   AG+R+  ++ I   V+ ++     
Sbjct: 53  -HDWLHTAERIAKPLARASVPKEGWEDSSLHTRFVHAGWRAPEAIPIYFGVKTILAFGLP 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  ++     +         +  + +   +GF  P++ ++  ++ RQ  +  ++PD+LD
Sbjct: 112 VL--LFPLALGQFDASQRLQFLTVLFVAAAIGFYLPNLVLAWKIKYRQRDVFESFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV +++      +++E  L   EL    +R+ A  +F  RT +
Sbjct: 170 LIMVCVEAGLGLDAAILRVVDEMRAARPVMAQEYELLTLELRAGLSREKALRHFAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D V      LIQ+DR+GTSI  SLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 230 DDVSLLVAMLIQADRFGTSIAASLRVHSDMLRTKRQMLAEERAAKIGTKILFPLIFCIFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            + +V++G A++ I++ ++
Sbjct: 290 SIYVVLLGSALIQIVEALR 308


>gi|163751752|ref|ZP_02158970.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
 gi|161328404|gb|EDP99563.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
          Length = 322

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 85/329 (25%), Positives = 149/329 (45%), Gaps = 19/329 (5%)

Query: 4   YFFDLFDATE-LAVAITTAVSIFSLIYAVVIPSLGS---GELEKRMKSVAVEREILRKQQ 59
               LFD  E +  A+    +I  +  A+ I    +     L KR+K +    E     +
Sbjct: 7   LLSTLFDDPEHVKWAVYVMAAIAGITLAISISLFITGIYSPLRKRLKIINQTGEGHHMTR 66

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
                               +     +  L   L +++    L  AG  SE +L +   V
Sbjct: 67  TDVNAT----------IEHGIGRMASRTPLN--LTNDDTRRLLIHAGLHSENALAVFSSV 114

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           RL   I+ LI   + +       E    + V  V L+    +  PS+ + +L  +R  ++
Sbjct: 115 RL---ILLLISAGLSVLILSLFPEISGMMSVYVVALMVGGAYLLPSMVLQHLASRRMKNL 171

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +  +PDALDLL++C E+G+ +  AL+RVA ++      L+ E+ L  +++      +VA 
Sbjct: 172 RAGFPDALDLLVVCCEAGLGLLAALQRVANELAISHASLASELDLVCSKVRAGLTIKVAL 231

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           + F  RT ++ ++    A+ QS R GT I  +LR+   E R +RL +AE++AA L  K+ 
Sbjct: 232 QEFTERTGLEDIKGLNSAISQSIRLGTGIAATLRIFSDEYRDKRLQDAEEQAAKLAVKMI 291

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            PM++   P   +V +GPA+L ++     
Sbjct: 292 FPMMLCIWPSFFIVAVGPAVLKVMKVWGQ 320


>gi|207728101|ref|YP_002256495.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
 gi|206591346|emb|CAQ56958.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
          Length = 314

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 76/319 (23%), Positives = 150/319 (47%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               +  +   T + IF  + A  +  L    L++R+  +         ++     +   
Sbjct: 1   MQIAQTVLLAGTFIIIFGAVLA-ALTILRPSALQRRLGQID--------REAPGRVQQET 51

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S    +  +  +   K    K    + ++  +   AG+R+  ++ I   V+ ++     
Sbjct: 52  PSDWLRKIGQIAKPLAKASLPKDGWENSDLRARFVHAGWRAPEAIAIYFGVKTLLAAGLP 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L    +    +         +  ++    +GF  P+V +   +++RQ  I  A+PD+LD
Sbjct: 112 LLLS--LALLGRFDASHQTEYLTVLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV E++      ++EE  +   EL     R+ A  N   RT +
Sbjct: 170 LIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYEILTLELRAGLAREKALRNLAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      LIQ+DR+GTS+ +SLRV     R++R M AE++AA +  K+  P+I    P
Sbjct: 230 EDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERAAKISTKILFPLIFCIFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA + ++  ++
Sbjct: 290 SLFVVLLGPAAIQVVGALR 308


>gi|116620536|ref|YP_822692.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223698|gb|ABJ82407.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 315

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 83/312 (26%), Positives = 145/312 (46%), Gaps = 10/312 (3%)

Query: 17  AITTAVSIFSLIYAVVIPSLGS--GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            I  ++  F ++  ++         +  K ++ +         +Q    +     +    
Sbjct: 4   PILFSLCAFLMLMLILSWVGYRLIYKPGKFLRQLGNPVITNASKQRIIEEGGEPEASALV 63

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                + + V      +     N+   L  AGFR E +L +   VR++  +  LIL ++ 
Sbjct: 64  TVLHQIGSRV----PSSDAEVANLKVDLIRAGFRGENALAVFYGVRILTTLGMLILCVMM 119

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
               +  +     +++G +      G+  P  ++   V KRQ +++ + PDALDLL++ +
Sbjct: 120 ----EARMPPNPVMQLGLMGSGICAGWILPRFFLEKRVAKRQETLRLSLPDALDLLVVSI 175

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+ +DQA++ VA ++      LS+EM L   E+     R  A  NF  RT     R  
Sbjct: 176 EAGLGLDQAIQHVARELYASHPQLSDEMQLVTLEMRAGKRRSEALRNFAERTGEAEFRKL 235

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              LIQ+DR+GTS+G+SLR      R+ R  EAE++A  +G KL  P+  F LP +++V 
Sbjct: 236 VAILIQNDRFGTSMGESLRTHSDFLRTRRRQEAEERAGKVGVKLVFPIFFFILPSMLVVA 295

Query: 315 IGPAILSIIDTM 326
            GP IL I   +
Sbjct: 296 AGPGILQIFKYL 307


>gi|297618076|ref|YP_003703235.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145913|gb|ADI02670.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 295

 Score =  149 bits (375), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 77/317 (24%), Positives = 137/317 (43%), Gaps = 23/317 (7%)

Query: 12  TELAVAITTAVSIFSLIYAV-VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            ELAV     ++ F L   V          + +R++    ER+    Q++          
Sbjct: 1   MELAVYGAVFLAGFCLTLGVGYTLFWERMAVLERLEHYTEERKKTIYQELNQPLSQRVFK 60

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            L     + ++ FV K   +A        ++L  AG          +  +  V    ++L
Sbjct: 61  PLIGAALRGMKRFVPKEKARAY------EHRLTLAGNPHGLEAETFVAAKYGVFAAAVLL 114

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G++                   ++L+G  G   P ++++   ++R   I ++ PD LDLL
Sbjct: 115 GLL-------------TRSPWLLVLLGMAGLLLPDMYLNLCRRQRSEGILKSLPDVLDLL 161

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            + VE+G+  D AL++V E       PL++E    + E+     R+ A  +   R ++D 
Sbjct: 162 SVSVEAGLGFDAALQKVVEK---SQGPLADEFDTALNEIRMGKPRREALRDMARRVEVDD 218

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V     A++Q+D  G SI + L V   + R +R   AE+KA     K+ +PM+ F  P +
Sbjct: 219 VSTFVGAVVQADTLGVSISNVLTVQAEQVRQKRRQRAEEKAQKAPVKILIPMLFFIFPTI 278

Query: 311 ILVIIGPAILSIIDTMK 327
            +V++GPA+L I    K
Sbjct: 279 FIVLLGPALLQIGKVFK 295


>gi|225181994|ref|ZP_03735426.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167279|gb|EEG76098.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 305

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 75/316 (23%), Positives = 150/316 (47%), Gaps = 14/316 (4%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            +  +A+   +++ + I A+         +L+ R+K+V    E    +Q         S 
Sbjct: 1   MQAIIALLVFLTLVTFITALQNKLQPAKVDLQGRLKNVINYDETADIRQAELS--RPLSE 58

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           R+ +     L     +L    IL    +  K++ AG    +S    L +++V        
Sbjct: 59  RICSPLLGVLSALASRLLPADILKG--LERKVQQAGMTGGFSAKDYLGMKVVFAFGLPFF 116

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             +                   V + G +G+  P + + N  + R++SI++++PD LDLL
Sbjct: 117 FYLL------FGRDLSPQTFLIVAIAGVLGWRLPEMKLENTARSRKASIEKSFPDTLDLL 170

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            + V +G+  D AL   A+ +     P++EE    + E+     R+ A  +F  RT +D 
Sbjct: 171 TVSVGAGLGFDGAL---AKVVEKSEGPVAEEFRRVLQEIKMGKARREALRDFGERTGIDD 227

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V++ T A++Q+D+ G +IG +L+V   + R +R    E++A  +  K+ +P++ F  P +
Sbjct: 228 VKSFTGAIVQADQLGLNIGKTLKVQSEQMRRKRRQRVEEQAMKVPVKMLLPLVAFIFPTI 287

Query: 311 ILVIIGPAILSIIDTM 326
            +V++GPA++ I++T+
Sbjct: 288 FIVLLGPAMIQIVETL 303


>gi|320161469|ref|YP_004174693.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995322|dbj|BAJ64093.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 319

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 73/314 (23%), Positives = 140/314 (44%), Gaps = 10/314 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD---SASSR 71
            +     + +      V I        + R+    +E    R +Q+   + +     S R
Sbjct: 6   IIIGVVGLVVIGAGALVYIGLRNPTSADDRLLQQRLEEFNQRGEQVDLEKIELSLPFSER 65

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           +    ++ L     +   +  + D  I  KL  AG   +    + L ++ +         
Sbjct: 66  VIFPMARKLGEIAVRFTPQNAMQD--INRKLELAGNPGKLDATVFLALQFIAG--GFFGA 121

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           ++++  Y     +PF  +   V+    +GF  P +W+++ + +RQ  I+++ PDALDLL 
Sbjct: 122 VLFLAMYFGQSNWPFGQKFLVVLGGTLLGFFFPQIWLTSKISRRQKEIRKSMPDALDLLT 181

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           ICVE+G+  D A+ +VAE        LS      I E+     R+ A  +   R  +  +
Sbjct: 182 ICVEAGLGFDAAMAKVAEK---WESELSLAFARVIQEIQLGKTRRDALRDMAERIGIPEM 238

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
            +   A+IQS++ G S+   LR+   + R  R   AE++A     K+ +PM +   P L+
Sbjct: 239 TSFVAAVIQSEQLGVSMAKVLRIQSDQMRVRRRQAAEEEAHKAPVKMLIPMALLIFPSLM 298

Query: 312 LVIIGPAILSIIDT 325
           +V++ PA L ++++
Sbjct: 299 IVLMTPAALRLMNS 312


>gi|118581108|ref|YP_902358.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
 gi|118503818|gb|ABL00301.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
          Length = 302

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 88/317 (27%), Positives = 147/317 (46%), Gaps = 16/317 (5%)

Query: 12  TELAVAITTAVSIFSLI-YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             + +     +S+  ++  A+       GEL++R++ +  E+     Q  T+  +D    
Sbjct: 1   MLIVITGFIFLSVAMVVSLALYPLLTKKGELQERLEKMMPEK-----QASTTFSEDKPWW 55

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           R+   D  +      K               L AAGFR + SL + L  +L + +I   +
Sbjct: 56  RITIEDLGAKLPVAAK-------EQTKYTRMLVAAGFR-KESLYLFLGSKLALALILPGI 107

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            I        +L  P    +     +   GF  PS W+   V  R++ I    PD LDLL
Sbjct: 108 YIFTYALPKGVLMEP--EPLLYTTGLAIAGFLLPSGWLMYKVNNRKTEIFHTLPDILDLL 165

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            + VE+G+ ID AL R  E    +  PL+EE+ +   E+     R  A  +   RT ++ 
Sbjct: 166 TVSVEAGLGIDAALNRACESPQFKGNPLAEELKIAAREIRAGKPRGDALRDMAERTDVED 225

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR     L+Q++R+GTS+  +LRV     R++R   AE++AA    K+  P+I+F  P L
Sbjct: 226 VRAFVTMLVQTERFGTSLSLALRVHSDSLRTKRRQIAEERAAKTAIKILFPLILFIFPAL 285

Query: 311 ILVIIGPAILSIIDTMK 327
           ++++IGPA   ++D  K
Sbjct: 286 MIILIGPAFFKLMDIFK 302


>gi|264678228|ref|YP_003278135.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262208741|gb|ACY32839.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 303

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 81/312 (25%), Positives = 144/312 (46%), Gaps = 19/312 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L VA+ T  ++     A+   +      E+R++S+                  S      
Sbjct: 2   LIVALLTFTAVMLAAGALFFWAT-PTVAERRLQSLT---------------PTSQDKGWT 45

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K +  F    +         +  +   AG R E +  +   V+ ++PI    LG+ 
Sbjct: 46  ETVVKLVGPFAHLSSPTKDSDATPLRLRFLNAGIRHESAPLLYFGVKTLLPIA---LGLA 102

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                    +      +   ++   V    P++ +  +  +R+  I   +PDA DL+L+C
Sbjct: 103 VYSLMRAASKADSTQLLFFPLVTALVACYLPNLVLRWMASRRKREIFENFPDAADLMLVC 162

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D AL +V ++I  +S  L+EE+  T  E+     R+ +  N   RT +D +  
Sbjct: 163 VEAGMGLDAALGKVTDEIRIKSEALAEELHWTNLEMRAGSTREKSLRNLAARTGVDEIHT 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  L Q+DR+GTSIG+SLRV   + R +R M AE+ AA +  K+ +P++    P +I+V
Sbjct: 223 FTAMLTQADRFGTSIGESLRVFSDDLRHKRQMRAEELAAKIPTKMLLPLVTCIFPAIIMV 282

Query: 314 IIGPAILSIIDT 325
           ++GPAI+ I+  
Sbjct: 283 VLGPAIIRIVRM 294


>gi|296122064|ref|YP_003629842.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014404|gb|ADG67643.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 426

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/282 (23%), Positives = 128/282 (45%), Gaps = 4/282 (1%)

Query: 45  MKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRA 104
           + S +  R+  R       +              +L   +  L  +A    ++I + L A
Sbjct: 114 VDSSSTYRDRSRGLPRVLAEDLPDELNQGEMTFGALTPALASLLPEAGSRQDSIRSDLYA 173

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+ S  ++     VR +  I+ ++   + +       E    + +GA++L+  VG+  P
Sbjct: 174 AGYYSPRAVMNFSAVRYLAMILPMLFCGVLLLFVPPRFE---PIVIGAIVLMPIVGWSLP 230

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
            + + N  + R++ I++A PD LD+L +CV  G+++  +L R+  ++ G    L +E+ +
Sbjct: 231 RLMVRNKARDRRNEIEKAMPDLLDMLNMCVSQGMTVPASLERIRVEMKGAYPALEQELKI 290

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
              +     +  VA +NF  R  +  V + T  L+Q+ R GTS+  +L       R    
Sbjct: 291 INEQSRIG-SMDVALKNFSQRVDVPEVHSFTSLLMQTSRMGTSVSGALTEYAETMRESLK 349

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             AE+K      +L  P ++  +P + L ++GPAI+ +    
Sbjct: 350 QRAEEKGNRATFRLLFPTVLCLMPAVYLFLMGPAIIELSRFF 391


>gi|322419939|ref|YP_004199162.1| Type II secretion system F domain-containing protein [Geobacter sp.
           M18]
 gi|320126326|gb|ADW13886.1| Type II secretion system F domain protein [Geobacter sp. M18]
          Length = 303

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/315 (23%), Positives = 141/315 (44%), Gaps = 14/315 (4%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
            A+  T   +I  L  A + P +         +SV   R +  + Q  S  +    +   
Sbjct: 3   YAITATVFFAIVLLTCAALYPYMSR-------RSVVQSRLVKLEVQEVSKVELVPEAPKW 55

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                 +   +      +       +  L AAG++ + S+ +    +++  +   + G  
Sbjct: 56  YDQLSEIGKSLSF----SSKEQGKYMKMLVAAGYK-KESVFVFFGCKIL--LACGLPGFY 108

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +F          +  +   +++  +G+ APS W+ +   +RQ  I    PD LDL+ +C
Sbjct: 109 LLFYVMSKGFTMNRQLILGALILAILGYLAPSYWLYHQYNERQLKIFHTLPDILDLITVC 168

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V++G+S+D AL +  E     + PL++E+ +   E      R  + ++   RT +D VR 
Sbjct: 169 VDAGLSMDAALIKTTETPQFANDPLAKEIKIATMETRAGKPRIESLKDMAERTMVDDVRA 228

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L Q++R+GTS+  +L V     R++R   AE+ AA    K+  P+I+F  P L++V
Sbjct: 229 FVTMLSQTERFGTSLSQALSVHAESLRTKRRQMAEEAAAKTTIKMVFPLILFIFPALLVV 288

Query: 314 IIGPAILSIIDTMKD 328
           I+GPA + I   +  
Sbjct: 289 ILGPAYVQISRVLMK 303


>gi|83312845|ref|YP_423109.1| Flp pilus assembly protein TadC [Magnetospirillum magneticum AMB-1]
 gi|82947686|dbj|BAE52550.1| Flp pilus assembly protein TadC [Magnetospirillum magneticum AMB-1]
          Length = 339

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 116/298 (38%), Positives = 182/298 (61%), Gaps = 6/298 (2%)

Query: 34  PSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD----SKSLRNFVKKLNL 89
           P L       R+K+V+  R  L ++Q   L +  A+SR R          +R  + +L L
Sbjct: 44  PLLARDRRASRIKAVSNRRRELSERQKAELDQARATSRRRGARPQRRVALMRAVIDRLKL 103

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           + +L  + +  +L  AG+RS+ +    +  R+ +P+I L LG+I+        E P  +R
Sbjct: 104 QDLLEAKALRAQLACAGWRSQAAPLTFIFARVALPVILLALGLIYATTL--FDEQPLMIR 161

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
              +     +G   P++W++N VQKRQ ++ RA+PDALDL++ICV++G+S++ AL RV E
Sbjct: 162 ALILAAAMGIGALLPNIWLTNAVQKRQMALSRAFPDALDLIVICVDAGLSVETALGRVTE 221

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           ++   +  ++EE+ LT AEL+FL +R+ A+ENF  RT +  V++   ALIQS++YGT + 
Sbjct: 222 EMMISAPEMAEEIGLTAAELAFLADRRHAWENFAERTGLPQVKSLATALIQSEKYGTPVA 281

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            +L+V+  E R  R+  AEKKAA+L  KLTVPMI+FFLPVL L+I GPA + +   MK
Sbjct: 282 QALKVISQENREGRMAAAEKKAAALPAKLTVPMIVFFLPVLFLIIAGPAAIQVSGMMK 339


>gi|303241709|ref|ZP_07328206.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590710|gb|EFL60461.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 306

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/316 (22%), Positives = 138/316 (43%), Gaps = 12/316 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            +      SIF   Y +    +G   +  R + V   R     ++     ++  +  L  
Sbjct: 1   MIIYLLLASIFISSYFIFYAFVG---VFYRNRKVVSIRLDRITKEDVKTLENELNQPLFV 57

Query: 75  RDSKSLRNFVKKLNLKAILV--DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R  + + + + K+ L+            K+  AG     S+   + +++++ +I   +  
Sbjct: 58  RVIRPILDDISKVILRITPKEFKSAFEKKVVNAGNPFNLSMKDWINMQVIIVVILPFI-- 115

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
               G    L    +  V   I+    G   P++ ++  + +RQ  I  + PD LDLL +
Sbjct: 116 --TSGVCYYLGLDVRSIVFVGIIEICFGLLFPNLVLNKQIAQRQKKILNSLPDVLDLLTV 173

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            VE+G+  D AL   A+ I     P++ E    + E+     ++ A ++   R  +  + 
Sbjct: 174 SVEAGLGFDGAL---AKVIDKMPGPIAIEFENVLQEMKVGKQKRDALKDMAERVGLHDLT 230

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
               ++IQ+D+ G SIG+ LR+   + R +R   A++KA     K+ +PM++F  P +  
Sbjct: 231 TFVGSIIQADQLGVSIGNVLRIQSEQMREKRRQRAKEKAMKAPVKMLIPMVLFIFPTIFS 290

Query: 313 VIIGPAILSIIDTMKD 328
           V+IGP I+ +I T   
Sbjct: 291 VLIGPVIIKVIYTFTK 306


>gi|302391033|ref|YP_003826853.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203110|gb|ADL11788.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 306

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/313 (23%), Positives = 145/313 (46%), Gaps = 10/313 (3%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +     +++  L   V           KR+++   +   L+++ +   ++   S   R
Sbjct: 1   MLLIAAVFIAVAGLTLVVGYYLSQPS---KRVQNRLQKYAQLQREVLPRREELELSFWER 57

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                  +  V  + L  + V ++I  +L  AG   +      L ++  +  +   +   
Sbjct: 58  VIRPGLQKMAVLFVKLTPLGVKDSIRKRLILAGRPFDLEAKEFLALQGNLMAVLPGI--- 114

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            I G   +        +   ++ G+ GF  P   +S  + +RQ  +++A PD LDLL + 
Sbjct: 115 -ILGGLMIAGVSLNTALMYSLIFGFAGFVIPRFLLSKKISERQKKMQQALPDVLDLLTVS 173

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+  D AL RV + I G   P+SEE    + E+     R+ A  +   RT ++ + N
Sbjct: 174 VEAGLGFDSALVRVVDKIAG---PISEEFERLLQEIRMGKPRRDAMRDLGERTNVEDLTN 230

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              A++Q+D+ G SIG  LRV   + R +R   AE +A     K+ +P++ F  P L ++
Sbjct: 231 FITAIVQADKLGVSIGKVLRVQSKQIRQKRRQRAEAQAMKAPIKMLLPLVFFIFPTLFII 290

Query: 314 IIGPAILSIIDTM 326
           ++GPA + +++++
Sbjct: 291 LLGPAAIKVMNSL 303


>gi|156741661|ref|YP_001431790.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232989|gb|ABU57772.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 311

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/317 (23%), Positives = 139/317 (43%), Gaps = 17/317 (5%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGS----GELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            + +    ++  L   +++  +        +  R+         L + ++          
Sbjct: 4   MLPMIGFGALMLLGVGLIVFGMRRSSQPDAISDRLSQFTERTMTLEEMELQQPFSQRVLV 63

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            L       L  +  K +       E +   L  AG     +      +RL + +I  ++
Sbjct: 64  PLTKSILAKLGEYGPKQS------AERLRISLAQAGNPGNLTPIQFSGIRLALAVILFLV 117

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
                F     +       +    + G +G+  P +W+   ++KR+ +I +A PDALDLL
Sbjct: 118 VGAVTFLQGMEMSQ----ALMYTAIGGVMGYLLPGIWLGQQIKKRKKAIIKALPDALDLL 173

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            ICVE+G+S DQA++R+ E       PLS+E    +++      R+ A ++  +R  +D 
Sbjct: 174 CICVEAGLSFDQAMQRLTEKWED---PLSKEFKRVLSDTRLGRPRRDAMKDMIDRCGVDD 230

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V+    A+IQ+++ G SIG  LR+   + R  R   AE++A     K+  PM+    P L
Sbjct: 231 VQTFIGAVIQAEQLGVSIGRILRIQSDQMRIRRRQRAEEEAHKAPIKMLFPMVFLIFPAL 290

Query: 311 ILVIIGPAILSIIDTMK 327
            +VI+GPA+  I+ ++ 
Sbjct: 291 FIVILGPAVPRIMKSLG 307


>gi|83749633|ref|ZP_00946616.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|207744163|ref|YP_002260555.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
 gi|83723694|gb|EAP70889.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|206595567|emb|CAQ62494.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
          Length = 314

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 75/319 (23%), Positives = 148/319 (46%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               +  +   T + IF  + A  +  L    L++R+  +         ++     ++  
Sbjct: 1   MQIAQTVLLAGTFIIIFGAVLA-ALTILRPSALQRRLGQID--------REAPGRVQEET 51

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                 +  +  +   K    K    +  +      AG+R+  ++ I   V+ ++     
Sbjct: 52  PYDWLRKIGQIAKPLAKASLPKDGWENSGLRAHFVHAGWRAPEAIAIYFGVKTLLAAGLP 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L    +    +         +  ++    +GF  P+V +   +++RQ  I  A+PD+LD
Sbjct: 112 LLLS--LALLGRFDASHQTEYLTVLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV E++      ++EE  +   EL     R+ A  N   RT +
Sbjct: 170 LIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYEILTLELRAGLAREKALRNLAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      LIQ+DR+GTS+ +SLRV     R++R M AE++AA +  K+  P+I    P
Sbjct: 230 EDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERAAKISTKILFPLIFCIFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA + ++  ++
Sbjct: 290 SLFVVLLGPAAIQVVGALR 308


>gi|296134293|ref|YP_003641540.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032871|gb|ADG83639.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 304

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 82/317 (25%), Positives = 142/317 (44%), Gaps = 15/317 (4%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
               V   T V++F L+  +         +      VA   E +         +D     
Sbjct: 1   MLYLVLGLTFVTVFFLVQGIYYTVYRDKII------VAQRIEEIISMNEKQQIEDELDRP 54

Query: 72  LRTRDSKSLRNFVKKL--NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
              R  + +   +              ++  KL AAG   + S N  +V++  + ++  +
Sbjct: 55  FFERVVRPVLERIALSLGKAIPAKKRISLQRKLLAAGNPLDLSPNEFMVIQYALTLLLPV 114

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +GI+ +        +     V  V L G +GF  P  ++      RQ  I+   PD LDL
Sbjct: 115 IGIVVVLPLG----WSPVGMVAVVALGGTIGFLLPEYYLKAKSAARQEEIQDTLPDVLDL 170

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L + VE+G+  D A+ +V E I G    LS+E    + E+     R+ A ++   RT ++
Sbjct: 171 LTVSVEAGLGFDAAMVKVVEKIKG---VLSQECARMLQEVKMGKPRRDALKDLGVRTGVE 227

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V++   A+IQ+D+ G SIG+ LRV   + R +R   AE+KA     K+ +P+IIF  P 
Sbjct: 228 DVQSFVGAVIQADQLGVSIGNVLRVQSEQMRQKRRQRAEQKAMKAPVKMLIPLIIFIFPT 287

Query: 310 LILVIIGPAILSIIDTM 326
           + +V++GPA + ++ T 
Sbjct: 288 IFIVVLGPAAIQVLKTF 304


>gi|294012231|ref|YP_003545691.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675561|dbj|BAI97079.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 322

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 148/309 (47%), Gaps = 8/309 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +     ++I +L++ +    + +  +  R+  V          Q    +++S+  +    
Sbjct: 14  ILGFLFIAIVALVFGLSEVVMRNARVRSRLDLVGEGGASQNGSQTLRGERNSSEWKKLVD 73

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
             + +   +   N      + ++  +L AAG+ S  +  +  + RLV+      + +I  
Sbjct: 74  RIEKMGVSLVDTN------NVDLRRRLIAAGYMSPEAPKLFTLFRLVLTFALPAIFVITS 127

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
               +              L+  +G   P+++IS    +RQ  I   +PDALDL+L+CVE
Sbjct: 128 LRNPEPPTALTLY--MVASLLAVLGLYMPNLYISAKASRRQEEIVHGFPDALDLMLVCVE 185

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+ ++ A+ RV  ++      +S  +   + EL    +RQ A     +   +D +R+  
Sbjct: 186 AGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGRSRQDALRRMADDVDVDEIRSFA 245

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQSD+ G+S+G +LRV  +E R +R M AE+KA  L   L+VP++   LPV+I V++
Sbjct: 246 TLLIQSDQLGSSVGQTLRVYAAEMREKRRMRAEEKAHRLPVLLSVPLVACMLPVMIGVLM 305

Query: 316 GPAILSIID 324
            PA++ ++ 
Sbjct: 306 LPAVVRVVR 314


>gi|163846103|ref|YP_001634147.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523838|ref|YP_002568308.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
 gi|163667392|gb|ABY33758.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447717|gb|ACM51983.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
          Length = 311

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 75/313 (23%), Positives = 145/313 (46%), Gaps = 10/313 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + +     I  +  +++I ++      + +     +   +         +     R+  
Sbjct: 1   MMDLLIVAGIVVIGASLIIVAVRQMNQSRAISERLDQYTDISLSLEELELQQPFRERVLV 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +SL N + +  LK     E +   L+ AG     S N+ + +R+ + I+  ++  + 
Sbjct: 61  PLFRSLLNTLGRFGLKQ--NQERLRINLQLAGNPGNISPNMFIGLRMALAIVLFVVIGLL 118

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +F        PF   +   ++ G +G+  P +W+   +++R+ +I +A PDALDLL I V
Sbjct: 119 VF-----GRLPFMQALMGALIAGMIGYILPGIWLDRKIKERKKNILKALPDALDLLCISV 173

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G++ D AL+RVA+        LS E    + ++     R+ A  +   RT ++ V+  
Sbjct: 174 EAGLAFDLALQRVAQK---WDNELSREFQRVLQDIRLGRTRREALRDLVTRTGVEDVQTF 230

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A+IQ+D+ G S+   LR+   + R  R   AE+ A     K+ +PM+    P L +VI
Sbjct: 231 VSAVIQADQLGVSMSKILRIQSDQLRVRRRQRAEEAAQKAPVKMLIPMVFLIFPALFVVI 290

Query: 315 IGPAILSIIDTMK 327
           +GPA+  I+  + 
Sbjct: 291 LGPAVPRIMQALG 303


>gi|323700365|ref|ZP_08112277.1| Type II secretion system F domain [Desulfovibrio sp. ND132]
 gi|323460297|gb|EGB16162.1| Type II secretion system F domain [Desulfovibrio desulfuricans
           ND132]
          Length = 318

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 77/315 (24%), Positives = 133/315 (42%), Gaps = 8/315 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L  A    VS+    Y ++    G+ +  K  + V+                        
Sbjct: 8   LFAAGIGFVSVLLAGYGLLGYLSGASDSAKLKERVSGTTVKRSDALTA------PLGNAV 61

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                       K+        +    +L  AG R   S  I   ++  + +      ++
Sbjct: 62  KSVVDFFGRLGTKIGPTETEEIDKGRLRLIQAGMRKPDSYKIFQGLKGFLAVGLAGGFLL 121

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
             F +  + +    +     + +  VG   P  W+S  + +R+ ++    PDALDLL++C
Sbjct: 122 VRFLF--IEDMSIAMTAFGTVTLAAVGVYGPEYWLSKKINRRKLAVGDELPDALDLLVVC 179

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+ +DQA+ RV +++      +S E  L   EL     R  A  +   R  +D + +
Sbjct: 180 VESGMGLDQAVDRVCQEMKNSGPIISSEFKLLTLELRAGKARIDALRSLAERVGLDDLNS 239

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  LIQ+D +G S+G +LRV     R +R   AE+KAA +   L +P++ F LP L + 
Sbjct: 240 LTSLLIQADAFGISVGRTLRVYSDAMRVKRSQRAEEKAAKMPVLLLLPLVAFILPTLFVA 299

Query: 314 IIGPAILSIIDTMKD 328
           I+GPA++  +D    
Sbjct: 300 ILGPAVIMSMDMFLK 314


>gi|299532601|ref|ZP_07045990.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719404|gb|EFI60372.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 303

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 78/312 (25%), Positives = 139/312 (44%), Gaps = 18/312 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +      +   L    +         E+R++S+                  S      
Sbjct: 1   MLIVALLTFTALMLAAGALFFWATPTVAERRLQSLT---------------PTSQDKGWT 45

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K +  F    +    +    +  +   AG R E +  +   V+ ++P+    LG+ 
Sbjct: 46  ETVVKLVGPFAHLSSPTKDIDATPLRLRFLNAGIRHESAPLLYFGVKTLLPL---SLGLA 102

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                    +     R+   ++   V    P++ +  +  +R+  I   +PDA DL+L+C
Sbjct: 103 VYSLMLTASKADSTQRLLFPLVAALVACYLPNLVLRWMALRRKREIFENFPDAADLMLVC 162

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D AL +V E+I  +S  L+EE+  T  E+     R+ A  N   RT +D +  
Sbjct: 163 VEAGMGLDAALGKVTEEIRIKSEALAEELHWTNLEMRAGSTREKALRNLAARTGVDEIHT 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  L Q+DR+GTSIG+SLRV   + R +R M AE+ AA +  K+  P++    P +I+V
Sbjct: 223 FTAMLTQADRFGTSIGESLRVFSDDLRHKRQMRAEELAAKIPTKMLFPLVTCIFPAIIMV 282

Query: 314 IIGPAILSIIDT 325
           ++GPAI+ +   
Sbjct: 283 VLGPAIIRVARM 294


>gi|82703469|ref|YP_413035.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411534|gb|ABB75643.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 313

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 75/318 (23%), Positives = 144/318 (45%), Gaps = 12/318 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               ++A      +++    + V + +L     + R++ VA            S  +  A
Sbjct: 1   MTPVQIAYLAVIFIAVAGAAFGV-MRALAPRPTKTRLEQVA---------AGNSPSQQKA 50

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                           K            +  +   AG+ +     +    +  + +   
Sbjct: 51  GDGWERTMVNLAGPLAKLALPSEGWETSVLRTRFMHAGYHARSVPMVYFAAKTGLALALP 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            + ++++      LE      + A++ +   G+  P++ +  LV +R+  +  ++PDA+D
Sbjct: 111 AIFLLYVGI--GRLELDVNAALFALLSLAAFGYYLPNLVLGRLVLQRKRELFESFPDAID 168

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+ +CVE+G+ +D A+ RVAE++  +S  L+ E+ L   EL     R+ A  N   RT +
Sbjct: 169 LMTVCVEAGLGLDAAMVRVAEEMRLRSKALASELHLVSLELRAGRTREQALRNLAMRTGV 228

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +      L+Q+DR+GTS+  SLRV     R+ R + AE+ AA +  KL  P+I F  P
Sbjct: 229 EEIEALVSMLVQADRFGTSVAASLRVHSDTLRTTRRLRAEEAAAKIALKLLFPLIFFIFP 288

Query: 309 VLILVIIGPAILSIIDTM 326
            L+LV++GPA ++I   +
Sbjct: 289 SLLLVLMGPAFINIYRVL 306


>gi|294140782|ref|YP_003556760.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
 gi|293327251|dbj|BAJ01982.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
          Length = 322

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 87/322 (27%), Positives = 154/322 (47%), Gaps = 18/322 (5%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGS---GELEKRMKSVAVEREILRKQQITSLQKD 66
           D + +  A+    ++  +  A+ +  L +     L KR+KS+            T  +  
Sbjct: 14  DPSHVKWAVYAMAAVAGITLAISLSFLITGIYSPLRKRLKSIN----------KTDAEHH 63

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
            + + + T     +    +K  L   L ++     L  AG  SE +L +   VRL++ +I
Sbjct: 64  ISHTDVNTTIEHGIGRAARKTPLN--LSNDETRRLLIHAGLHSENALAVFSSVRLILLLI 121

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
                 + +       E    + V  V L+    +  PS+ + NL  +R   ++  +PDA
Sbjct: 122 ---SASLSVLILSMFPEISGMMSVYVVALLVGGAYLLPSMVLQNLASRRMKELRAGFPDA 178

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LDLL++C E+G+ +  AL+RVA ++    V L+ E+ L  +++      +VA + F +RT
Sbjct: 179 LDLLVVCCEAGLGLLAALQRVANELAISHVSLASELDLVCSKVRAGLTIKVALQEFTDRT 238

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +D ++    A+ QS R GT I  +LRV   E R +RL EAE++AA L  K+  PM++  
Sbjct: 239 GLDDIKGLNSAISQSIRLGTGIAATLRVFSDEYRDKRLQEAEEQAAKLAVKMIFPMMLGI 298

Query: 307 LPVLILVIIGPAILSIIDTMKD 328
            P   +V +GPA+L ++     
Sbjct: 299 WPSFFIVAVGPAVLKVMKVWGQ 320


>gi|269126091|ref|YP_003299461.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311049|gb|ACY97423.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 307

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 74/291 (25%), Positives = 125/291 (42%), Gaps = 12/291 (4%)

Query: 37  GSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL--NLKAILV 94
                  R   VA     +  +                R ++ L   ++ L  +L     
Sbjct: 23  SPPRRSDRPTGVAGALHSIETEYAGKATGTVPPPSRDERLAEPLMRRLRMLAQSLSPGTG 82

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
            E +  +L  AG    ++   +L  + +  +     G +                +    
Sbjct: 83  VEGLQRRLDLAGNPGAWTPERILSYKGLGLLAVGATGALV-------GSGSVPGILLGAA 135

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L    GF  P + + N   +RQ  +KR+ PD LDLL++ VE+G+  D AL RVA+     
Sbjct: 136 LGSLFGFFLPDILLYNAGLRRQEELKRSLPDTLDLLVVSVEAGLGFDAALTRVAQH---T 192

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
           S PL+EE+   + E+    +R  A  +   R  ++ VR    AL+Q+   G SIG  LR 
Sbjct: 193 SGPLAEELARVLQEIRIGKSRTEALRSMGERVAVEEVRTFIAALVQASELGMSIGVVLRE 252

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
              E R +R   AE+ A  +  K+  P+++  LP LI+ ++GP +LSI+++
Sbjct: 253 QAREARLKRRQRAEEMAQKVPVKVMFPVVLCILPALIITVVGPGVLSIMES 303


>gi|300704935|ref|YP_003746538.1| tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072599|emb|CBJ43949.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
          Length = 314

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 75/319 (23%), Positives = 150/319 (47%), Gaps = 11/319 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               +  +   T + IF  +    +  L    L++R+  +         ++     ++  
Sbjct: 1   MQIAQTVLLAGTFIIIFGAVLT-ALTILRPSALQRRLGQID--------REAPGRVQEET 51

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
                 +  +  +   K    K    + ++  +   AG+R+  ++ I   ++ ++     
Sbjct: 52  PHDWLRKIGQIAKPLAKASLPKDGWENSDLRARFVHAGWRAPEAIAIYFGIKTLLAAGLP 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L    +    +         +  ++    +GF  P+V +   +++RQ  I  A+PD+LD
Sbjct: 112 LLLS--LALLGRFDASHQTEYLTVLLGAALIGFYLPNVLLRLKIRRRQRDIFEAFPDSLD 169

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A+ RV E++      ++EE  L   EL     R+ A  N   RT +
Sbjct: 170 LIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYELLTLELRAGLAREKALRNLAARTGV 229

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + V      LIQ+DR+GTS+ +SLRV     R++R M AE++AA +G K+  P+I    P
Sbjct: 230 EDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERAAKIGTKILFPLIFCIFP 289

Query: 309 VLILVIIGPAILSIIDTMK 327
            L +V++GPA + ++  ++
Sbjct: 290 SLFVVLLGPAAIQVVGALR 308


>gi|225174956|ref|ZP_03728953.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169596|gb|EEG78393.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 306

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 74/312 (23%), Positives = 143/312 (45%), Gaps = 12/312 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            V +   ++   ++           E+ +R+  +   R +  +     +       R+ T
Sbjct: 4   LVNLLVFITAVLMVMLAATSLGRKHEVMERLGQI---RNMDTRPSEDDIFHRPFRERVIT 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
               +  N +  L    I    N+   L  AG     ++N LL ++++  I   +LG+ +
Sbjct: 61  PFFHNAGNALGNLAPSEIRQ--NMEKNLIYAGHPWNLTVNTLLGLQVLFGIGLPVLGLFF 118

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +       ++P    +  ++L        P+  +     +RQ  I+R+ PD LDLLL+ V
Sbjct: 119 LGIVAPEHQFPGLFALLLLVLGF----MMPNTIVKRKATERQKEIQRSLPDMLDLLLVSV 174

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G++ D AL++VA+ + G    LS E+   + E+     R  A  +  NRT +  +   
Sbjct: 175 DAGLAFDMALKKVADKMPG---ELSREIGKALDEIRMGKTRIEALRSMANRTGVPDISTF 231

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A+IQ+++ G++I  +L V  +  R  R M AE++A     K+  P++ F  P L +V+
Sbjct: 232 ISAVIQAEQLGSNIAKTLDVQANTMRQRRRMRAEEEAMRAPIKMLFPLVFFIFPALFVVL 291

Query: 315 IGPAILSIIDTM 326
           +GPA + I+ T 
Sbjct: 292 LGPAGIRIVQTF 303


>gi|87310969|ref|ZP_01093094.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
 gi|87286259|gb|EAQ78168.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
          Length = 288

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 117/244 (47%), Gaps = 4/244 (1%)

Query: 83  FVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLL 142
              +L             +L   GF S  ++++ ++ R    ++ ++  +        L 
Sbjct: 34  IEMRLLPNEEESRTYYTRRLVLGGFHSPTAISLFMLAR----LLLMVCPVFIALAIALLG 89

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
            +PF   +   + +G++G   P +W+ +  Q+RQ  ++ + PD +DL++ C+E G+   +
Sbjct: 90  IFPFHTTILVGVCLGFIGILIPELWLRSCTQQRQKRLRESLPDFVDLVVTCLEGGMGAAE 149

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSD 262
           A+  V +++      LS E+ L   + +   +   +F     RT ++ VR  +  L  S 
Sbjct: 150 AISHVHQELTSTHADLSYELGLVARDGTLGISLDKSFRRMAERTGVEEVRTLSTFLEHSQ 209

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R+G+++G+++  L    R +R   AE++A     K+ +P ++F  P + +V+ GPA + I
Sbjct: 210 RFGSAMGEAMHELSDMLRYQREQRAEERAQQASVKILIPTLLFIFPTIFVVLAGPAAIQI 269

Query: 323 IDTM 326
              +
Sbjct: 270 SGKL 273


>gi|51245380|ref|YP_065264.1| hypothetical protein DP1528 [Desulfotalea psychrophila LSv54]
 gi|50876417|emb|CAG36257.1| hypothetical membrane protein [Desulfotalea psychrophila LSv54]
          Length = 283

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 70/223 (31%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 103 RAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
           + AG     SL    ++R  + ++ L+L  I    +        +  +   I  G  G+ 
Sbjct: 60  QRAGIYDSTSLRSYQLLRYFLLVLPLLLLTI---SHVVGFRTFTERLLAFAIFAGIFGYF 116

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P   +      R+  + R +PDA+DLL++CVE+G+ ID A+RRVA++I   S  L++E 
Sbjct: 117 LPVFRLKIRGHYRRKELDRTFPDAIDLLMVCVEAGMGIDSAIRRVAQEIHITSPELAKEF 176

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +   EL     R    +N   RT +  + N    LIQ+ +YGT + ++LR+   E R +
Sbjct: 177 KILSLELKTGKPRNECLKNLAKRTNLRDIDNLVSLLIQAQKYGTGVANALRIHAEEMRQK 236

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           R    E+ AA L  KL +P+I F  P L LVI+GPA++ +   
Sbjct: 237 RYSRLEEMAAKLPVKLVIPLIFFIFPALFLVILGPAMIRVFRV 279


>gi|253701804|ref|YP_003022993.1| type II secretion system protein [Geobacter sp. M21]
 gi|251776654|gb|ACT19235.1| type II secretion system protein [Geobacter sp. M21]
          Length = 302

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 75/317 (23%), Positives = 143/317 (45%), Gaps = 16/317 (5%)

Query: 12  TELAVAITTAVSIFSLIYAV-VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
               +  +  VS+  +   +          + +R++      +  +     S        
Sbjct: 1   MLYLLVFSVFVSVLLVSAILCYYAFFSKSAVAQRLEEFFPRPQSAKTGMAPSG------- 53

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                 +  L    +K+ L      + +   L AAGFR + +    L  +L++  +  ++
Sbjct: 54  ----TWAYKLARIGEKVKLPQKEESKYVKA-LVAAGFR-KDAFYRFLGAKLLLAGVLPLI 107

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++ +        +     + A    G +G+ AP+ W+   V+ RQ  I    PD LDL+
Sbjct: 108 YLLAV--ATPTRTFFTTQTLLATAFFGIIGYLAPTYWLHLKVKARQLEIFHTLPDILDLV 165

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +CVE+G+S+D AL R  E    +  PL+ E+     E+     R  + ++   RT+++ 
Sbjct: 166 TLCVEAGLSMDAALIRTTETPQFRDNPLAIEIRQVTMEVRAGKPRVESLKDMALRTRVED 225

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           + + T  + Q++R+GTS+  +LR    E R++R   AE+ AA    KL  P+I+F  P L
Sbjct: 226 IGSFTTMVTQAERFGTSLSHALRTFSDELRTKRRQTAEEAAAKTTIKLIFPLIMFIFPAL 285

Query: 311 ILVIIGPAILSIIDTMK 327
           ++VI+GPA++ I    +
Sbjct: 286 LVVILGPAVVQISRIFQ 302


>gi|197118215|ref|YP_002138642.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197087575|gb|ACH38846.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 304

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/314 (21%), Positives = 134/314 (42%), Gaps = 13/314 (4%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +      SIF+ +  ++   L           +   +E +R++    + +    +     
Sbjct: 1   MLALITASIFASVTVLIGVLLYP---------LLSRQESVRQRLTKLMPQQEEEAPPLVP 51

Query: 76  DSKSLRNFVKKLNLKAILVDENIV--NKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                +  + +L +K  +   ++    +   A    + ++ + L  +L   + FL+    
Sbjct: 52  TPTKWQRTLSELGIKQQIRPADLRTYREAVTAAGFKKEAVYVFLGAKLF--LAFLLPAGY 109

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +            + +         G+  P++W+      R+++I  A PD LDLL +C
Sbjct: 110 LMLFALPRGTMASSISILVATACAVAGYLLPTIWLDRRAGVRKTAIFHALPDVLDLLTVC 169

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D A+ + AE+   ++ PL  E    I E+     R  A +    RT +D ++ 
Sbjct: 170 VEAGLGLDAAIIKTAENFQEKNCPLIAEFNAVILEIRAGRPRSEALKGLAERTTLDDIKA 229

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               LIQ+++ GTS+G +LR+     R++R   AE++AA    K+  P+     P  ++V
Sbjct: 230 LVSMLIQTEKLGTSLGKTLRIYSDSLRTKRKQLAEERAAKTAVKMLFPLTFCVFPAFMVV 289

Query: 314 IIGPAILSIIDTMK 327
           ++ PA   I    K
Sbjct: 290 LLVPAFFRIFQMFK 303


>gi|320101695|ref|YP_004177286.1| type II secretion system F domain-containing protein [Isosphaera
           pallida ATCC 43644]
 gi|319748977|gb|ADV60737.1| Type II secretion system F domain protein [Isosphaera pallida ATCC
           43644]
          Length = 318

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/320 (22%), Positives = 144/320 (45%), Gaps = 6/320 (1%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                +   +   V++   +  V + ++ + + + R+  +    +    +     ++   
Sbjct: 4   LSPEMMTTVVQLVVALCGALAVVGLMTMLAPKEKDRLGELLKRDKAGPSRLAE--ERAKK 61

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            +    +    +   + K +  +      I   L  AGFRS  +++I + V+    +IF 
Sbjct: 62  KNEEVKKKIAKVVEEIGKNSAASEKDMSQIKLDLINAGFRSPNAVSIFMGVK----LIFF 117

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +  +  +              +  + +   +G  APS ++  L  +RQ  I    PDALD
Sbjct: 118 LTSVAVVVPLVYTNYGFTTTGILYMAIGAAIGMIAPSFFLGYLKSRRQEQIFLTLPDALD 177

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+++CVE+G+ +D A  R+A ++   +  L EE  +   ++     R+    +   RT +
Sbjct: 178 LMVVCVEAGLGLDAAFNRIASELQTAAPVLCEEFAIANFQIRMGRPRREVLRDLGVRTGV 237

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R     LIQ++R+G+SI  +LRV     R +R   AE+KAA    KL  P+++F  P
Sbjct: 238 ADLRALAAVLIQAERFGSSIASALRVQSDSMRIKRRQIAEEKAAKTAVKLLFPLVLFIFP 297

Query: 309 VLILVIIGPAILSIIDTMKD 328
            + +V++GPA +SI   +  
Sbjct: 298 GIFVVLVGPAAISIKQNLVQ 317


>gi|197117442|ref|YP_002137869.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197086802|gb|ACH38073.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 302

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 75/317 (23%), Positives = 145/317 (45%), Gaps = 20/317 (6%)

Query: 16  VAITTAVSIFSLIYAVV-----IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           +      S+F+ +  V              + +R++      +  +   + S        
Sbjct: 1   MLYLVVFSVFASVLLVSAILCHYAFFSKSAVAQRLEEFFPRPQSAKTGMVPSG------- 53

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                 +  L    +K+ L      + +   L AAGFR + ++   L  +L++  +  ++
Sbjct: 54  ----TWAYKLAKIGEKVKLPQKEESKYVKA-LVAAGFR-KDAVYRFLGAKLLLAGVLPLI 107

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++ +    +   +     + A      +G+ AP+ W+   V+ RQ  I    PD LDL+
Sbjct: 108 CLLAVATTSR--TFFTTQTLLATAFFSIIGYLAPTYWLHLKVKARQLEIFHPLPDILDLV 165

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +CVE+G+SID AL R  E    +  PL+ E+     E+     R  + ++   RT+++ 
Sbjct: 166 TLCVEAGLSIDAALIRTTETPQFRDNPLAIEIRQVTMEVRAGKPRVESLKDMAVRTRVED 225

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           + + T  + Q++R+GTS+  +LR    E R++R   AE+ AA    KL  P+I+F  P L
Sbjct: 226 IGSFTTMVAQAERFGTSLSHALRTFSDELRTKRRQMAEEAAAKTTIKLIFPLIMFIFPAL 285

Query: 311 ILVIIGPAILSIIDTMK 327
           ++VI+GPA++ +    +
Sbjct: 286 LVVILGPAVVKLGKIFQ 302


>gi|307294432|ref|ZP_07574276.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880583|gb|EFN11800.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 322

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 73/319 (22%), Positives = 147/319 (46%), Gaps = 8/319 (2%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
             +       +     ++I +L++ +    + +  +  R+  V       +  Q    ++
Sbjct: 4   TAIMIQLRPFILGLLFIAIVALVFGLSEIVMRNARVRSRLDIVGDAGGAAQGSQTLRGER 63

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           +    +      + +   +   N      +  +  +L AAG+ S  +  +    RLV+  
Sbjct: 64  NDGEWKKLVDRIEKMGISLVDTN------NAGLRRRLIAAGYMSPEAPKLFTFFRLVLTF 117

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
               + ++      +              L+  +G   P+++IS    +RQ +I   +PD
Sbjct: 118 ALPAIFVVMALSKAEPP--SALKLYFIASLLAVLGLYLPNLFISAKAARRQEAIVHGFPD 175

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDL+L+CVE+G+ ++ A+ RV  ++      +S  +   + EL    +RQ A     + 
Sbjct: 176 ALDLMLVCVEAGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGRSRQDALRRMADD 235

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +D +R+    LIQSD+ G+S+G +LR+  +E R +R M AE+KA  L   L+VP++  
Sbjct: 236 VDVDEIRSFATLLIQSDQLGSSVGQTLRIYAAEMREKRRMRAEEKAHRLPVLLSVPLVAC 295

Query: 306 FLPVLILVIIGPAILSIID 324
            LPV+I V++ PA++ ++ 
Sbjct: 296 MLPVMIGVLMLPAVVRVVR 314


>gi|103488240|ref|YP_617801.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98978317|gb|ABF54468.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 326

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 79/316 (25%), Positives = 146/316 (46%), Gaps = 7/316 (2%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             L   +   V + SL+Y  V   L    +  R+     E   L            A+  
Sbjct: 11  LRLGFLVLLFVIVSSLVYFGVRLILSRRVILSRL-----ESPALPGSHRDDSDGLRAADV 65

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                +K      +          + +  ++ AAG+RS ++  I  ++RL   +IF +  
Sbjct: 66  RSGAWAKLAATIEQSGLSLGDSNPQGLRRRMLAAGYRSPHAPKIYTLLRL--ALIFALPS 123

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            + +            +       +  +G   PS++++    +R+  I   +PD LDL+L
Sbjct: 124 ALVLPQLLSETPVDLFMLYLQGAGLALMGLVIPSLFLTAKADRRRQEILNGFPDCLDLML 183

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CVE+G+ ++ AL RV  ++      ++E++  T  EL    +R+ A     +R+ +D +
Sbjct: 184 VCVEAGMGLEAALDRVGREMTLSHPLVAEQISQTTLELRAGASREEALRALADRSGVDEI 243

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R     LIQSD+ G+SI  +LR+  +E R +R M AE+KA  L   L++P++   LPV+I
Sbjct: 244 RAFATLLIQSDKLGSSIATTLRIYAAEMREKRRMRAEEKAHRLPVLLSIPLVACMLPVMI 303

Query: 312 LVIIGPAILSIIDTMK 327
            V++ PA++ +I  + 
Sbjct: 304 GVLMLPAVIRVIRDIA 319


>gi|167840869|ref|ZP_02467553.1| hypothetical protein Bpse38_29619 [Burkholderia thailandensis
           MSMB43]
          Length = 279

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 81/261 (31%), Positives = 133/261 (50%), Gaps = 3/261 (1%)

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
            A   +       +   + +L+L      +  +  +L  AG+RS  + ++    + V+ +
Sbjct: 14  PAPPAVWVEKLAEISQPISRLSLPKSGWENSPLRLRLINAGWRSPGAAHLYFAAKTVLAL 73

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
               +     F     L          V+LIG  GF  P+  +S  ++ RQ  I   +PD
Sbjct: 74  TLPAVA--MPFMIGTALGDNPYAVSAMVLLIGGFGFYLPNAMLSRHIRLRQRKIIEDFPD 131

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     +  A  N   R
Sbjct: 132 ALDLLTVCVEAGLGLDAALTKVADELRLRSPIVADELGLMLLEIRSGFAKDAALRNLALR 191

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T  + V      LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I  
Sbjct: 192 TGAEDVDAFCAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIFC 251

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L+ V++GPA + I  T+
Sbjct: 252 IFPALLTVLLGPAFIHIYRTL 272


>gi|325111219|ref|YP_004272287.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324971487|gb|ADY62265.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 461

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 120/249 (48%), Gaps = 4/249 (1%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
            +    +  +  ++    + +  +L  AG+ + ++   L  VR +  ++ L++  + +  
Sbjct: 197 GTATPALAAMLPESESRRDALKQELVEAGYYNPHAYENLAAVRYLGLMLPLLIFGVLLVF 256

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
               LE    + +  +I+   +G+  P + +     KR+  I++A PD +DLL +CV  G
Sbjct: 257 GPPQLE---PVMLVLMIVGAVLGWSIPRLLVRQRAAKRRREIEQALPDVIDLLNMCVSQG 313

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +++  AL RV+ +I      ++EE+ +   + +     + A  N   R  +  + + T  
Sbjct: 314 MTLRPALARVSWEISDTYPAMAEELRIVAEQANLG-TLEHALNNMNERVDVPELHSLTTL 372

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LIQ++R GT++ DSL       R+     A++KA +   KL  P ++  +P +   ++GP
Sbjct: 373 LIQTERMGTNVSDSLTEYSDGMRATLQQRADQKANAATFKLLFPTVLCLMPAVYFFLLGP 432

Query: 318 AILSIIDTM 326
           A++ + D  
Sbjct: 433 AVVELSDFF 441


>gi|188586923|ref|YP_001918468.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351610|gb|ACB85880.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 317

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 68/320 (21%), Positives = 137/320 (42%), Gaps = 18/320 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           L + +T    +  +   +         E + R+  +    +           +      L
Sbjct: 5   LMLYLTITACMTGIFLNMYQFLFRKRIETKNRLSKLNELTDGSAGSGFEHTPRTPLQKAL 64

Query: 73  RTRDSKSL------RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
                + +      +       L    V       + +AG     +   LL    ++  +
Sbjct: 65  ALPVHRRVVLPLFHKLTAFLEKLLPHKVFTGFKKDIISAGLSQHLNATELLAAYFLIICL 124

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
            L++ + ++              V   +++  +GF  P +W+S+ V  R++ I+RA P+ 
Sbjct: 125 GLVMAVFFVTFLST--------PVWTGMVLVILGFIGPKLWLSSKVNTRKNEIQRALPEF 176

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LDLL + VE+G+  + +L++VAE     + PL+ E+     E+S   +R+ A  +   R 
Sbjct: 177 LDLLTVSVEAGLGFESSLKKVAE---EGTGPLAVEIKRVTQEISMGKSRKEALIDLKERI 233

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +  +     A+IQ+++ G  I   L+V   E R +R   AE++A     KL +P+I+F 
Sbjct: 234 DLQDLSTFINAIIQAEQLGVGISRVLKVESKEFRRKRRQRAEEQAMKAPVKLLIPLILFI 293

Query: 307 LPVLILVIIGPAILSIIDTM 326
            P + ++++GPA L I+D +
Sbjct: 294 FPTIFIILLGPAALRIMDNL 313


>gi|296156494|ref|ZP_06839332.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893093|gb|EFG72873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 318

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 79/305 (25%), Positives = 144/305 (47%), Gaps = 2/305 (0%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLR 81
           +++  +++ +V  +        R   V    E L +  + S     A        +K   
Sbjct: 6   IAMLGVMFLIVFGAALKAMTLLRPDPVQRRIEELAQPGVASEADAGAEKNWVETVTKVSE 65

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
              +    K       +  +   AG R+  +  I    + V+ +    + +I+     + 
Sbjct: 66  RVARLSLPKEDWDKSALRLRFANAGIRTPSAPAIYFAAKTVLALSLPAVALIFFGNAFEA 125

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
            +      +  V+    +GF  P++ ++ LV+ RQ  +    PDALDL+ +CVE+G+ +D
Sbjct: 126 DQR--IYLLLTVLAASALGFYLPNLVMTRLVESRQRKLFEDLPDALDLMTVCVEAGLGLD 183

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            A+ RV ++IG +S  L +E  + + EL     R  A  N   RT ++ +      LIQ+
Sbjct: 184 AAMMRVTQEIGVKSHALKDEFDMVLLELRAGSGRDKALRNLSLRTGVEDIDTLAAMLIQA 243

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           DR+GTS+GDSLRV     R++R + AE+ AA +  KL  P++ F  P L+ V++GP+ + 
Sbjct: 244 DRFGTSVGDSLRVYTDNLRTKRRLRAEELAAEIALKLLFPLMFFIFPTLLAVLVGPSAIQ 303

Query: 322 IIDTM 326
           I+  +
Sbjct: 304 IVRQL 308


>gi|149178503|ref|ZP_01857091.1| type II secretion system protein [Planctomyces maris DSM 8797]
 gi|148842618|gb|EDL56993.1| type II secretion system protein [Planctomyces maris DSM 8797]
          Length = 334

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 58/312 (18%), Positives = 122/312 (39%), Gaps = 13/312 (4%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
                  V+ F L+  V+     +     R             +   S   +  ++  +T
Sbjct: 1   MFIELVTVATFLLVCFVIFLIGDAISAGHRT-----------GRNKNSKYDERGANYYKT 49

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                    +  +  ++      I   L+ AG+    +L   L  R  + ++ +++G   
Sbjct: 50  SKVGVFSRALAGVIPQSSQEISKIELDLKRAGYYRSTALVEYLATR-NMLVVLVLIGTGV 108

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                       ++ + A +LI   G+  P + + N   +R   I+R  PDALDL+++C+
Sbjct: 109 GCVLADPGSNLPEIILIAGLLIAGAGYGLPRIVLQNQANRRVHRIQRGLPDALDLVMMCL 168

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
             G+ +  AL RV +++      ++ E  +         +   A + F  R     V   
Sbjct: 169 TGGVPLRTALERVTDEVRFSHPDIAVEFEIIRRHADAN-SMADALKQFAKRIDAPDVNAL 227

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           +  + Q++R GT++  +L       R +    AE+ ++    KL  P+I    P + ++ 
Sbjct: 228 SLMISQTERLGTNVSTALIDFADGVRRKYRQRAEENSSKTSIKLLFPIIFCMAPPIYILF 287

Query: 315 IGPAILSIIDTM 326
            GPA+L + + +
Sbjct: 288 FGPAVLELRNFL 299


>gi|167566943|ref|ZP_02359859.1| type II secretion system protein [Burkholderia oklahomensis EO147]
 gi|167574012|ref|ZP_02366886.1| type II secretion system protein [Burkholderia oklahomensis C6786]
          Length = 318

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 82/321 (25%), Positives = 149/321 (46%), Gaps = 10/321 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +  + T+L +       + + + A        G         A   E +    + +   
Sbjct: 1   MENLNVTQLLLLFGLFAIVVAGVMAAWFAFAPRG--------FARRLEQIGGGAVAAGDG 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
            +  +    + ++  R   K    K+   +  +  +L  AG+RS  +  +    + V+ +
Sbjct: 53  PAPQTVWIEKLAEISRPISKLSLPKSGWENSPLRLRLINAGWRSASAAPLYFAAKTVLAL 112

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                     F     L     +    ++ IG  GF  P+  +S  +  RQ  I   +PD
Sbjct: 113 ALPA--AAMPFLIGTELADSPYILSVMLVTIGAFGFYLPNAVLSRRIASRQRVIVEDFPD 170

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +C+E+G+ +D  L +VA+++  +S  +++E+ L + E+    +++ A  N   R
Sbjct: 171 ALDLLTVCIEAGLGLDAGLMKVADELRLRSPVVADELGLMLLEMRSGFSKETALRNLALR 230

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T  + +   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I  
Sbjct: 231 TGAEDIDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIFC 290

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L+ V++GPA + I  T+
Sbjct: 291 IFPALLTVLLGPAFIHIYRTL 311


>gi|167579124|ref|ZP_02371998.1| type II secretion system protein [Burkholderia thailandensis TXDOH]
          Length = 319

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 83/322 (25%), Positives = 150/322 (46%), Gaps = 11/322 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +  +   + + +     + + + A  +     G        +A   E +      +   
Sbjct: 1   MENLNVMHILLLLGLFAIVVASVMATWLAFAPRG--------LARRLEQIGGAGAVAAGD 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             A   +       +   + KL+L      +  +  +L  AG+RS  + ++    + V+ 
Sbjct: 53  SPAPPAVWVEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPSAAHLYFAAKTVLA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +          F +   +          ++LIG  GF  P+  ++  +  RQ  I   +P
Sbjct: 113 LALPA--AAMPFLFGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIASRQRMIIEDFP 170

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   
Sbjct: 171 DALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKEAALRNLAL 230

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 231 RTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIF 290

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+ V++GPA + I  T+
Sbjct: 291 CIFPALLTVLLGPAFIHIYRTL 312


>gi|317123667|ref|YP_004097779.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315587755|gb|ADU47052.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 306

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 75/317 (23%), Positives = 133/317 (41%), Gaps = 17/317 (5%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            A+        AV++F L+ A+   S G   + K +  +          +     KD   
Sbjct: 1   MASVYIGVGLIAVAVFGLVLALSFGSGGPTGVAKSLAMIEGVVTQRSAVKTELDAKDRLV 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
             +  R  +          L      + +   L  AG  S ++   ++  + V  +I L+
Sbjct: 61  EPIFNRAQRIA------TVLSPQGTSDRLARGLERAGNPSPWTAERVMGAKGVALLIGLL 114

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           LG+ +     +             +  G   F  P++ + N   +RQ  +     +ALD+
Sbjct: 115 LGVAYGGFSLR--------GFVFALGFGGAAFWLPNLLVYNAALRRQEQVATGLAEALDM 166

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L +CVE+G   D AL +VA        P+S E    ++E+    +R  AF    +R  + 
Sbjct: 167 LTVCVEAGQGFDAALVQVAR---STDGPISGEFARVLSEVQIGKSRSEAFAGLGDRVSLS 223

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V+N   A+IQ+D+ G  I   LR   +  R  R   AE+KA  +  K+  P+++   P 
Sbjct: 224 DVKNFVSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVTVKILFPLLLCIFPA 283

Query: 310 LILVIIGPAILSIIDTM 326
           + +VI+GP I+ +I T+
Sbjct: 284 MFVVILGPGIIRMITTL 300


>gi|167617239|ref|ZP_02385870.1| type II secretion system protein [Burkholderia thailandensis Bt4]
 gi|257141112|ref|ZP_05589374.1| type II secretion system protein [Burkholderia thailandensis E264]
          Length = 319

 Score =  142 bits (358), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 83/322 (25%), Positives = 149/322 (46%), Gaps = 11/322 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +  +   + + +     + + + A  +     G        +A   E +      +   
Sbjct: 1   MENLNVMHILLLLGLFAIVVASVMATWLAFAPRG--------LARRLEQIGGAGAVAAGD 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             A   +       +   + KL+L      +  +  +L  AG+RS  + ++    + V+ 
Sbjct: 53  SPAPPAVWVEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPSAAHLYFAAKTVLA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +          F     +          ++LIG  GF  P+  ++  +  RQ  I   +P
Sbjct: 113 LALPA--AAMPFLIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIASRQRMIIEDFP 170

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   
Sbjct: 171 DALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKEAALRNLAL 230

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 231 RTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIF 290

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+ V++GPA + I  T+
Sbjct: 291 CIFPALLTVLLGPAFIHIYRTL 312


>gi|197106463|ref|YP_002131840.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
 gi|196479883|gb|ACG79411.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
          Length = 320

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 108/311 (34%), Positives = 161/311 (51%), Gaps = 8/311 (2%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           AVA+   V+ F  I AV+        + +R +S A  R  LR   +            R 
Sbjct: 15  AVALAVGVANFLAILAVLRALSPKDLVRERARSHARRRNDLRAALL------QPRRGARP 68

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R     R  V+ L L            L  AG+RS  ++++ L ++++ P+         
Sbjct: 69  RSVGLARRLVELLKLNRDGRAGGAAALLVQAGWRSPDAMHVFLALKVLAPLALAAAAW-- 126

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +     L +     R+ A +     G   P + + N +QKR   I+RA PDALDL +IC 
Sbjct: 127 LLAPGVLHDDDPLRRLAATLGGAVAGLYLPRLMLKNAIQKRSLKIQRALPDALDLFVICA 186

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+S+D AL RV+ +IG  +  L++E+ LT  EL FLP+R+ A  N   R     VR  
Sbjct: 187 EAGLSLDAALARVSREIGPAAPELADELGLTAVELGFLPDRREALLNLTRRVAAPQVRGL 246

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L+Q+++YGT +  +LRVL +E R  R+M+AE+KAA L   LTVPMI F LP L +V+
Sbjct: 247 VNTLVQTEKYGTPLAQALRVLAAEFRDTRMMKAEEKAARLPATLTVPMIAFILPPLFVVL 306

Query: 315 IGPAILSIIDT 325
           IGPAI+ ++ T
Sbjct: 307 IGPAIVQVLTT 317


>gi|261252092|ref|ZP_05944665.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
 gi|260935483|gb|EEX91472.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
          Length = 314

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 81/309 (26%), Positives = 134/309 (43%), Gaps = 11/309 (3%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
               +  LI  V+I    S  L      +      L+        K  +      R  KS
Sbjct: 17  AFFLVIVLIATVLIIFTISLLLLSSKSPLKSRLARLKDATRADTLKKGS------RLEKS 70

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           L +    +        E+I  KL  AG+    +L     ++ V  ++  ++     F   
Sbjct: 71  LESLAPAMKSSNSKESESIRVKLMHAGYHDASALTFFYAMKGVSMVVGFLMAAGIYFFAP 130

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
           ++      +R  A+I     G   P+V +S +V KRQS I+   PDALDLL++C ESG+ 
Sbjct: 131 EMS-----MRNIAMIGSVAFGLYCPNVVLSMMVDKRQSRIRSGIPDALDLLVVCTESGLG 185

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
            + ALRRVA+++       ++E+     ++S       AF +   RT +  +      L 
Sbjct: 186 FNAALRRVADELTISHPDFADELDTVCVKISAGVEMSDAFNDLIKRTGLSEIAGLVTMLA 245

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
            + R G S+  +LR    + R +R  E E+ AA +  K+  P++IF  P   +V IGP++
Sbjct: 246 HASRIGGSLSQTLREYTEDYRDKRNQEIEEIAAKIPTKMIFPLLIFIWPCFFIVAIGPSM 305

Query: 320 LSIIDTMKD 328
           L    TM +
Sbjct: 306 LLFTSTMGN 314


>gi|221067370|ref|ZP_03543475.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712393|gb|EED67761.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 303

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 76/312 (24%), Positives = 142/312 (45%), Gaps = 19/312 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L VA+ T  S+     A+          E+R++ ++                   S    
Sbjct: 2   LIVALLTFASLMLAAGALFFWVT-PTVTEQRLQELS---------------PAPLSGSWT 45

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K +  F    +  A      +  +   AG R E +  +    + ++P++ +    +
Sbjct: 46  ETAVKLVGPFAHLSSPTAGSDATPLRLRFLNAGIRHENAPLLYFGAKTLLPLVMM---FL 102

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                           +   ++ G V    P++ +  +  +R+  I   +PDA DL+L+C
Sbjct: 103 VYSLMLAQGTTDSLQLLLYPLVTGLVACYLPNLVLRWMAARRKREIFENFPDAADLMLVC 162

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D AL +V  +I  +S  L++E+  T  E+     R+ +  N   RT +D +  
Sbjct: 163 VEAGMGLDAALGKVTAEIRIKSEALAQELHWTNLEMRAGSTREKSLRNLAARTGVDEIHA 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  L Q+DR+GTSIGDS+RV   + R +R M AE+ AA +  K+ +P++    P +++V
Sbjct: 223 FTAMLTQADRFGTSIGDSIRVFSDDLRHKRQMRAEELAAKIPTKMLLPLVTCIFPAIVMV 282

Query: 314 IIGPAILSIIDT 325
           ++GPAI+ ++  
Sbjct: 283 VLGPAIIRLLRM 294


>gi|53723215|ref|YP_112200.1| hypothetical protein BPSS2198 [Burkholderia pseudomallei K96243]
 gi|76819357|ref|YP_336475.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|126455503|ref|YP_001076997.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167744183|ref|ZP_02416957.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167821382|ref|ZP_02453062.1| type II secretion system protein [Burkholderia pseudomallei 91]
 gi|167829724|ref|ZP_02461195.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167851191|ref|ZP_02476699.1| type II secretion system protein [Burkholderia pseudomallei B7210]
 gi|167899821|ref|ZP_02487222.1| type II secretion system protein [Burkholderia pseudomallei 7894]
 gi|167916485|ref|ZP_02503576.1| type II secretion system protein [Burkholderia pseudomallei 112]
 gi|167924342|ref|ZP_02511433.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
 gi|217424204|ref|ZP_03455703.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226194113|ref|ZP_03789713.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237510430|ref|ZP_04523145.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254182575|ref|ZP_04889169.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|254187127|ref|ZP_04893642.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254192523|ref|ZP_04898962.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254296491|ref|ZP_04963947.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52213629|emb|CAH39683.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76583830|gb|ABA53304.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Burkholderia pseudomallei 1710b]
 gi|126229271|gb|ABN92684.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157806389|gb|EDO83559.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934810|gb|EDO90480.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169649281|gb|EDS81974.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|184213110|gb|EDU10153.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|217392669|gb|EEC32692.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225933806|gb|EEH29793.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002635|gb|EEP52059.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 319

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 82/322 (25%), Positives = 149/322 (46%), Gaps = 11/322 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +  +   + + +     + + + A  +     G        +A   E +      +   
Sbjct: 1   MENLNVMHILLLLGLFAIVVAGVMATWLAFAPRG--------LARRLEQIGGAGAVAAGD 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             A   +       +   + KL+L      +  +  +L  AG+RS  + ++    + V+ 
Sbjct: 53  GRAPPAVWIEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPGAAHLYFAAKTVLA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +      +         +          ++LIG  GF  P+  ++  +  RQ  I   +P
Sbjct: 113 LALPAAAM--PLLIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIAARQRMIVEDFP 170

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   
Sbjct: 171 DALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKETALRNLAL 230

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 231 RTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIF 290

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+ V++GPA + I  T+
Sbjct: 291 CIFPALLTVLLGPAFIHIYRTL 312


>gi|332798625|ref|YP_004460124.1| Type II secretion system F domain-containing protein
           [Tepidanaerobacter sp. Re1]
 gi|332696360|gb|AEE90817.1| Type II secretion system F domain protein [Tepidanaerobacter sp.
           Re1]
          Length = 307

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 76/314 (24%), Positives = 132/314 (42%), Gaps = 13/314 (4%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
             A + A+ ++ LIY            +++R+  ++        Q            R  
Sbjct: 4   LFAWSGALLVYCLIYMTFTTIFSKKITMQQRLDEMSKAGNR---QVENDELNKPFEERFV 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                 + +F   L       +E +  +L+ A  R            L+   + ++  ++
Sbjct: 61  KPTLGRIISFFAVLIPVNAASEERLNQQLKQAEIRMG--AREYQAAVLLFTFVCVVGMVL 118

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +      +L     LR+   +L  Y G       +   + KR+++I    PD LDLL + 
Sbjct: 119 Y----STMLGLSVSLRILFGMLGIYAGLVLSRFDLKRNIIKRKTAIYHQLPDTLDLLSVS 174

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G+  DQAL  V E + G   PL +E+  T  E+S    R+ A E    R + D +  
Sbjct: 175 VSAGLGFDQALSYVVEHMEG---PLIQELDTTQREISMGIPRKEALERLAARCECDEIYI 231

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              A+ Q+D  G SI + +    +  R       E++A  L  K+ VPM++F LPV  ++
Sbjct: 232 FVGAINQADELGASIKNVMETQAAAIRLTHKQNVEEQAQKLSVKMMVPMVLFILPVTFII 291

Query: 314 IIGPAILSIIDTMK 327
           I+GPAI S+I  +K
Sbjct: 292 ILGPAIPSVISALK 305


>gi|149175458|ref|ZP_01854079.1| hypothetical protein PM8797T_18379 [Planctomyces maris DSM 8797]
 gi|148845726|gb|EDL60068.1| hypothetical protein PM8797T_18379 [Planctomyces maris DSM 8797]
          Length = 370

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/249 (21%), Positives = 115/249 (46%), Gaps = 4/249 (1%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
            S    + ++  ++         +L+AAG+   ++L+    +R +  +  L+     +  
Sbjct: 105 GSATPALAEMMPESEERRAKTKKELQAAGYYQPHALHNFSAIRFISILGTLLFFGGVLLL 164

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
             +  E P  + +  V     + +  P + +++    R+S I++  PD LD+L +CV  G
Sbjct: 165 APERFEIPILVAMLIVP---ILVWAVPFLIVTSKASDRRSEIEQGIPDMLDMLNMCVSQG 221

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +++  AL+++  ++      L+ E+ + I + S       A  NF  R  +  V +    
Sbjct: 222 MTVPHALKKIISELAKVYPALAHELKIVIEQSSIG-TFSQALSNFSKRIDVPEVHSFAAL 280

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LIQ+D+ GT++  +L+      R      A++KA     KL  P ++  +P + + ++GP
Sbjct: 281 LIQTDQMGTNVTSALQEYSDNMRESLSQRADEKANKATFKLLFPTVLCLMPAIYIFLLGP 340

Query: 318 AILSIIDTM 326
           AI+ + D  
Sbjct: 341 AIVELSDFF 349


>gi|89899611|ref|YP_522082.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89344348|gb|ABD68551.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 312

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 74/302 (24%), Positives = 140/302 (46%), Gaps = 2/302 (0%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
            + +  + +  +        +    V R+ L      +  +     R     + + R   
Sbjct: 6   LAFLALIFVVVVAGVLGVSGVMRPNVARQRLAGLVADAPPRPPIQHRWLHWIADATRPIS 65

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
           K    +      ++  +   AG R+  + +    ++ ++ +   ++    +      L+ 
Sbjct: 66  KLSMPEEGFEKSSLKLRFAHAGIRNANAASAFFGIKTLLTLGLPLVAFALLTLSGSPLKG 125

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
              L V   +    +G+  P++ +S+LV  RQ  I  ++PDALDL+ +CVE+G+  + A+
Sbjct: 126 NTLLLVMLALAA--LGYYGPNLVLSHLVMVRQREIFESFPDALDLMTVCVEAGLGTEAAM 183

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            RVA+D+  +S  L++EM L   EL     R+ A  N   RT ++ V      + Q++R+
Sbjct: 184 MRVADDLQFKSPALADEMRLVNLELRAGAVRERALRNLAIRTGVEEVDGFVTMISQAERF 243

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           GTSI  SLR+     R+ R   AE+ AA +  KL  P+I    P L++V++GPA++ I  
Sbjct: 244 GTSIAASLRIHAELLRTRRRQRAEEAAAKIALKLLFPLIFCIFPSLMVVLMGPAMIQIYR 303

Query: 325 TM 326
            +
Sbjct: 304 VL 305


>gi|219850073|ref|YP_002464506.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544332|gb|ACL26070.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 72/313 (23%), Positives = 141/313 (45%), Gaps = 10/313 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I     +  +  A++I ++      + +     +   +         +     R+  
Sbjct: 1   MMEILVLTGVLVIGAALIIIAVRQMNQSRAISERLDQYTDVSLSLEELELQQPFRERVLI 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              ++L +++ +  LK     E +   L+ AG     S N+ + +R+      L L +  
Sbjct: 61  PMFRALLSYLGRFGLKQ--NQERLRANLQMAGNPGNISPNMFIGLRM-----ALALTLAT 113

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +     +        +  V +   +G+  P +W+   +++R+ +I +A PDALDLL I V
Sbjct: 114 VIVPLVIGRLSLIQALAGVAIAFMIGYILPGIWLDRKIKERKKNILKALPDALDLLCISV 173

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G++ D AL+RVA+        LS E    + ++     R+ A  +   RT ++ V+  
Sbjct: 174 EAGLAFDLALQRVAQK---WDNELSHEFQRVLQDIRLGRTRREALRDMAARTGVEDVQTF 230

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A+IQ+D+ G S+   LR+   + R+ R   AE+ A     K+ +PM+    P L +VI
Sbjct: 231 VSAVIQADQLGVSMSKILRIQSDQLRTRRRQRAEEAAQKAPVKMLIPMVFLIFPALFVVI 290

Query: 315 IGPAILSIIDTMK 327
           +GPA+  I+  + 
Sbjct: 291 LGPAVPRIMSALG 303


>gi|330811031|ref|YP_004355493.1| type II secretion system protein; membrane protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379139|gb|AEA70489.1| putative type II secretion system protein; putative membrane
           protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 321

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 81/316 (25%), Positives = 152/316 (48%), Gaps = 14/316 (4%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
            L       VS    + A+++  LG  +  +R         ++++    +     A S L
Sbjct: 19  RLLFVTVVGVSTVLAVVALMLLMLGLQDPVQR------RLALIKRGYAGNTVGQEAPSNL 72

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           +      L    ++               L  AG+RS  ++ +   VRL++P++ + + +
Sbjct: 73  QL----LLERVGQRFASTDQAHTSATQTLLTHAGYRSASAVQMYWAVRLMLPLLMVGVAL 128

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           + +     +++    + + AV L+  +G+  P++++    Q RQ  ++ A+PDALDL+++
Sbjct: 129 LLL----PMVKVSVAIGLLAVTLVAGIGWLLPAIYVGKRKQARQGRLRAAFPDALDLMVV 184

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVESG+++   + RVAE++    V L+EE+ L  A++        A +    RT ++ ++
Sbjct: 185 CVESGLALPTTIERVAEEMSVSQVELAEELALVNAQIRAGITSTEALKQLAVRTGLEDIQ 244

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                L QS R+GTS+ D+LR+   E R  R   AE+  A +G KL  P+I    P   L
Sbjct: 245 GLVSLLAQSIRFGTSVADTLRIYADEFRDRRTQAAEEMGAKIGTKLIFPLIFCLWPSFFL 304

Query: 313 VIIGPAILSIIDTMKD 328
           V IGPA++ +     +
Sbjct: 305 VAIGPAMIGVFRAFGN 320


>gi|239908016|ref|YP_002954757.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239797882|dbj|BAH76871.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 281

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 77/270 (28%), Positives = 137/270 (50%), Gaps = 4/270 (1%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
            ++    +      +     ++   F + +  +         + L  AG+R   +L I  
Sbjct: 12  SRLKDGGRPGIFGWIEGSIRRAAAWFGELVKPREAQELTKARSSLVQAGYRQPSALEIYW 71

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
            ++    ++ L+LG +         + P Q ++  V+ +   GF  P + + + V+ RQ+
Sbjct: 72  GIKAGAALVGLVLGALAAMS----GKVPGQYKLFVVVGLTAAGFYIPGMILDSRVKARQT 127

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           +I+++ PDALDLL++CVE+G+ +D A+ RV +++  +   LS E+ L   EL     R+ 
Sbjct: 128 AIQKSLPDALDLLVVCVEAGMGLDAAIYRVCQEMSLKDPILSAELRLLTLELRAGKARRE 187

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           A +N   R  ++ V +    LIQ+D +GTSI  +LRV     R++R   AE+ AA L  K
Sbjct: 188 ALKNLSARIGLEDVGSLVAMLIQTDMFGTSIAQTLRVYADSMRTKRFQLAEELAAKLPVK 247

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           L +P+I F  P L++VI+GPA + I     
Sbjct: 248 LLMPLIFFIFPTLLIVILGPAGIRIFQMFG 277


>gi|116623251|ref|YP_825407.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226413|gb|ABJ85122.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 304

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 75/313 (23%), Positives = 126/313 (40%), Gaps = 16/313 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +  A+T A+ +                  + +  +A      R +           SR+ 
Sbjct: 1   MLEAMTAAIFVLVAGGTAWAALRAGSWRVRGVTRLAPAAGTARVRVSPGALWGRLVSRIG 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           T                       +  +L  AGFR   +      +RLV  +      ++
Sbjct: 61  TAL------------PTPARELPRLKRQLVRAGFRGPGAARHFQGIRLVATLGCGAGALL 108

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
               +    +  F     +       G+ AP  ++   V +R+ +I+R  P+ LDL+++C
Sbjct: 109 GASQWHAASDNVF----WSAAAGIAFGYLAPMQYVQFCVGRRRKAIERGLPNTLDLMVVC 164

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+ IDQ   +VA+++      +  E  +   EL     R  A  N   RT +D V+ 
Sbjct: 165 VESGLGIDQTTLQVAKELHWAHPEICAEFTVMNLELRAGIRRAEALHNLAERTGVDDVKK 224

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L+Q+DR+GTSI  SLR      R+     AE++A+ L  KL  P+    LP L +V
Sbjct: 225 LVAVLVQTDRFGTSIAQSLRGHAEYLRTMARQRAEERASKLAVKLVFPIFFCVLPSLFVV 284

Query: 314 IIGPAILSIIDTM 326
            IGP I  ++  +
Sbjct: 285 TIGPVITRLVREL 297


>gi|126443620|ref|YP_001064084.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|167908138|ref|ZP_02495343.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
 gi|126223111|gb|ABN86616.1| type II secretion system protein [Burkholderia pseudomallei 668]
          Length = 319

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 82/322 (25%), Positives = 149/322 (46%), Gaps = 11/322 (3%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            +  +   + + +     + + + A  +     G        +A   E +      +   
Sbjct: 1   MENLNVMHILLLLGLFAIVVAGVMATWLAFAPRG--------LARRLEQIGGAGAVAAGD 52

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             A   +       +   + KL+L      +  +  +L  AG+RS  + ++    + V+ 
Sbjct: 53  GRAPPAVWIEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPGAAHLYFAAKTVLA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +      +         +          ++LIG  GF  P+  ++  +  RQ  I   +P
Sbjct: 113 LALPAAAM--PLLIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIAARQRMIVEDFP 170

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   
Sbjct: 171 DALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKETALRNLAL 230

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I 
Sbjct: 231 RTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIF 290

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+ V++GPA + I  T+
Sbjct: 291 CIFPALLTVLLGPAFIHIYRTL 312


>gi|167725257|ref|ZP_02408493.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 275

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 76/270 (28%), Positives = 136/270 (50%), Gaps = 2/270 (0%)

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNIL 116
              + +    +  +    + ++  +   K    K+   +  +  +L  AG+RS  + ++ 
Sbjct: 1   AGAVAAGDGRAPPAVWIEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPGAAHLY 60

Query: 117 LVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQ 176
              + V+ +      +         +          ++LIG  GF  P+  ++  +  RQ
Sbjct: 61  FAAKTVLALALPAAAM--PLLIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIAARQ 118

Query: 177 SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQ 236
             I   +PDALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++
Sbjct: 119 RMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKE 178

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            A  N   RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  
Sbjct: 179 TALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIAL 238

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           KL  P+I    P L+ V++GPA + I  T+
Sbjct: 239 KLLFPLIFCIFPALLTVLLGPAFIHIYRTL 268


>gi|114800177|ref|YP_759874.1| putative Flp pilus assembly protein TadC [Hyphomonas neptunium ATCC
           15444]
 gi|114740351|gb|ABI78476.1| putative Flp pilus assembly protein TadC [Hyphomonas neptunium ATCC
           15444]
          Length = 310

 Score =  140 bits (352), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 78/313 (24%), Positives = 150/313 (47%), Gaps = 3/313 (0%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
             A+ ++  +   +   +   L    L   ++S     +I R+         + + R  +
Sbjct: 1   MPALLSSGPVIPFVLGFLALLLAVPGLISFLRSRQDAGDIERRLSRRPGTGAAEAKRSES 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           +  K++                    KL  AGF    ++    + R +  +I  +     
Sbjct: 61  KLGKAVMGIADNAAPTDGAEVSAARAKLNQAGFTGAKAVPRYFLARFICVVIPQVA---L 117

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
            F    L EYP  + V A I++   G  AP  ++   + +R+ +    +PD +DL++ CV
Sbjct: 118 FFALPYLQEYPRYVPVMASIILVLAGLAAPGKFLDMRISQRKQACSSGFPDMMDLMVACV 177

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G+S+D +++RV E++  +   ++  M     EL    +R++A+  F  R  +D   + 
Sbjct: 178 EAGLSLDASVQRVGEELELRHPIIAGHMRTLSLELRAGKSRKMAWRAFAERLGIDEAGSL 237

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L Q++  GTS+G +LRV  ++ R  R++ AE+KA +L  K+T+P+IIF  PVL+ V+
Sbjct: 238 ATMLRQAEEMGTSLGQTLRVFSADMRQRRILMAEEKAMALPAKMTLPLIIFVFPVLLGVL 297

Query: 315 IGPAILSIIDTMK 327
           I PA++ ++ T+ 
Sbjct: 298 ILPAVVMLMTTLG 310


>gi|83718164|ref|YP_440464.1| hypothetical protein BTH_II2276 [Burkholderia thailandensis E264]
 gi|83651989|gb|ABC36053.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 296

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 81/282 (28%), Positives = 139/282 (49%), Gaps = 3/282 (1%)

Query: 46  KSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRA 104
           + +A   E +      +     A   +       +   + KL+L      +  +  +L  
Sbjct: 10  RGLARRLEQIGGAGAVAAGDSPAPPAVWVEKLAEISQPISKLSLPKSGWENSPLRLRLIN 69

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG+RS  + ++    + V+ +          F     +          ++LIG  GF  P
Sbjct: 70  AGWRSPSAAHLYFAAKTVLALALP--AAAMPFLIGTAIADSPYSVSAMLVLIGAFGFYLP 127

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           +  ++  +  RQ  I   +PDALDLL +CVE+G+ +D AL +VA+++  +S  +++E+ L
Sbjct: 128 NAMLARRIASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGL 187

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + E+     ++ A  N   RT  + V   +  LIQ+DR+GTSIG SLRVL    R++R 
Sbjct: 188 MLLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRR 247

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           M AE++AA +  KL  P+I    P L+ V++GPA + I  T+
Sbjct: 248 MRAEERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTL 289


>gi|163757631|ref|ZP_02164720.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
 gi|162285133|gb|EDQ35415.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
          Length = 336

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 56/320 (17%), Positives = 125/320 (39%), Gaps = 20/320 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D   +A+    A+S  +L Y V+   +      +         E  R +   +  + + 
Sbjct: 4   LDTVVVAIIGLAALSAGALGYGVLYSRIEGDRKAENRVKRVKAAETDRSKASAARDRLAE 63

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +++ R     SL+   +K           + +K+  AG    +SL    ++ LV+ ++  
Sbjct: 64  ANKRRKSVQDSLKTLDEKNKENDKKTSPPLKDKIGQAGLP--FSLGQFYMISLVLGLVAG 121

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++G +                + A  +    G   P   +  L  +R  +    +P+ALD
Sbjct: 122 LVGFVAYGS-----------PLVAAGIAIIFGAGVPRWIVGYLRNRRLKAFLSEFPNALD 170

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  ++SG+ ++ A+R ++        P+  E    +       N   A    Y+R  +
Sbjct: 171 IMVRSIKSGLPLNDAIRMIS---AEGQEPVRTEFKRIVDSQQMGMNIPEACARLYSRIPL 227

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                 +  +    + G ++ ++L  L    R  + M+A+  A S+  K +   II  LP
Sbjct: 228 SEANFFSIVIAIQAQAGGNLSEALGNLSRVLRDRKKMKAKINALSMEAKASAA-IIGALP 286

Query: 309 VLILVII---GPAILSIIDT 325
            ++ +++    P  + I+ T
Sbjct: 287 FIVALLVYLTSPDYIMILFT 306


>gi|242311994|ref|ZP_04811011.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254265316|ref|ZP_04956181.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|242135233|gb|EES21636.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254216318|gb|EET05703.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 313

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 147/314 (46%), Gaps = 11/314 (3%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + + +     + + + A  +     G        +A   E +      +     A   + 
Sbjct: 3   ILLLLGLFAIVVAGVMATWLAFAPRG--------LARRLEQIGGAGAVAAGDGRAPPAVW 54

Query: 74  TRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                 +   + KL+L      +  +  +L  AG+RS  + ++    + V+ +      +
Sbjct: 55  IEKLAEISQPISKLSLPKSGWENSPLRLRLINAGWRSPGAAHLYFAAKTVLALALPAAAM 114

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
                    +          ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +
Sbjct: 115 --PLLIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTV 172

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVE+G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   RT  + V 
Sbjct: 173 CVEAGLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVD 232

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
             +  LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I    P L+ 
Sbjct: 233 AFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLT 292

Query: 313 VIIGPAILSIIDTM 326
           V++GPA + I  T+
Sbjct: 293 VLLGPAFIHIYRTL 306


>gi|152994352|ref|YP_001339187.1| type II secretion system protein [Marinomonas sp. MWYL1]
 gi|150835276|gb|ABR69252.1| type II secretion system protein [Marinomonas sp. MWYL1]
          Length = 316

 Score =  139 bits (351), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 71/320 (22%), Positives = 152/320 (47%), Gaps = 7/320 (2%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGE--LEKRMKSVAVEREILRKQQITSLQKDS 67
              ++   +   + + +    ++     +    L  R++S  +  + + + +   L ++ 
Sbjct: 1   MTNDMMFPVLAGIFLCTTGLVLLGLYFRTKPKTLADRLQSSGIMDKDILQVEAVLLSQND 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
              +L  +  + L    ++L              L  AGFR + +L +    +  + II 
Sbjct: 61  ERRKL-QKWLQPLDRIGQELA-GTESDKFATRKLLLMAGFRRQNALGVFTFCKFSLGIIC 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           +   ++++FG  +         +   +++ + G  A  VW+      R   +  + PDAL
Sbjct: 119 I---LLFLFGVLESGNRLSLNGLAGSLMLLFFGSFAAEVWLKMRAASRGGRLSSSLPDAL 175

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL++IC E+G+ + +  + V++++   +  ++EE+  T AEL  L +R  A  N   R  
Sbjct: 176 DLMVICAEAGLPLGRIFKTVSKELAFSAPEIAEELGYTHAELQILSDRTKALLNLSERCG 235

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           ++ V      LIQ++RYGT +  +LR +  E+R   +++ E+KA  L  +L+VP+++F L
Sbjct: 236 VENVEAMVSTLIQAERYGTPLSQALRTISEESRKRLVLDLEEKAGKLPAQLSVPLMVFIL 295

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P +I ++  PA++ II  + 
Sbjct: 296 PPVIAMMGTPAMIRIIRMLG 315


>gi|317154600|ref|YP_004122648.1| type II secretion system F domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944851|gb|ADU63902.1| Type II secretion system F domain protein [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 317

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 82/316 (25%), Positives = 132/316 (41%), Gaps = 10/316 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIP---SLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            +    A   F+ +    +      G      R++         R  +            
Sbjct: 5   LIPFIAAGLAFATVLVAGLGMAGYFGGAGQAARLRERVAGGPTGRSVES-----RPLFDG 59

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
           LR   S +      K+  K     +     L  AG RS  ++      ++ + +    L 
Sbjct: 60  LRRAVSGAFERLGSKVAPKDADEADRTRKALVQAGLRSPGAVIKFQGTKVALALCLSSLF 119

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           ++       L +    L     + +  +G   P VW+     KR+ ++    PDALDLL+
Sbjct: 120 LVVRSF--TLSDLSVSLTCFVAVGLAALGVYGPEVWLRRRTTKRRLAVANELPDALDLLV 177

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CVESG+ +DQAL RV  ++      +S E  L   EL     R  A      R  +D +
Sbjct: 178 VCVESGMGLDQALDRVCHEMRTSGPVISAEFKLLTLELRAGKGRGDALRGLSERVGLDDL 237

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
            + T  L+Q+D +G S+G +LRV     R++R   AE+KAA L   L +P+I F LP L 
Sbjct: 238 NSLTSLLVQADIFGISVGRTLRVYSDAMRTKRSQRAEEKAAKLPVLLLLPLIGFILPALF 297

Query: 312 LVIIGPAILSIIDTMK 327
           + I+GPA++  ID   
Sbjct: 298 IAIMGPAVILFIDVFA 313


>gi|332970974|gb|EGK09948.1| hypothetical protein HMPREF9374_2751 [Desmospora sp. 8437]
          Length = 306

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 65/311 (20%), Positives = 123/311 (39%), Gaps = 14/311 (4%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I   V    L + +            R + V             +  +     +   
Sbjct: 1   MLKIYALVGAAWLFFILAGWMYVKYR--DRQEKVHHRIGEQMCVASVAETEGDGWKQTLV 58

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R         K + L +      + + L  AG     +++ L   ++V  I   I G+++
Sbjct: 59  RWCDQFAPTGKNIELLSDPE--ELKDDLIKAGHPYGLTVDRLQGAKVVFAIGGTIFGLLY 116

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                        L   AV     +G+  P   +    QKRQ  I+   PD +D++ I +
Sbjct: 117 FLI-------GLPLAPFAVAFGPLLGYLFPIYMVKFKAQKRQEEIQYELPDFMDMMSITL 169

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G+++D AL      +   + PLSEE+     E+SF   R+ A+    +RT    +   
Sbjct: 170 QAGMALDTALDYY---VSTNNGPLSEEIARMNQEISFGVQRETAYRALIDRTDSTELETL 226

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            Q++IQ+   GT I ++  +   E R+ R  +A+++A    PK++    +   P ++L++
Sbjct: 227 VQSMIQAHNLGTPISETFALQAMEMRNMRAEKAKEQAGKSEPKISAVAGLVITPSIMLLV 286

Query: 315 IGPAILSIIDT 325
            G  IL    T
Sbjct: 287 FGAFILKFFFT 297


>gi|134281772|ref|ZP_01768479.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|134246834|gb|EBA46921.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 313

 Score =  138 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 85/310 (27%), Positives = 151/310 (48%), Gaps = 7/310 (2%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           I   + +F+++ A V+ +     L    + +A   E +      +     A   +     
Sbjct: 3   ILLLLGLFAIVVAGVMATW----LAFAPRGLARRLEQIGGAGAVAAGDGRAPPAVWIEKL 58

Query: 78  KSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
             +   + KL+L      +  +  +L  AG+RS  + ++    + V+ +      +    
Sbjct: 59  AEISQPISKLSLPKSGWENSPLRLRLINAGWRSPGAAHLYFAAKTVLALALPAAAM--PL 116

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                +          ++LIG  GF  P+  ++  +  RQ  I   +PDALDLL +CVE+
Sbjct: 117 LIGTAIADSPYSVSAMLVLIGAFGFYLPNAMLARRIAARQRMIVEDFPDALDLLTVCVEA 176

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+ +D AL +VA+++  +S  +++E+ L + E+     ++ A  N   RT  + V   + 
Sbjct: 177 GLGLDAALTKVADELRLRSPVVADELGLMLLEMRSGFTKETALRNLALRTGAEDVDAFSA 236

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            LIQ+DR+GTSIG SLRVL    R++R M AE++AA +  KL  P+I    P L+ V++G
Sbjct: 237 MLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERAAKIALKLLFPLIFCIFPALLTVLLG 296

Query: 317 PAILSIIDTM 326
           PA + I  T+
Sbjct: 297 PAFIHIYRTL 306


>gi|187919329|ref|YP_001888360.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717767|gb|ACD18990.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 318

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 79/306 (25%), Positives = 144/306 (47%), Gaps = 2/306 (0%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLR 81
           + +  +++ +V  +        R   V    E + +  + +     A        +K   
Sbjct: 6   IVLLGVMFLIVFGAALKAMALLRPDPVQRRIEEIGQPGVAAEADTGAQKNWVETVTKMSE 65

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
              +    K       +  +   AG R+  +  +   V+ V+ +    + +I      + 
Sbjct: 66  RVARLSLPKEDWDKSVLRLRFANAGIRTPSAAAVYFAVKTVLALALPAIALIVFGNAFQA 125

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
            E      +  V+    +GF  P+V +  LV+ RQ  +    PDALDL+ +CVE+G+ +D
Sbjct: 126 GER--IYLLLTVLAASALGFYLPNVVMRRLVESRQRKLFEDLPDALDLMTVCVEAGLGLD 183

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            A+ RV ++IG +S  L +E  + + EL     R+ A  N   RT ++ +      LIQ+
Sbjct: 184 AAMLRVTQEIGVKSHALKDEFDMVLLELRAGSGREKALRNLSLRTGVEDIDTLAAMLIQA 243

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           DR+GTS+GDSLRV     R++R + AE++AA +  KL  P++ F  P L+ V++GP+ + 
Sbjct: 244 DRFGTSVGDSLRVYTDNLRTKRRLRAEEQAAKIALKLLFPLMFFIFPTLLAVLVGPSAIQ 303

Query: 322 IIDTMK 327
           I+  + 
Sbjct: 304 IVRQLS 309


>gi|226310159|ref|YP_002770053.1| hypothetical protein BBR47_05720 [Brevibacillus brevis NBRC 100599]
 gi|226093107|dbj|BAH41549.1| conserved hypothetical membrane protein [Brevibacillus brevis NBRC
           100599]
          Length = 311

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 71/313 (22%), Positives = 136/313 (43%), Gaps = 12/313 (3%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
             I T V +F L++A+ +       +EK+ K +A   E+   +     +++++S RL  R
Sbjct: 3   ALIITCVFLFLLLFAICLKEWYRYSIEKQ-KLLAHVHEMSGHKNYGVRKQETSSERLVKR 61

Query: 76  DSKSLRNF-VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             +   ++ V    +        + + L  AG   + ++     V++ + ++ +I G ++
Sbjct: 62  LLRYGDDYAVMGQRINFFSESHEVEDWLLRAGRPLDLTVAQFQGVKIFMALLGIIAGTLF 121

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                      F      +I    +G+  P + +    + RQ  ++   P+ LD + + +
Sbjct: 122 FIL-------RFPFSHLGLIAWPLIGYFLPILLLKKKARDRQHQLRYDLPEFLDTVSVTL 174

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G+S+DQALR V +   G   P+ EE      EL     R+ A+E    R      +  
Sbjct: 175 QAGVSLDQALREVIKFFDG---PIREEFSRFNQELDLGVQREKAYEQLLRRNDNPEFQML 231

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            +ALIQ  R G  I  + +      R  R    ++KAA   PK+T+       P  I++I
Sbjct: 232 IKALIQGMRLGVPIAVTFKAQAENMRRIRKELIKEKAAKASPKVTLITTFIVTPTAIILI 291

Query: 315 IGPAILSIIDTMK 327
            G  +L+I+D   
Sbjct: 292 GGLMVLNILDNFS 304


>gi|23016184|ref|ZP_00055943.1| COG2064: Flp pilus assembly protein TadC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 319

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 179/294 (60%), Gaps = 6/294 (2%)

Query: 38  SGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR----TRDSKSLRNFVKKLNLKAIL 93
                 R+K+V+  R  L ++Q   L +   S R R     R    +R  + +L L+ ++
Sbjct: 28  RDRRAARIKAVSGRRRELSERQKADLDQARGSGRRRGAMPQRRVALMRAVIDRLKLQDLM 87

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             + +  KL  AG+R + +    +  R+ +P++ L LG+I+        E P  +R   +
Sbjct: 88  EAKALKAKLAQAGWRGQAAPLTFIFARVALPVLLLALGLIYATTL--FDEQPLMIRAMIL 145

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
            +    G   P++W++N VQKRQ ++ RA+PDALDL++ICV++G+S++ AL RV E++  
Sbjct: 146 AVAMGAGGLLPNIWLANAVQKRQLALGRAFPDALDLIVICVDAGLSVETALGRVTEEMMN 205

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
            S  ++EE+ LT AEL+FL +R+ A+ENF  RT +  V++ + ALIQS++YGT +  +L+
Sbjct: 206 SSPEMAEEIGLTAAELAFLADRRQAWENFAGRTGLPQVKSLSTALIQSEKYGTPVAQALK 265

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           VL  E R  R+  AEKKAA+L  KLTVPMI+FFLPVL L+I GPA L +   +K
Sbjct: 266 VLSQENRESRMAAAEKKAAALPAKLTVPMIVFFLPVLFLMIAGPAALQVSGMLK 319


>gi|283777928|ref|YP_003368683.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283436381|gb|ADB14823.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 326

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 64/324 (19%), Positives = 144/324 (44%), Gaps = 9/324 (2%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            ++LF +  +            L+    + S     L+ RM+S+               +
Sbjct: 1   MWELFSSPVMIQVAVFLGVSSLLLGLHWLMSSSDTRLDSRMESL-----TEGDSHAIDDR 55

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             +    +       +    K +          +  +L  AG  +  ++ + L  +LV+ 
Sbjct: 56  YRAKPRGMMQLLVPQIPRLAKVILPNDEATRTRLQAQLIQAGIYAPSAMGLYLTAKLVLM 115

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            I  ++G++  +       +     +      G  G   PS+W++    KRQ  ++ +  
Sbjct: 116 TIPPVVGLVVAWF----GWFDPAYAMLLGGAGGCAGMLMPSMWLAYYRAKRQRQLRTSLA 171

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D LDL++ C+E G+ +  A+ +VA+++      L+ E+L+ + E+    + +VA  +   
Sbjct: 172 DFLDLMVTCLEGGVGMQAAISQVADELRTPHPILATELLVVLREVEVGRSIEVALAHLAE 231

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT ++ +R+    + Q+ R+G+++ D++R L    R++R   AE++A     K+ +P ++
Sbjct: 232 RTGLEELRSLATFVQQAQRFGSTMADAMRELSDMLRTQRETRAEERAQKASVKILIPTLL 291

Query: 305 FFLPVLILVIIGPAILSIIDTMKD 328
           F  P + +V+ GPA + I +++  
Sbjct: 292 FIFPTVFVVLAGPAAIQIQESLAK 315


>gi|89100216|ref|ZP_01173083.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
 gi|89085066|gb|EAR64200.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
          Length = 312

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/309 (21%), Positives = 135/309 (43%), Gaps = 16/309 (5%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL----RT 74
              +++      +V+  +   +  KR + + +  + +       + K  + S        
Sbjct: 4   IILITVILCWLTLVLGLINLYQFAKRKEVLKLHIDEIAASSAFDVSKKKSGSEKVITFLA 63

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R +       +++NL +      I   LR AG   E ++      ++V  II  I G+  
Sbjct: 64  RYADDFSTIGERVNLLS--ESAEIQTLLRKAGNPFEMTVGRFQGFKIVCVIIGFIAGLFA 121

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +     L          A + +   GF  P + + +  +KRQ  ++   PD LD + + +
Sbjct: 122 VLLGLPLSN-------IAFVTLPIFGFFVPILLVRSKAKKRQQQLRSDLPDFLDTVSVSL 174

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G ++D AL+ V +     S P+ EE  + + E+     R+ A+     R   +  ++ 
Sbjct: 175 QAGSNMDSALKEVIKYF---SGPIKEEFSIFLQEIDLGVPREKAYGGLLERNDNEEFQSF 231

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            ++LIQ+ R G  +  +L+    + R   L + ++KAA   PK+T+       P+++L+I
Sbjct: 232 IKSLIQATRLGVPMASTLKSQAEDIRKISLEQVKEKAAKASPKVTMITSFIIAPLIMLLI 291

Query: 315 IGPAILSII 323
           IG  +L++I
Sbjct: 292 IGLVLLNMI 300


>gi|283769336|ref|ZP_06342235.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
 gi|283103993|gb|EFC05377.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
          Length = 313

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 76/320 (23%), Positives = 143/320 (44%), Gaps = 9/320 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAV-EREILRKQQITSLQKDS 67
                L + I+ +  +F     +V        L  ++K +A  E  + R       +  S
Sbjct: 1   MSQNLLILLISVSTGLFVYSMILVKFVNERTHLRLQLKDIAETENSLRRNSDDMDFENKS 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             SR+     + L  F+ ++   A    + +  +L  AG R +      L +R++V  + 
Sbjct: 61  FYSRVIFPGIERLSLFIGRVFPIAQKDQDKLNLQLLQAGLRIK--AQTYLTIRILVIAVC 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           +I   I+I  Y     +   +     IL    G+      +++ V +RQ+ +++  P  L
Sbjct: 119 MIFTYIYIGPYHLYFGFSVMMSALGGILS---GYIISRFVLASRVTRRQNLLEKQLPGFL 175

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL +CVE+G+  DQA++ V  +  G    LS+E  +   ++S    R+ A  +   R  
Sbjct: 176 DLLSVCVEAGLGFDQAIQYVCHEYKG---ELSDEFKVVQRDISLGSTRKQALMSLCQRVT 232

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
              +   T A++Q+D  G S+ + L       R     + E+KA  L  K+ +PM+IF  
Sbjct: 233 SSQMTTFTAAVLQADEMGISLKNILNAQSRNVRLAYKNKIEEKAQKLSTKILIPMLIFIF 292

Query: 308 PVLILVIIGPAILSIIDTMK 327
           PV+ ++++GPA+  I+  + 
Sbjct: 293 PVIFIILLGPAVPGIMKALG 312


>gi|308050051|ref|YP_003913617.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
 gi|307632241|gb|ADN76543.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
          Length = 321

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 76/322 (23%), Positives = 144/322 (44%), Gaps = 11/322 (3%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
           ++ +  +L+  +  A++  + +   +  S     L             +R +++ +    
Sbjct: 10  EVLNDRQLSTYLFYAIAAAAGVMLALALSFLFSGLYS--------PTRMRLKELKTGAVA 61

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
           S S        +      + L     + +     +L  AGF S  +L I   +RL+  ++
Sbjct: 62  SGSGANFDDALEHENRVREGLVKHLSVDNSGSRKRLIHAGFHSNSALAIYNGLRLLFLLL 121

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             ++ II       ++     +++  ++++  +    PS  +      R   I+  +PDA
Sbjct: 122 MAMVSII---AIPMMVGLSTFMQIYIIVMLMGLAILTPSFILDRFAASRMRKIRNGFPDA 178

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LDLL++C ESG  +  AL+RV+ ++      L+EE+LL   +         A   F  RT
Sbjct: 179 LDLLVVCCESGQGLLAALQRVSVELRVSHKELAEELLLVCQKNRAGIELSTALHEFSERT 238

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +D +R    A+ QS R GT I ++LRV   E R +R+  AE+ AA LG K+  PM+   
Sbjct: 239 GLDDIRGLNGAITQSLRLGTGIAETLRVYADEYRDKRMQAAEEMAAKLGVKIIFPMLTCI 298

Query: 307 LPVLILVIIGPAILSIIDTMKD 328
            P   +V +GPA++ +++    
Sbjct: 299 WPSFFIVAVGPAVIKVMEVWDK 320


>gi|220913386|ref|YP_002488695.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860264|gb|ACL40606.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 291

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 76/312 (24%), Positives = 146/312 (46%), Gaps = 24/312 (7%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +A+   ++I   I  +V  S        R             +   +L    + +     
Sbjct: 4   IALAAILAIVVPISGMVWLSFTGDRAALR-------------RIKANLGGRPSQAAQSLN 50

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            S+ L  F +++  K    +  +  +L  AG   ++ L  +L+V+ ++     ++G +  
Sbjct: 51  VSQHLVEFSQRITPKGY--EGWLDKQLSGAGRPKQWPLARILMVKPMLAFGGALIGFMLF 108

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                    P   R    +LI  +G+  P + + N  QKR+ +I+   P+ALD +LI V+
Sbjct: 109 L------GAPSAGRFVMAVLIVALGYFVPDLLLRNRAQKRREAIRLELPNALDQMLISVQ 162

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+  + A+ R  E+  G   PL+EE++ T+ ++    +R+ A+     R  +  VR   
Sbjct: 163 AGLGFETAMGRAGENGRG---PLAEELIRTLQDIQVGRSRKEAYLALSERVDVPSVRTFV 219

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           +A++Q+D YG +I + L+    + R +R   AE+ A  +  K+  P+I F LP L +V++
Sbjct: 220 RAVVQADAYGIAIANVLKTQAKDMRIKRRQLAEEHAMKMPVKMLFPLIFFILPTLFIVLL 279

Query: 316 GPAILSIIDTMK 327
           GPA+L I+    
Sbjct: 280 GPAVLQIMSVFS 291


>gi|167584966|ref|ZP_02377354.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 324

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 81/318 (25%), Positives = 154/318 (48%), Gaps = 7/318 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +  ++ +      ++F+     ++  +    +++R++        L     T       
Sbjct: 4   LNLMQILMLGGLFAAVFAGALVALLVFVPRN-MQRRLQQAGGGTVTLGDGAATG----GF 58

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +S    + ++  +   K    K    D  +  +L  AG+R+  + ++    + ++ I   
Sbjct: 59  ASEWVAKFAEMSKPISKLSVPKEGWEDSPLRVRLMNAGWRTPNAASVYFGAKTLLAIALP 118

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
              ++        L          ++++G +G+  P+V +S  +  RQ  I   +PDALD
Sbjct: 119 --AVLLPALITTRLAESRYTLSMILVVLGAIGYYLPNVVLSRRIASRQRVIFEDFPDALD 176

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL +CVE+G+S+D AL +V E++  +S  ++ E+ L + E+     ++ A  N   RT +
Sbjct: 177 LLTVCVEAGLSLDSALLKVCEELQFRSPIVASELDLMLLEMRSGFTKEAALRNLALRTGV 236

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + + +    LIQ+DR+GTSIGDSLRVL    R+ R M AE++AA +  KL  P+I    P
Sbjct: 237 EDIESFCAMLIQADRFGTSIGDSLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCIFP 296

Query: 309 VLILVIIGPAILSIIDTM 326
            L+ V++GPA + I   +
Sbjct: 297 ALLTVLLGPAFIHIYRIL 314


>gi|119717342|ref|YP_924307.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538003|gb|ABL82620.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 304

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 134/281 (47%), Gaps = 8/281 (2%)

Query: 46  KSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAA 105
           +S+ + R      ++ + + +           +     + +  L      + I ++L  A
Sbjct: 32  RSLELVRAASASPEVVTREAEVPFGERVLDPLRERTLGLGR-RLAGHEAADRIRHRLDLA 90

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPS 165
           G    ++++  L   ++   +    G++       LLE    + V  +     +G+  P 
Sbjct: 91  GNPPGWTVDRYLTGTVLGAAL----GLVGAGLLGLLLEPATPVLVLLLAAGLVLGYFGPR 146

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
           +++      R   I+RA PDA+DLL I VE+G+  D A+++VA+       PL++E+   
Sbjct: 147 LYLYQKSYDRSERIRRALPDAIDLLTISVEAGLGFDAAVQQVAQH---TEGPLADELSRV 203

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
           + E+    +R  A  +   RT +  +R    A++Q+D  G  I   LRV   E R +R  
Sbjct: 204 LREMQLGQSRSAALRSLSARTTVPELRGFVGAMVQADALGIPIAQVLRVQSREIRVKRRQ 263

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            AE++A  +  K+TVP+I   LP L +V++GPA+L+I+DT 
Sbjct: 264 HAEERAQQVPVKITVPLIFCILPCLFVVVLGPAVLNIMDTF 304


>gi|328952510|ref|YP_004369844.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452834|gb|AEB08663.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 312

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 80/321 (24%), Positives = 137/321 (42%), Gaps = 10/321 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   L  A+ +   +     A  +  L    L  R+           + +  S   D+A
Sbjct: 1   MNPWSLTAAVLSFAGV--TTLAYYLGRLAEQRLYTRLIK---RSLTAGRDRPKSFFGDAA 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
             RL T     L                 I   L  AG+RS  +   L+     +  +  
Sbjct: 56  PQRLLTEVVLPLGRLAA---PSGEEDLAVIRRLLCQAGYRS--APYNLVEAYFGLRALLA 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +        +           +  + L    G+  P+V +     +R+  I +  PD LD
Sbjct: 111 LGLGALYVLWLFFAGGWTSRSLLILFLPLTAGYYLPAVILRRQASERRLKIWQELPDVLD 170

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL IC+E+G+S+D AL RV+ ++   +  LS E+     E+     R+   E   +R Q+
Sbjct: 171 LLNICIEAGLSLDSALYRVSRELRDIAPVLSRELAQYFLEIQSGLPRKEVLEKIVDRNQV 230

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +      L+QS R GT I +SL+V     R+ER+  AE++ A +  KLT PM +  LP
Sbjct: 231 NALSGVVNVLMQSSRLGTDIAESLKVYSVSLRTERMQAAEEQGAKVSTKLTFPMTMLILP 290

Query: 309 VLILVIIGPAILSIIDTMKDH 329
            L+LV++GPA++ +++ +  H
Sbjct: 291 ALLLVVLGPAMIKMLEKLSQH 311


>gi|84498181|ref|ZP_00996978.1| probable secretion system protein TadC [Janibacter sp. HTCC2649]
 gi|84381681|gb|EAP97564.1| probable secretion system protein TadC [Janibacter sp. HTCC2649]
          Length = 301

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 66/267 (24%), Positives = 117/267 (43%), Gaps = 13/267 (4%)

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           +  + +A  RL     + L+   ++L+         +   L  AG    + +  +   + 
Sbjct: 47  AKSELAAKDRLVVPFEQGLKGVARRLSP--AGTAGRLAASLNRAGNPPAWPVERIFGAK- 103

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
                   +G++                +   ++ G   F  P + + N   +RQ  +++
Sbjct: 104 -------GIGLVAGALLGLFFGGLGLTGLLYAVIGGAALFFLPDLLVYNAGIRRQEQLRK 156

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
            + DALD+L +CVESG   D AL +VA ++   + P++ E    ++E      R  AF+ 
Sbjct: 157 GFADALDMLTVCVESGQGFDAALGQVARNV---TGPIAGEFARVLSEFQIGMTRGQAFQG 213

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
              R     V+N   AL+Q+DR G  I   LR    E R  R   AE+KA  +  K+  P
Sbjct: 214 MAERNTSPEVKNFVSALVQADRLGVPIAGVLREQTKEMRVVRRQLAEEKAQKVTVKVVFP 273

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMKD 328
           +++   PV+ +VI+GPA ++I D    
Sbjct: 274 VLLCIFPVIFVVILGPAAINIYDLFSK 300


>gi|153006801|ref|YP_001381126.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030374|gb|ABS28142.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
          Length = 314

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 84/318 (26%), Positives = 147/318 (46%), Gaps = 14/318 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            DA  LA+     +++ S+  A       +    +R++  +    +     +   + ++A
Sbjct: 3   LDALTLAMGGLVVLAVASIGAAARSFRAAADPAVRRLREGSDPHSVPLAAVVAGERLEAA 62

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +     R + +               +  +  +L  AGFRS  +  + +  +     +  
Sbjct: 63  THEASRRGAAT----------TDEDAESRLRRQLVWAGFRSMRAPKLFVGAKA----VLS 108

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
              ++     +     P    +G  + +   GF  P++W+S+ +  R   I RA PDALD
Sbjct: 109 FGLLLGFLAVNAARAEPVPFALGIAVWLAGAGFFLPNLWLSSRIANRLRQIDRALPDALD 168

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL+ CVE+G+ +D AL+RV+ +I      LS E+ LT  E+     R   F     RT  
Sbjct: 169 LLVTCVEAGLGLDAALQRVSGEIALAWPLLSSELRLTFLEVRAGIPRMDGFRRLAARTGS 228

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R     L Q++ +GTSI  +LRV     R  R+  AE++AA +  K+T+P+I+  LP
Sbjct: 229 PELRALAATLTQTELFGTSIASALRVQAEGIRIRRMQRAEERAAYVAVKMTLPLILCILP 288

Query: 309 VLILVIIGPAILSIIDTM 326
            L  VIIGPA ++I+ T+
Sbjct: 289 SLFAVIIGPAAINIMKTL 306


>gi|156744077|ref|YP_001434206.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235405|gb|ABU60188.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 309

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 63/314 (20%), Positives = 127/314 (40%), Gaps = 8/314 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L +          L+ A ++ S     + +R+ +             +   K   S R+ 
Sbjct: 2   LIIPSIVTALAILLVVAGLMASRRDVTVGERLDAYLSPTVEKAPSNPSLEAKQPFSERVI 61

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K        +  +     E +  +L  AG+    +    +  +    I+ +++G++
Sbjct: 62  IPLLKRASRAFAWIMPQN--RYEALRLRLAMAGYPWGLTAADFVGAK---GIVCVLVGLL 116

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                      P    +  +  I    F  P VW+S  + +RQ+ +  A PDALDLL I 
Sbjct: 117 TGVIGWAADAAPTFFNILLLGGIALCAFFLPDVWLSRRIGQRQTELLNALPDALDLLAIA 176

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
             +G+S + A++ +       +  L+ E    + ++S    R+ A  +   RT +  + +
Sbjct: 177 TAAGLSFENAIQEITSK---WTNELAREFSRVLRDMSMGVPRRQALTDMAERTGVPDIAS 233

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              A+ Q++  G SIG  L V   E R+ R   A+++A     K+  P++    P +  V
Sbjct: 234 FVSAIKQAEALGVSIGRVLTVQAEEMRTRRRQRAQERANQAPVKMMFPLVFLIFPAIFAV 293

Query: 314 IIGPAILSIIDTMK 327
           ++GPA+  +++   
Sbjct: 294 LLGPAVPQLLEAFG 307


>gi|154250693|ref|YP_001411517.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154643|gb|ABS61860.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 328

 Score =  136 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 119/319 (37%), Gaps = 23/319 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D + L +A    ++   +     +   G    +KR+  V         + +    +   
Sbjct: 1   MDQSTLMIAGIAVLAALCIGAIGFLFVGGESRSQKRVARVTRAGN---ARLVAVDGEVDN 57

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           S + R +  ++L+   +K   +      ++  ++  AG   E +     +  +V  I F 
Sbjct: 58  SEKRRKQMQETLKGLEEKQ--QEHKKRVSLNTRIERAGL--EMTTRNFYIASIVTGIAFF 113

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++  +                + + +     GF  P   +S L+++RQ +    + +A+D
Sbjct: 114 LVFKLVGLSL-----------LVSALSGFAGGFGFPRWVLSYLIKRRQKAFTEEFANAID 162

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  V+SG+ ++  L+ +A        P+  E    +         +      Y R  +
Sbjct: 163 VIVRGVKSGLPVNDCLKLIAT---ESPEPVRTEFQGIVEGQRVGVTLEQGLAKIYERMPL 219

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             V      L    + G ++ ++L  L    R  + M  + +A S   K +  +I    P
Sbjct: 220 PEVNFFQIVLAIQQKTGGNLSEALGNLSKVLRERKKMRGKIQAMSQEAKASAGIIGSLPP 279

Query: 309 VLILVII--GPAILSIIDT 325
            ++L+I    P  + ++ +
Sbjct: 280 GVMLLIYFSSPGYMDVLFS 298


>gi|87199542|ref|YP_496799.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135223|gb|ABD25965.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 322

 Score =  136 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 76/322 (23%), Positives = 144/322 (44%), Gaps = 7/322 (2%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
            D      L  ++  A+   + + A             R   V      +      S   
Sbjct: 1   MDFILQNALLRSLILALFFAATVIAAFSAISY----FTRRAQVRAHLRTVSVDSGASNGA 56

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           +++ ++ R+    S+ N +++  L       + +  KL AAGF +  +  I  + RL++ 
Sbjct: 57  ETSLAQSRSGPFWSIVNVIERTGLSLADSNPDALRTKLIAAGFEATEAPTIYTLSRLILV 116

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
            +     I ++       E           + G +G  AP+ ++     +R  +I   +P
Sbjct: 117 FLLPACAISYLMLTG--SELTIFKLYMVGSVSGLLGLIAPAWFVRIKADRRMEAITNGFP 174

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           + LDL+L+CVE+G+ ++ A  RV+ +I      ++  ++ T   L     R+ A      
Sbjct: 175 NCLDLILVCVEAGLGMEAAFDRVSREIARAEPQVAHLLVRTNLHLRAGATREEALHRMAT 234

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
              +D +R+    LIQS++ GTSIG +LRV  SE R +R M AE+KA  L   +++P++ 
Sbjct: 235 LAGVDEIRSFATLLIQSEKLGTSIGTTLRVFASEMREKRRMRAEEKAHRLPVLISLPLVT 294

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
             LP +I V++ PA + ++  +
Sbjct: 295 CMLPTMIGVLMIPAAIRVVRKL 316


>gi|90411198|ref|ZP_01219211.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
 gi|90328044|gb|EAS44365.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
          Length = 224

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 62/225 (27%), Positives = 112/225 (49%), Gaps = 3/225 (1%)

Query: 103 RAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFC 162
             AG+  + +L     +++++ II L   +I       L E   Q  +   +L   +   
Sbjct: 1   MHAGYEQKQALTNFYAIKIILVIIALFGVLI---SSKFLPELSTQKILFYTLLAMAIATF 57

Query: 163 APSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM 222
            P+  +    +KR   +  A+PDALDLL++  E+G+    AL RVA +I   S  LS E+
Sbjct: 58  LPNFILQKKAKKRIRKLSNAFPDALDLLVVTTEAGLGFLAALNRVANEIDAISPELSNEL 117

Query: 223 LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE 282
            +   ++       +A   F  RT +  ++     + QS + G+S+GD+LR    E R  
Sbjct: 118 QIVCRKVRLGVPMPIALAQFIERTGLLELQGLVSIISQSVKLGSSMGDTLREYAIEFRDR 177

Query: 283 RLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           R+ +AE++AA +G K+  P++    P   +V +GPAI+++++   
Sbjct: 178 RMQKAEEEAAKIGTKMIFPLVTCIWPGFFVVAVGPAIIAVLEVFG 222


>gi|108756874|ref|YP_632816.1| type II secretion system protein F domain [Myxococcus xanthus DK
           1622]
 gi|108460754|gb|ABF85939.1| type II secretion system protein F domain protein [Myxococcus
           xanthus DK 1622]
          Length = 296

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 75/316 (23%), Positives = 132/316 (41%), Gaps = 25/316 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D     + I ++  +F+     +   L    LE+ +  V  E     K   +   +   
Sbjct: 1   MDDVLTPILIGSSALLFAGAVGFLGLGLYQTMLERFLSEVRDESTGGMKGFGSVAIRRLG 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +   R                     +      L  AG    Y    ++ ++ V  ++ L
Sbjct: 61  AMNRRFMWPGY---------------EAKARRNLIKAGEPQAYKPEDIMALQEVSAVVGL 105

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I+G+I + G+         + +    L    G   P +W+++ V+KR   I RA P +LD
Sbjct: 106 IMGLILLNGFG--------VSLVWAPLFLLFGMYYPLMWLNDQVKKRHLLISRALPYSLD 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL + VE+G+    AL +V E   G+  PL EE+ L + +L     R+   ++   R  +
Sbjct: 158 LLTLSVEAGLDFTAALAKVVE--KGKPGPLREELQLVLKQLKMGKTREEGLKSMIVRVDL 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +     ALIQ+D+ GTS+G  LR+  ++ R +R   AEK A     K+  P+I    P
Sbjct: 216 PPLTTFVTALIQADKMGTSLGKVLRIQSTQMRIDRTQRAEKLAGEAPVKMLFPLIACIFP 275

Query: 309 VLILVIIGPAILSIID 324
            + +V+ GP +   + 
Sbjct: 276 TVFMVLFGPIVFQFMF 291


>gi|84685156|ref|ZP_01013055.1| Putative Flp pilus assembly protein TadC [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666888|gb|EAQ13359.1| Putative Flp pilus assembly protein TadC [Rhodobacterales bacterium
           HTCC2654]
          Length = 329

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 81/334 (24%), Positives = 143/334 (42%), Gaps = 23/334 (6%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
              L ++  L +A+  AVS+  +  A+           +RM++ +        + +    
Sbjct: 9   LTSLLNSPGLLMAM-VAVSVVFIGLALWTAIAMRDPAAERMRAASAAYGRAANRDLLKTP 67

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                  L+             L  +       I ++LR AGF    +L    V+RL++ 
Sbjct: 68  DALPEGMLKA------------LIPEERAERTQIRDQLRRAGFGGPNALRNFFVLRLILA 115

Query: 125 IIFLILGIIWI----------FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
               ++ +             F    +    F      V +   +GF +P++W+   ++ 
Sbjct: 116 TAAPVIALALTALNMSIGLPWFLDKLVGGLTFISASRLVAICTAIGFWSPTIWLKRKIRA 175

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           RQ+ I+  +P+ALDLL I  E+G+  D A+ RV + +   S  +SEE LL  AE+    +
Sbjct: 176 RQAEIEAGFPNALDLLQISTEAGMGFDAAMTRVGQSLATVSPAISEEFLLCQAEILASRD 235

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R+ A  +   R  +  V    Q + QS  YGTSI  +L    +E R  R M+A +KA  L
Sbjct: 236 RRQALADMAERMGVAEVSAFAQVVSQSMEYGTSIAKALNAYAAEMREMREMKAIEKANRL 295

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             +++  M +  LP L L+ +GP ++  +    D
Sbjct: 296 PVQMSGVMSVMMLPALFLITLGPTVIRYLSVFGD 329


>gi|220918108|ref|YP_002493412.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955962|gb|ACL66346.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 319

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/253 (26%), Positives = 128/253 (50%), Gaps = 4/253 (1%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                   + + +           +  +L   GFR  +++++ L ++L + +      ++
Sbjct: 64  RSALGRALDVLTRFARPMGDEAARLQLRLEQGGFRGPHAVSVHLALKLTLAVGL----LL 119

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                +       +      +L    GF  P + +++ +  RQ +++R  PDALDLL+ C
Sbjct: 120 TFLFVNAHRAERIEPAFVVAVLAFAAGFYLPDLLLTSRISSRQLTLERGLPDALDLLVTC 179

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D +++RV+E+I      L+ E+  T  E+     R  AF     RT +  +++
Sbjct: 180 VEAGLGLDASVQRVSEEIHRAWPQLATELRTTFLEVKAGIPRIEAFRRLATRTGVKDLKS 239

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            +  L Q++ +GTS+  +LRV     R  R+  AE+KAA +  K+T+P+I+  LP L+ V
Sbjct: 240 LSATLAQTEIFGTSVALALRVQSDGMRVRRMHRAEEKAAYVSVKMTLPLILCILPSLLAV 299

Query: 314 IIGPAILSIIDTM 326
           I+GPAI+ I+  +
Sbjct: 300 IMGPAIIGIMRAL 312


>gi|326404408|ref|YP_004284490.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|325051270|dbj|BAJ81608.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 307

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 79/311 (25%), Positives = 143/311 (45%), Gaps = 6/311 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            AI    ++F L+    +  L    +E++++                  + +    +R  
Sbjct: 3   AAILWVPALFLLVSVTAVLMLRLVIVEEKLQRRIDRAAGTASGAAEKGGEPAQPIHVRIV 62

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               L   V +  L +    E + + LR AG R + +L + +  +L+      +L ++  
Sbjct: 63  M--GLGLAVARSGLLSPRTLEELRHTLRMAGIRDKGALALFVGTKLLSLTGLSVLSLLMS 120

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                         V A ++    G   P + I    ++    ++    DALDL++IC +
Sbjct: 121 RFLHMTAG----HAVIAAVVGAIGGLLLPDIIIQQRRKRFIQKVEGGLADALDLMVICAD 176

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+S++ AL RVA ++      +++E  LT  E+    N + +      RT +D ++   
Sbjct: 177 AGLSLESALVRVAGELQLTHPAVAQEFTLTAQEMRIGGNIRDSLNALGVRTGLDSLKRLA 236

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQ+ +YGT +  +LR L SE R E+L   E++AA L   LT+PMIIF LP + LV+ 
Sbjct: 237 STLIQTLQYGTPLTQALRTLSSELRQEQLTRFEERAARLPVLLTLPMIIFILPCVFLVVG 296

Query: 316 GPAILSIIDTM 326
           GPA+L ++ + 
Sbjct: 297 GPAVLKLLASF 307


>gi|197295161|ref|YP_002153702.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944640|emb|CAR57244.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 324

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 75/321 (23%), Positives = 147/321 (45%), Gaps = 6/321 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                  +  +     + +   +  V +       +++R++                   
Sbjct: 1   MQNLSVVQAVMLGGLFIFVAGGVL-VAMLLFAPRSIQRRIEQAGG---AGAGAIAGPGDG 56

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           D  +SR   +  +      K    K    +  +  +L  AG+R+  +  +    + ++ +
Sbjct: 57  DDLASRWVAKLVELSTPISKLSVPKEGWENSPLRIRLMNAGWRNPSAAALYFTAKTMLAL 116

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                 ++ +       E      +   +    +G+  P+V +S  V+ RQ  I   +PD
Sbjct: 117 GLPCAALLVLITTSLGDERALLSVILVAL--AGIGYYIPNVVLSQRVKVRQQKIFEDFPD 174

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +V+E++  +S  ++ E+ L + E+     ++ A  N   R
Sbjct: 175 ALDLLTVCVEAGLGLDAALMKVSEELRFRSEVVASELDLLLLEMRSGFTKETALRNLALR 234

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 235 TGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFC 294

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L++V++GPA++ +   +
Sbjct: 295 IFPALMVVLLGPAMIHVYRVL 315


>gi|295700365|ref|YP_003608258.1| type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
 gi|295439578|gb|ADG18747.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
          Length = 322

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 78/321 (24%), Positives = 160/321 (49%), Gaps = 7/321 (2%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
               + T++ +       +F+ ++   +      ++ +R++       +   +Q+ +  +
Sbjct: 1   MQTLNITQILLLAGVFAIVFAAVFG-AMHLSTPRDMSRRIEQAGGANAVPAPEQLDAAAQ 59

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
                +L     +  +   K    K       +  +L  AG+RS  ++ + L  +  + +
Sbjct: 60  TPWYEKL----VEISQPISKLSVPKDGWEQSALRVQLMNAGWRSANAVPVYLAAKTALAL 115

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
              +L ++ ++            R   ++++   G+  P+V +S     RQ S+   +PD
Sbjct: 116 TLPLLAMLALY--GSSFASSLLERAIVLVVLAAFGYYLPNVVLSRRTAARQRSLVEDFPD 173

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D +L +V E+I  +S  ++ E+ L + E+    +++ A  NF  R
Sbjct: 174 ALDLLTVCVEAGLGLDASLMKVGEEIRLRSAVVASELELMLLEMRSGFSKEKALRNFSLR 233

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + + +  LIQ++R+GTSIG SLRVL    R+ R M AE++AA +  KL  P++  
Sbjct: 234 TGVEDIDSFSAMLIQAERFGTSIGASLRVLSDTLRTRRRMRAEERAAKIALKLLFPLMFC 293

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L++V++GPA++ I   +
Sbjct: 294 IFPALLVVLMGPAMIHIYRDL 314


>gi|310822671|ref|YP_003955029.1| type II secretion system protein f domain-containing protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395743|gb|ADO73202.1| Type II secretion system protein F domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 296

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 69/229 (30%), Positives = 115/229 (50%), Gaps = 10/229 (4%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
             +  KL  AG  S Y    ++ ++ +  +I LI+G+I   G  + L +         +L
Sbjct: 73  SKMRRKLIKAGDPSGYKPEDIMALQEIGLVIGLIMGLILANGLSQHLAWS--------LL 124

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               G   P++W+++ V++R  +I RA P  LDLL + VE+G+    AL +V E   G+S
Sbjct: 125 AALFGLYYPAIWVNDQVKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVE--KGKS 182

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            PL EEM + + +L     R+ A +    R  +  +     ALIQ+D+ GTS+G  LR+ 
Sbjct: 183 GPLKEEMSIVLKQLKMGKTREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRIQ 242

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            ++ R +R   AEK A     K+  P+I    P + +V+ GP +   + 
Sbjct: 243 STQMRIDRTQRAEKLAGEAPVKMLFPLIACIFPTVFMVLFGPIVFQFMF 291


>gi|148261008|ref|YP_001235135.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|146402689|gb|ABQ31216.1| type II secretion system protein [Acidiphilium cryptum JF-5]
          Length = 307

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 79/311 (25%), Positives = 143/311 (45%), Gaps = 6/311 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            AI    ++F L+    +  L    +E++++                  + +    +R  
Sbjct: 3   AAILWVPALFLLVSVTAVLMLRLVIVEEKLQRRIDRAAGTASGAAEKGGEAAQPIHVRIV 62

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               L   V +  L +    E + + LR AG R + +L + +  +L+      +L ++  
Sbjct: 63  M--GLGLAVARSGLLSPRTLEELRHTLRMAGIRDKGALALFVGTKLLSLTGLSVLSLLMS 120

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                         V A ++    G   P + I    ++    ++    DALDL++IC +
Sbjct: 121 RFLHMTAG----HAVIAAVVGAIGGLLLPDIIIQQRRKRFIQKVEGGLADALDLMVICAD 176

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+S++ AL RVA ++      +++E  LT  E+    N + +      RT +D ++   
Sbjct: 177 AGLSLESALVRVAGELQLTHPAVAQEFTLTAQEMRIGGNIRDSLNALGVRTGLDSLKRLA 236

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQ+ +YGT +  +LR L SE R E+L   E++AA L   LT+PMIIF LP + LV+ 
Sbjct: 237 STLIQTLQYGTPLTQALRTLSSELRQEQLTRFEERAARLPVLLTLPMIIFILPCVFLVVG 296

Query: 316 GPAILSIIDTM 326
           GPA+L ++ + 
Sbjct: 297 GPAVLKLLASF 307


>gi|302037432|ref|YP_003797754.1| pilus assembly protein TadC [Candidatus Nitrospira defluvii]
 gi|300605496|emb|CBK41829.1| Pilus assembly protein TadC [Candidatus Nitrospira defluvii]
          Length = 318

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/318 (22%), Positives = 142/318 (44%), Gaps = 10/318 (3%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
               + +++   +     I  + +      ++ +  + V   R    +    +   +   
Sbjct: 6   MDVTITISLAAFLGCLIGIAGLGLYVAEHRKISRWRRRVEGVRGAEERVAFLASLWNQGR 65

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
             L     +       +          ++ N    AG R      +    +L   ++   
Sbjct: 66  RLLLICGRR-------RTGPTREGEPLSLPNPFATAGLRGSDLPVLFQGAKLFGAVVCP- 117

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             +  +  Y  L   P    +   +     G+  P +W+   ++ RQ +I  A+PDALDL
Sbjct: 118 --LTCLSLYGLLANTPTFFPLILCMASALAGWYGPDLWLQRRIESRQRNILAAFPDALDL 175

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +++CVE+G+S+D A+ RV +++      LSEE+     EL    +RQ A  N   R Q++
Sbjct: 176 MVVCVEAGLSLDVAITRVGQELQLMHRELSEELRALYLELRTGRSRQQALRNAGLRIQLE 235

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V++    L+Q++R+GTS+G +LR      R+ + ++A + AA L  KL +P+I F  P 
Sbjct: 236 EVQSFVALLVQTERFGTSVGQALRAHADGLRTRQDLQATEMAAKLPVKLLLPLIFFIFPS 295

Query: 310 LILVIIGPAILSIIDTMK 327
           L++V++GPA + +I  + 
Sbjct: 296 LLVVLLGPAAIQVIRQLA 313


>gi|302343414|ref|YP_003807943.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301640027|gb|ADK85349.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 305

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 79/313 (25%), Positives = 143/313 (45%), Gaps = 15/313 (4%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           ++++  T +++    +A      G     +R+  +       R               ++
Sbjct: 7   ISISGATGLAVLLAFWACRTLGGGPDPARRRLDELLARNAPPRPAPA-----------IK 55

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            R   +++    K           +   L  AGFRS  +LN+   VRL    +   +   
Sbjct: 56  KRLLGAVKALAPKSERGQGWEKSKLRQDLLTAGFRSVEALNVFTGVRLAAAFLLPAI--- 112

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +F    L++      V + ++   +G+  P   +  L  +R + I R  P  LDLL+I 
Sbjct: 113 -VFALGVLIQAKRPAMVISTLIAAALGYLGPGYVLEKLALRRSALIARQMPSMLDLLVIA 171

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+ +D A++RV+ D+   S  L+ E+ +   EL     R  A  N   R  +D +  
Sbjct: 172 VESGLGLDAAVQRVSRDLAASSPVLAHELAIFSLELKLGAARGDALRNLAKRCGVDEMAG 231

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               LIQ+DR+G SIG S+RV   + R++R  + E++AA +  KL  P++    P ++ V
Sbjct: 232 LVAMLIQADRFGVSIGRSIRVFADDLRTKRRQKLEEQAAKIPLKLLFPVLFLIFPAIMAV 291

Query: 314 IIGPAILSIIDTM 326
           + GPA+++I++ M
Sbjct: 292 MAGPAVINIVEKM 304


>gi|254505024|ref|ZP_05117175.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222441095|gb|EEE47774.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 339

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/329 (20%), Positives = 131/329 (39%), Gaps = 30/329 (9%)

Query: 5   FFDLFDATEL---AVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQI 60
            F+ F    +   AVAI    S+  +IY + +PSL    + + RM +V+      R Q  
Sbjct: 3   VFEQFMTPAITGAAVAILVMFSVGGIIYGLFLPSLSGTKKRDARMSAVSA-----RPQSE 57

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFRSEYSLNILLVV 119
           T  +    ++R +      L++F ++   K        +  K+  AG   E+ +  L++ 
Sbjct: 58  TQRKTMRDTNRRKKSIQDQLKDFEERQKAKHEKQKNVPLKVKIEQAGL--EWEMRHLVLF 115

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
            +V  I+F ++ +I                + A       G   P  +I N  ++R ++ 
Sbjct: 116 SVVSAILFFVISLIASGNL-----------LIAAAFTFVGGIGFPRWYIGNKRKRRFNAF 164

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
               P+ +D+++  V++G+ +   ++ VA +      P++ E            +   A 
Sbjct: 165 LNELPNGIDIIVRGVKAGLPLSDCVKVVAREARE---PVATEFRKVTETQVMGVSLAEAL 221

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
               +R  +         +    + G  + ++L  L    R  + M+A+ KA S   K +
Sbjct: 222 SKMPDRVPLPETNFLAIVVSIQQKAGGGLAEALGNLSRVLRQRKAMKAKIKALSSEAKSS 281

Query: 300 VPMIIFFLPVL---ILVIIGPAILSIIDT 325
              II  LP +   IL  I P  + I+ T
Sbjct: 282 AA-IIGALPFVVGGILFFIAPDYMMILFT 309


>gi|260775648|ref|ZP_05884544.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608064|gb|EEX34233.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 292

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 124/309 (40%), Gaps = 24/309 (7%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            V   + V++ + +  + +    +   +K+ +++++            +  +       T
Sbjct: 4   IVLFISLVAVSAGVLFLGVLFFKTMAKKKKFRALSIG------GAADRVAHEEDQLNRET 57

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R    L              + ++  KL  AG  +       L V+     + ++     
Sbjct: 58  RWYGFL-----------YQENGDMEQKLERAGIYNNRWAGFYLPVKYTTAFVGVVA---- 102

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
              Y   L      ++  + L        P +++ +  +  Q  I    P  LDL+ +CV
Sbjct: 103 --LYSSTLGITSMKQLAIIALWLIAVIVVPDLYLEHRRKVLQDKISNQLPYLLDLMAMCV 160

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G++++ +++ ++ ++      L   M +             A +  Y R     VR+ 
Sbjct: 161 QTGMTVEASIQYLSSELSALDKDLGHTMNIVNERSRL-VGLDQALDELYQRFPATEVRSF 219

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L QS RYG++I   L  L S+ R  R++  E+K   L  K++VP+I+F L  ++++I
Sbjct: 220 VMTLKQSLRYGSAIYSVLNNLASDIREVRVLALEEKIGKLSAKMSVPLILFILIPIVILI 279

Query: 315 IGPAILSII 323
             P I+ ++
Sbjct: 280 AAPGIMRLM 288


>gi|170734860|ref|YP_001773974.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169820898|gb|ACA95479.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 324

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/321 (22%), Positives = 150/321 (46%), Gaps = 6/321 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                  ++ +     + +   +  V +       +++R++               +   
Sbjct: 1   MQNLSVVQVVMLGGLFIFVAGGVL-VAMLLFAPRGIQRRLQQAGG---TGAGGVAGAGDG 56

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           +  +SR   +  +      K    K    +  +  +L  AG+R++ +  +    + ++ +
Sbjct: 57  EDMASRWVAKLVELSSPISKLSVPKEGWENSPLRIRLMNAGWRNQSAAAVYFTAKTMLAL 116

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                 ++ +       E      +   +    +G+  P++ +S  V+ RQ  I   +PD
Sbjct: 117 GLPCAALLALITTSLGDERALLSLILVAL--AGIGYYIPNIVLSQRVKVRQRKIFEDFPD 174

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +V+E++  +S  ++ E+ L + E+     ++ A  N   R
Sbjct: 175 ALDLLTVCVEAGLGLDAALMKVSEELRFRSEVVASELDLLLLEMRSGFTKETALRNLALR 234

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 235 TGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFC 294

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L++V++GPA++ +   +
Sbjct: 295 IFPALMMVLLGPAMIHVYRVL 315


>gi|319951073|ref|ZP_08024926.1| Type II secretion system F domain protein [Dietzia cinnamea P4]
 gi|319435233|gb|EFV90500.1| Type II secretion system F domain protein [Dietzia cinnamea P4]
          Length = 300

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 77/314 (24%), Positives = 143/314 (45%), Gaps = 16/314 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L+ A+   V   S+         G   +  R ++VA  R  +     + +          
Sbjct: 3   LSAALAVFVLTASMFLLAFAVFSGRDTV--RARTVANLRRGIDDGFASQVDLTGVDDDDS 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                 +   +  +     L   +I      AG    +S+  L+V ++VVP+I ++LG+ 
Sbjct: 61  RSRLYEVARRLTPVGTVRRLEKLSIR-----AGRPRGWSIQRLVVAKIVVPLIVVLLGLA 115

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +         P  L +   +    V +  P + + +  Q+R   I     D LD + I 
Sbjct: 116 LL------RTNPEPLLLLLTLGTAVVCYFLPELLLQSRGQERNDEIALELADTLDQMTIA 169

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+  D A+ R   +    + PL++E++ T+ E+     R+ A+E    RT +  +R 
Sbjct: 170 VEAGLGFDAAMARAGRN---GTGPLAQELIRTLQEIQVGQLRRTAYEQLALRTDVPDLRR 226

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             +A+IQ+D YG S+ D LR   SE R +R   AE+KA  +  K+  P+++  LPVL +V
Sbjct: 227 FIRAIIQADAYGISVADVLRTQASEMRLKRRQRAEEKAQQVPVKVIFPLLVCILPVLFIV 286

Query: 314 IIGPAILSIIDTMK 327
           ++GP ++++++   
Sbjct: 287 LLGPTVINMMEAFS 300


>gi|171320623|ref|ZP_02909643.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171094136|gb|EDT39223.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 314

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 80/284 (28%), Positives = 148/284 (52%), Gaps = 1/284 (0%)

Query: 44  RMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLR 103
           R +  A  ++   ++ ++          +R   ++ L    ++L +   +    +  +L 
Sbjct: 32  RRRIAARVQQAAGQRSLSLAAGRLQPGEVRQDLTRRLAQLGERLPVLDPMQRVKLGLQLT 91

Query: 104 AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA 163
            AGFR   +++ ++ ++L   ++F  L I++     +L E+ F +R  A++    +G   
Sbjct: 92  RAGFRERRAVSTMIGIKLSCGVLFAGLAIVFSPYIPRLGEF-FVIRAVAMVGAFVIGVIV 150

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++E+ 
Sbjct: 151 PEYVLGAVIRRRRRIIAACFPDALDLLVICTMAGNSLASGVRRVARELERICPPLADELT 210

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R+E+
Sbjct: 211 VCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSERTEQ 270

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           ++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 271 VVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 314


>gi|78060306|ref|YP_366881.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
 gi|77964856|gb|ABB06237.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
          Length = 324

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 72/321 (22%), Positives = 142/321 (44%), Gaps = 6/321 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                  +  +     + +   +  + +       +++R++                   
Sbjct: 1   MQNLSVVQAVMLGGLFIFVAGGVL-IAMLLFAPRSIQRRLQQAGGAGATGAAGTGDGDDM 59

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
            S         S  +         K    +  +  +L  AG+R++ +  +    +  + +
Sbjct: 60  ASRWVAKLVELSTPISKLS---VPKEGWENSPLRIRLMNAGWRNQSAAALYFTAKTALAL 116

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                 ++ +       E      +   +    +G+  P++ +S  V+ RQ  I   +PD
Sbjct: 117 GLPCAALLVLITTSLGDERAILSAIL--VAFAGIGYYIPNIVLSQRVKVRQQKIFEDFPD 174

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +V+E++   S  ++ E+ L + E+     ++ A  N   R
Sbjct: 175 ALDLLTVCVEAGLGLDAALMKVSEELRFSSEVVASELDLLLLEMRSGFTKETALRNLALR 234

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 235 TGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFC 294

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L+LV++GPA++ +   +
Sbjct: 295 IFPALMLVLLGPAMIHVYRVL 315


>gi|319782178|ref|YP_004141654.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168066|gb|ADV11604.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 316

 Score =  133 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 65/318 (20%), Positives = 133/318 (41%), Gaps = 7/318 (2%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            F         V+I   V+  S      +  L + +  K +        ++ +       
Sbjct: 1   MFSNIQDLGFLVSIAVFVAAVSFFLFGALVFLPALQTRKLVAQ-----SLMGEGITDRRS 55

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                   +    + +  + K +  +       +  KL  AGF    +  I  + RLV  
Sbjct: 56  MLGQDQLAKLAAQRPVDAYFKSIEKERE-EPNALEAKLFRAGFYQSTAPLIYTLSRLV-A 113

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +    L +  +         P  + +    L G      PS+ +      ++   +RA+P
Sbjct: 114 VCLGFLAMYALLSRVLPPHLPGFITLAGSALFGLACMVIPSILLDRFENSQKQIYRRAFP 173

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           D +D+++ C ++G+S++ A+ RV+ ++      L  ++ +   +L      + A     +
Sbjct: 174 DFMDMMITCADAGMSLEGAVERVSHEMAATHKWLGIQLSIMNLQLRAGKPLREALRELAD 233

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  +D  R       QS+  GTS+ D+LRV  +E R +R++ AE++A SL  K+ +P+ +
Sbjct: 234 RIGLDEARALAVLFRQSEELGTSLTDALRVYSAEMRGQRILSAEERANSLPVKMMIPLGL 293

Query: 305 FFLPVLILVIIGPAILSI 322
              PV+++VI+ P I+ +
Sbjct: 294 CIFPVVMMVIMLPVIIRM 311


>gi|186474108|ref|YP_001861450.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184196440|gb|ACC74404.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 323

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 86/318 (27%), Positives = 151/318 (47%), Gaps = 3/318 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
               ++ +       +F   +   +  L    L++R+  +A     +   +      +  
Sbjct: 1   MQTEQILLLTAMFAIVFGAAW-KAMSLLRPDPLKRRIDGIAAASSGVAGMEGEPGVAEDE 59

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           S       +K   +  +    K       +  +   AG RS+ +  +    + ++ ++  
Sbjct: 60  SPAWMETVAKVSHHVARLSLPKDDWDKSALRRRFANAGLRSDSAPALYFAAKTLLALVLP 119

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L ++ I            L       +  +GF  P+V +S LV+ RQ +I    PDALD
Sbjct: 120 ALALVSITLLAGADGDKLLLVAALA--MAALGFYLPNVVLSRLVEARQRTIFEDLPDALD 177

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+ +CVE+G+ +D A++RVAE+IG +S  L +E+ L + EL     R  A  N   RT +
Sbjct: 178 LMTVCVEAGLGLDAAMQRVAEEIGVKSRALKDELELVLLELRAGSARDKALRNLALRTGV 237

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +   T  LIQ+DR+GTS+GDSLRV +   R+ R + AE++AA +  KL  P++    P
Sbjct: 238 EDIDTLTSMLIQADRFGTSVGDSLRVFIDALRTRRRLRAEEQAAKIALKLLFPLMFCIFP 297

Query: 309 VLILVIIGPAILSIIDTM 326
            LI+V+IGPA + +   +
Sbjct: 298 TLIVVLIGPAAMRVAHQL 315


>gi|167836684|ref|ZP_02463567.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis MSMB43]
          Length = 310

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 77/290 (26%), Positives = 139/290 (47%), Gaps = 6/290 (2%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENI 98
             + +R++ VA      R      +   ++   +  R  + +    + + +        +
Sbjct: 27  KRIAQRVRQVAA-----RTAAEVQVGASASVQPVSQRVKRRIALLGELVPILDAEQRTKV 81

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
             +L +AGFR   ++++L  ++L+V  +   LG+I    +   +   F  R   +     
Sbjct: 82  AQRLISAGFRDRRAVSVLAGLKLLVG-VGFALGMIVGASHVPRIGEYFVFRALMMAGAFM 140

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G   P   +  ++++RQ  I    PDALDLL+IC  +G S+  A++RVA ++     PL
Sbjct: 141 IGMMLPEFVLDLMIRQRQKRIAAYLPDALDLLVICTNAGNSLVVAIKRVASELKMICPPL 200

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           ++E  +T  EL    +   A      R  +   R     L+QS +YGT I  SLR L   
Sbjct: 201 ADEFAVTADELQIGGDISSALNALAKRIAVPSTRALVTTLVQSQQYGTPITQSLRQLSRT 260

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            RS +++  E+KAA L PK+++PM++F +P + L+  GPAI+ +I     
Sbjct: 261 ERSMQIVALEEKAAKLAPKMSLPMLLFIMPTVALIAAGPAIIRLIALFPK 310


>gi|284048519|ref|YP_003398858.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952740|gb|ADB47543.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 309

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 66/318 (20%), Positives = 139/318 (43%), Gaps = 12/318 (3%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             L+++I  A+  +  +  + +  +   E+++R+++    RE  + Q+      D     
Sbjct: 2   LALSLSIALALFFYLSLSVLALKKIQGEEVKRRLETF---REEEKPQEAEDNPNDLKKIP 58

Query: 72  LRTRDSKSLRNFVKKL--NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           L  R    L               + + +  ++  AG +  +    L+ +  V  I +  
Sbjct: 59  LYQRTIGRLLAQAMDFFSKFAPSALPQMMEQRIILAGKQGIWKPRTLVGIWFVSMIFWGF 118

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
            G  +  G+           +  +      G   P   ++++++ RQ+ I R  PD LDL
Sbjct: 119 QGFRYTTGHPM----STFGGLVLIWGCLLFGAMLPFGVLNHIIRNRQTKIIRQLPDVLDL 174

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L I V++G+S+D A+R+V E + G   PL +E    + ++     R+ + +    R  + 
Sbjct: 175 LSISVQAGLSLDGAMRKVVERMEG---PLIDEFRRMLRDVRMGMTRRRSMQLMARRCDVQ 231

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V     +++QS+R G S+ D+L +     R  R   A  +A     K+  P++    P 
Sbjct: 232 DVYLFVMSVVQSERLGASMSDTLVIQADNMRDLRRQRARTQAMKAPVKMIFPLVFCIFPA 291

Query: 310 LILVIIGPAILSIIDTMK 327
           + +V++ P+++S++  MK
Sbjct: 292 IFVVVLLPSLISLMQGMK 309


>gi|78062901|ref|YP_372809.1| type II secretion system protein [Burkholderia sp. 383]
 gi|77970786|gb|ABB12165.1| type II secretion system protein [Burkholderia sp. 383]
          Length = 314

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 74/284 (26%), Positives = 139/284 (48%), Gaps = 1/284 (0%)

Query: 44  RMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLR 103
           R +  A  R+   +    S+        +R   ++ L    ++L +   +    +  +L 
Sbjct: 32  RQRIAARVRQAAGQHPPASVAGWLQPGGVRLDLTRRLAQLGERLPVLDPMQRVKLGLQLT 91

Query: 104 AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA 163
            AGFR   ++++++ ++L    +    G I            F +R  A+I    +G   
Sbjct: 92  RAGFRERRTVSVMIGIKLSCG-VLFACGAIVFSPLIPRFGDYFVIRALAMIAAFVIGVIV 150

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++E+ 
Sbjct: 151 PEYVLGAMIRRRRRIIAACFPDALDLLVICTMAGNSLASGIRRVAHELARICPPLADELT 210

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           +   EL+   +      +F  R      R+    L QS R+GT I  +LR L    R+E+
Sbjct: 211 VCADELTLSGDVAATLTHFAMRVDFTSARSLATTLTQSQRFGTPITQALRTLSRTERTEQ 270

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           ++  E++AA L PK+T+PM++F LP + L+  GPA + +++  +
Sbjct: 271 IVALEERAAKLAPKITLPMMLFILPTVCLIAAGPAAIRLLEVFR 314


>gi|209515956|ref|ZP_03264817.1| type II secretion system protein [Burkholderia sp. H160]
 gi|209503614|gb|EEA03609.1| type II secretion system protein [Burkholderia sp. H160]
          Length = 316

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 80/273 (29%), Positives = 136/273 (49%), Gaps = 1/273 (0%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           +R      L+ +   + L  R  K   +  +++ +        +  +L  AGFR   +++
Sbjct: 45  MRADSHPQLRAEEHVADLWQRLLKRFASLGERVPVGGAAQRNKLGEQLVRAGFRERRAVS 104

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           +++  +L+   +   L  I I  Y   +   F  R   +  +  VG   P + ++ L+ +
Sbjct: 105 MMIGFKLLAGAL-FALAAIVIGPYVPRIGEYFVFRALMMGGVFIVGMILPEIALNALISR 163

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           RQ +I    PDALDLL+IC  +G S+   ++RVA ++     PL++E  +   EL    +
Sbjct: 164 RQKAIASCLPDALDLLVICTNAGNSLVVGVKRVARELETICPPLADEFAVAGDELQVSGD 223

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
              A  N   R  +  VR     LIQS +YGT I  SLR+L    R+ ++M  E+KAA L
Sbjct: 224 SAGALRNLAARIGLPSVRALVTTLIQSQQYGTPITHSLRMLSRAERTAQMMALEEKAAKL 283

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
             K+T+PM++F LP + L+  GPA++ +I   K
Sbjct: 284 ATKMTMPMMLFILPTVGLIAAGPAVIRLIAVFK 316


>gi|147677788|ref|YP_001212003.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
 gi|146273885|dbj|BAF59634.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
          Length = 307

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 71/316 (22%), Positives = 133/316 (42%), Gaps = 14/316 (4%)

Query: 15  AVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVA-VEREILRKQQITSLQKDSASSRL 72
            +A+     +F +I  +         E+E R+  V       LR+Q++ +         L
Sbjct: 4   LIAVFIFTEVFLVILLLYNIISKERQEVESRVAKVVGSRTPTLREQELKAPLFQRIIKPL 63

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             R S  +   +          +  +  K+  AG   + +   LL ++ +          
Sbjct: 64  LARLSLFMVKML------PAEKEAELAGKISRAGLSQKITPRELLALKYLAAAGT---AT 114

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
             +     +        +        +G+  P + ++  +  R+  I+++ PD +DLL +
Sbjct: 115 TLLITGKIMAGRSLFQIILLGTAGLALGWFVPELLLNKKILDRKKEIEKSLPDVMDLLTV 174

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            VE+G+S D AL +V E   G    LSEE    + E+     R  A  +   R  +D + 
Sbjct: 175 SVEAGLSFDGALMKVTEKKRG---VLSEEFTKMLQEIKIGRPRLEALRDLSRRLDVDDLS 231

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
               A+I +D+ G SIG+ LRV   + R +R   AE+ A     K+ +PM++F  P + +
Sbjct: 232 AFAGAVILADQLGISIGNILRVQSDQIRMKRRQAAEEMAMKAPVKMLIPMVLFIFPAIFV 291

Query: 313 VIIGPAILSIIDTMKD 328
           V++GPA++ I     +
Sbjct: 292 VLLGPAVIQISKAFSN 307


>gi|115376389|ref|ZP_01463626.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
 gi|115366596|gb|EAU65594.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
          Length = 238

 Score =  132 bits (331), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 69/229 (30%), Positives = 115/229 (50%), Gaps = 10/229 (4%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
             +  KL  AG  S Y    ++ ++ +  +I LI+G+I   G  + L +         +L
Sbjct: 15  SKMRRKLIKAGDPSGYKPEDIMALQEIGLVIGLIMGLILANGLSQHLAWS--------LL 66

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               G   P++W+++ V++R  +I RA P  LDLL + VE+G+    AL +V E   G+S
Sbjct: 67  AALFGLYYPAIWVNDQVKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVE--KGKS 124

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            PL EEM + + +L     R+ A +    R  +  +     ALIQ+D+ GTS+G  LR+ 
Sbjct: 125 GPLKEEMSIVLKQLKMGKTREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRIQ 184

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            ++ R +R   AEK A     K+  P+I    P + +V+ GP +   + 
Sbjct: 185 STQMRIDRTQRAEKLAGEAPVKMLFPLIACIFPTVFMVLFGPIVFQFMF 233


>gi|219883050|ref|YP_002478214.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219862056|gb|ACL42397.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 293

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 77/308 (25%), Positives = 144/308 (46%), Gaps = 17/308 (5%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
            +V++      V +P L       R KS  V RE L +    S +  +A  R       S
Sbjct: 3   ASVTLAIYAITVSVPLLLWCVFLGRDKSREVVRENLFRGFEESSKDSTAGRRW------S 56

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           L    ++  +   +    +      AG  + + L  ++  + V+ ++  +LG++      
Sbjct: 57  LAATARRFTMPRAI--ARLDRLHALAGRPAAWPLERVIAAKPVLAVVAFLLGLLLY---- 110

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                P    +  VI +    +  P + + +  Q+RQ  I    PD LD ++I VE+G+ 
Sbjct: 111 --TGRPGAPLMLLVIAVTVTAYFVPDLLLQSRGQERQKLIGLELPDTLDQMMIAVEAGLG 168

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
            D A+ R  +   G   PL+ E++ T+ ++    +R+ A+E    RT +  +    ++++
Sbjct: 169 FDSAMARAGDKGKG---PLANELVRTLQDMQIGRSRREAYEALGERTSVPDLDAFIRSVV 225

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q+D YG SI   LR    E R +R   AE+KA  +  K+ +P+++  LPVL + ++GPA+
Sbjct: 226 QADIYGISISKVLRTQAGEIRLKRRQRAEEKAMQIPVKVIIPLMLCILPVLFIALLGPAV 285

Query: 320 LSIIDTMK 327
           L++I+   
Sbjct: 286 LNVINQFG 293


>gi|254486463|ref|ZP_05099668.1| type II secretion system protein [Roseobacter sp. GAI101]
 gi|214043332|gb|EEB83970.1| type II secretion system protein [Roseobacter sp. GAI101]
          Length = 320

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 74/317 (23%), Positives = 143/317 (45%), Gaps = 2/317 (0%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                L +       + + + A+ +      +   R   +       + +          
Sbjct: 1   MSDASLHIFWMAFAGLSTAMLALTVLLYLERQRSLRDARLRRANGTSQPRPTLDNATSPG 60

Query: 69  S-SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
               L  +   ++    ++L++            L +AG+RS  +L I   ++ VVP+  
Sbjct: 61  MVGSLARQVRHTVATIGQRLSVVLGGEARETAADLASAGYRSRDALLIYAFLKTVVPMAA 120

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L+ G++W+     +      +    VI           +++    + R   I+ ++PD L
Sbjct: 121 LMAGLVWLGLTTPV-GIDMLIPAAMVIGTALALSKGVDMYVDLRRKNRLGRIRHSFPDML 179

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           +L++I  E+G+    AL RVA+++      L+ EML  ++E++   + + A+     R  
Sbjct: 180 ELIVITSEAGLGPQPALHRVAQEMSLSHPELAREMLQMVSEMAMTNDCRGAYAKMNLRVP 239

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +   TQ L QSDRYGT    ++R L+ E R  RLM  E+KAA L   +T+P+I   +
Sbjct: 240 LPEIGIFTQTLDQSDRYGTPFSRAMRTLIIEQRGNRLMAIEEKAARLPVLMTLPLIFCIM 299

Query: 308 PVLILVIIGPAILSIID 324
           P + +V++GPA+LS++D
Sbjct: 300 PAVFVVLVGPAVLSVLD 316


>gi|168699471|ref|ZP_02731748.1| probable secretion system protein TadC [Gemmata obscuriglobus UQM
           2246]
          Length = 307

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 73/310 (23%), Positives = 134/310 (43%), Gaps = 4/310 (1%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +           AV + +L +  L +   +  V R + R +++        +       +
Sbjct: 1   MLALAVGGLAFGAVALGALAAVRLLEERPTHDVGRALRRLRELNGAAAPGDAGEAGGWLA 60

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
                   +L  ++      + ++L  AG+R   ++      +    ++ +I       G
Sbjct: 61  TVGAWLGSRLAFRSGARAVELADRLALAGYRHPSAVLCYGAAQ----LVLMIAPAATAGG 116

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
               LE  +   +      G  G  APSV +   ++KRQ  I+ A PDALD++++ VE G
Sbjct: 117 AAFTLEGAWNKVLLWAAAGGAAGLVAPSVLLGARIEKRQRLIRNALPDALDIMVLSVEGG 176

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
            S++ AL   A++I      L  E+L+   E+    +   AF+ F  R  +   R+   A
Sbjct: 177 SSLNAALMWAADEIRDVHPVLGAELLVVQREVQLGLSMGDAFQGFARRCGIPEGRDLAAA 236

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LIQS++YG S+G +LR      R +R   AE+ A     K+  PM++   P + +V++GP
Sbjct: 237 LIQSEKYGASVGKALRTFADSARQDRQAWAEEVAQKASVKVVFPMLLCIFPAIFIVLLGP 296

Query: 318 AILSIIDTMK 327
           A + +     
Sbjct: 297 AAVQMSQLFA 306


>gi|323702118|ref|ZP_08113786.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
 gi|323533000|gb|EGB22871.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
          Length = 310

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/321 (20%), Positives = 142/321 (44%), Gaps = 12/321 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKDS 67
            D      A+    ++   I  +     G   ++ +RM  V     +L  ++I       
Sbjct: 1   MDKWLYISAVLVFFTVSFSILVIYRFIFGERLQVVQRMDQVVGTPSLLPIREIELNVPLY 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             +        S+   + +        +  +  K+ AAG     ++   +V++ ++    
Sbjct: 61  QRAIR--PALGSIAKLLTRFIPT--AREAALNKKVAAAGQPGNLNVREWMVLKYLLATTL 116

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
                  ++ +  L+       +    +   +G+ +P ++++  +++R++ +++A PDAL
Sbjct: 117 G----FLLWSWGGLMSKSLPQCLLLAGVGVPLGWLSPDLFLNARIRQRKNQVEKALPDAL 172

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL + VE+G+  D AL +VAE     +  L++E +L + E      R+ A  +  +R  
Sbjct: 173 DLLTVSVEAGLGFDCALMKVAEQ---SNSVLADEFVLMMQECHMGKPRREALRDMADRVD 229

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D +     ++I +D  G SIG+ LR    + R +R    E+ A     K+  PM++F  
Sbjct: 230 VDDLSTFCGSIILADTLGISIGNILRTQSQQIRQKRRQRTEELAMKAPIKMLFPMVLFIF 289

Query: 308 PVLILVIIGPAILSIIDTMKD 328
           P + ++++GPA L I+    +
Sbjct: 290 PAIFVILLGPAALQIMQAFNN 310


>gi|220922536|ref|YP_002497838.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947143|gb|ACL57535.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 303

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 68/313 (21%), Positives = 132/313 (42%), Gaps = 20/313 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            V+    +S+ +L Y         G + +RM++     E      + + +K    +    
Sbjct: 9   MVSAAVFLSVAALTYLSTTYVGQRGTVRQRMRAARRTSEREHTPYLPAERKGRLEAIFGV 68

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            +S   R  +                 L   GF +  ++      +L +     I     
Sbjct: 69  NESTIQRQRLD----------------LLRGGFFNPNAVEYFNFTKLTLVFALPICACAM 112

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
              +    +     +   V     + +  P  ++S   + ++ + + A+PD LDLL++CV
Sbjct: 113 ---FAFRSDLSSLTKFALVSGSLLLAYYIPDAFVSRRQRLQKEAYRSAFPDMLDLLVVCV 169

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G+S++ A  RV  ++  +S  L   + +  +EL          +    R  +D  R+ 
Sbjct: 170 DAGLSLEAAFDRVGSEM-DESGALRVNLAIMASELRNGRGFVDGLQGLAERLDIDEARSF 228

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L QS   GT I  SLRV   E R++R+M AE+KA +L  K+ +P+  F  PV+++V+
Sbjct: 229 AILLQQSLELGTDISQSLRVYSDEMRNKRMMRAEEKANALPVKIVLPLGAFIFPVILIVV 288

Query: 315 IGPAILSIIDTMK 327
           + P ++ II  + 
Sbjct: 289 MVPIVIRIIAVLG 301


>gi|221633000|ref|YP_002522225.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
 gi|221157259|gb|ACM06386.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
          Length = 303

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 80/289 (27%), Positives = 129/289 (44%), Gaps = 9/289 (3%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLK--AILVDENI 98
             +R + V  ER     Q+  SL     +   R R    L   +    L+         I
Sbjct: 22  RAERRQVVLEERLARFAQRPPSLDDLELAVPFRHRVILPLAERLAHFVLRFTPGASLHRI 81

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
             +L  AG          L +R  + +      I+           P Q RVG   ++  
Sbjct: 82  EQRLVEAGLDGSLRPLTFLGLRFGLALTMASFAIVLTLA----GSGPVQYRVGLPFVLAA 137

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P+ W+S  + +R+ +I+RA PDA+DLL+I VE+G+  DQAL RV E        L
Sbjct: 138 LGWIVPNAWLSRRIAQRKRAIQRALPDAIDLLVISVEAGLGFDQALLRVVEK---WDNEL 194

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
           + E   T++E+     R+ A  +   R  +D +     +L+Q+D+ G SI   LR   ++
Sbjct: 195 TREFARTLSEMRMGIPRRQALRDLARRVNVDDLNVFIASLVQADQLGVSISQVLRAQANQ 254

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            R  R   A++ A     K+  PM+    P L +VI+GPAI  I++  +
Sbjct: 255 MRLRRRQRAQELAHKAPIKMIFPMVFLIFPALYVVILGPAIPRIVEAFR 303


>gi|254255261|ref|ZP_04948577.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
 gi|124900998|gb|EAY71748.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
          Length = 324

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 74/321 (23%), Positives = 146/321 (45%), Gaps = 6/321 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
               +  +  +     V +    +A  +       +++R++               + + 
Sbjct: 1   MQNLNVVQAVMLGGLFVFVAGGAFA-AMLLFAPRNIQRRLQQAGGASAAAAAGVGDAGEP 59

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
            +         S  +         K    +  +  +L  AG+R + +  +    + V+ +
Sbjct: 60  AARWVAKLAELSTPISKLS---VPKDGWENSPLRIRLMNAGWREQSAAALYFTAKTVLAL 116

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                G + +            L    ++ +  +G+  P++ +S  V  RQ  I   +PD
Sbjct: 117 ALP--GAVLLSVITTRFADERALLSVLLVALAGIGYYVPNLVLSQRVAARQQKIFEDFPD 174

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +V+E++  +S  ++ E+ L + E+     ++ A  N   R
Sbjct: 175 ALDLLTVCVEAGLGLDAALMKVSEELRFRSDVVAGELDLLLLEMRSGFTKETALRNLALR 234

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 235 TGVEDIESFCAMLIQADRFGTSISESLRVLSDLLRTRRRMRAEERAAKIALKLLFPLIFC 294

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L++V++GPA++ +   +
Sbjct: 295 IFPALMVVLLGPAMIHVYRVL 315


>gi|59711125|ref|YP_203901.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
 gi|59479226|gb|AAW85013.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
          Length = 290

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/247 (21%), Positives = 117/247 (47%), Gaps = 5/247 (2%)

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
              L  ++K    +    +E I  KLR AG+ +   +++ + ++  V +I  ++  I  +
Sbjct: 46  ENELGGWLKNKASELNPDEEEIKQKLRQAGWENTQYVHLFMPIKYSVLLIGEVIFGIAYY 105

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                        V A  L       AP +++   ++ R   +    P  LDL+ +CV++
Sbjct: 106 ----QSFLSSTAWVIAASLWMVFVIIAPDMYLQAKIKARVHRVSTQMPYLLDLMAVCVQT 161

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G++++ +L  + +++ G +  L++ +             + + E  Y     + +R+   
Sbjct: 162 GMTVEASLSYLVKEMKGFNKDLTQVLTKMNERSRM-VGLEKSLEEMYVEIPSNEMRSFVM 220

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L QS  YG+SI + L  L S+ R  +++E E++   L  K++VP+I+F +  ++++I  
Sbjct: 221 TLTQSMHYGSSIYNVLTTLASDIREVQMLELEERIGKLAAKMSVPLIVFIMIPIVILIAA 280

Query: 317 PAILSII 323
           P ++ ++
Sbjct: 281 PGVMRLM 287


>gi|269836553|ref|YP_003318781.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785816|gb|ACZ37959.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 307

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 72/286 (25%), Positives = 128/286 (44%), Gaps = 13/286 (4%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
           +E+R+         L + ++     +     L  R +  +  F  K + +       +  
Sbjct: 33  IEERLSQYGHRVPTLEELELQQPFNERVLKPLLRRLAGMMSRFAPKTSHQR------LRQ 86

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           KL  AG  +         +R+++           +F    +        +    + G +G
Sbjct: 87  KLVEAGNPANLGPAEFTGLRVLLAGGLGG----LLFVLFLMSGSSLTNLILFPAVAGGIG 142

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P VW+ N +++R+S+I RA PDA+DLL I VE+G+  D AL+RV E        L+ 
Sbjct: 143 YLLPGVWLGNRIKRRKSAIIRALPDAIDLLTISVEAGLGFDPALQRVVEK---WDNELTR 199

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E    ++E+    +R+ A  +   RT +D +     A++Q+D+ G SI   LRV   + R
Sbjct: 200 EFARMLSEIRMGQSRREALRDLAERTNVDDLNVFVSAVVQADQLGVSITQVLRVQSKQMR 259

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             R   AE++A     K+  PM+    P L +V++GPA+  + D  
Sbjct: 260 MRRRQRAEEQAHKAPVKMIFPMVFLIFPALYIVLLGPAVPIVWDAF 305


>gi|148657456|ref|YP_001277661.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148569566|gb|ABQ91711.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 309

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/314 (19%), Positives = 126/314 (40%), Gaps = 8/314 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L +          L+ A +        + +R+ +             +       + R+ 
Sbjct: 2   LLIPGIITALAILLVVAGLTTVRRDVTVGERLDAYLSPTVEKMNPTPSLEATKPFAERVV 61

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K        L  +     E +  +L  AG+    +    +  +    I+ +++ ++
Sbjct: 62  IPLLKRAARAFAWLLPQN--RYEALRLRLAMAGYPWGVTAADFVGAK---GIVLVLVTLV 116

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                      P    +  +  IG+  F  P VW+S  +++RQ+ +  A PDALDLL I 
Sbjct: 117 AGAFGWMAGAAPTFFNLLLLGGIGFCAFFLPDVWLSRRIRQRQTELLNALPDALDLLAIA 176

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
             +G+S + A++ +       +  L+ E    + ++S    R+ A  +   RT +  + +
Sbjct: 177 SAAGLSFESAMQEITSK---WTNELAREFSRVLRDMSMGVPRRQALTDMAERTGVSDIAS 233

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              A+ Q++  G SIG  L V   E R+ R   A+++A     K+  P++    P +  V
Sbjct: 234 FVSAVKQAEALGISIGRVLTVQADEMRTRRRQRAQERANQAPVKMMFPLVFLIFPAIFAV 293

Query: 314 IIGPAILSIIDTMK 327
           ++GPA+  +++   
Sbjct: 294 LLGPAVPQLLEAFG 307


>gi|326797332|ref|YP_004315152.1| type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
 gi|326548096|gb|ADZ93316.1| Type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
          Length = 316

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 69/315 (21%), Positives = 144/315 (45%), Gaps = 3/315 (0%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           ++ +       + +    ++   + +       +  + +          SL  ++  +  
Sbjct: 4   QMILPALIGFFLCAAGMVLLALYVRTKPKTLAERLASQQDHASTTAHEASLLIEANMATS 63

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             R   +  + + +  +            L  AG R   SL +    +L    + L L +
Sbjct: 64  WWRKCLAPIDRIGQELVGTESDRFATRKLLLMAGLRHSQSLGLYTFGKLA---VGLFLSV 120

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +++F   +  +      +   ++I ++   +  +W+      R   +  + PDALDL++I
Sbjct: 121 MFVFFVLEKGDRLSLSALAGSLIILFLSSFSAEIWLKMRAASRGGKLSSSLPDALDLMVI 180

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C E+G+ + +  + V++++   S  L+EE+  T AEL  L +R  A  N  +R  +D V 
Sbjct: 181 CAEAGLPLGRIFKTVSKELAFSSPELAEEIGYTHAELQILSDRSKALMNLADRCGVDNVA 240

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                LIQ++RYGT +  +LR +  E+R   ++E E+KA  L  +L+VP+++F LP +I 
Sbjct: 241 AMVSTLIQAERYGTPLSQALRTISVESRKNMVLELEEKAGKLPAQLSVPLMVFILPPVIA 300

Query: 313 VIIGPAILSIIDTMK 327
           ++  PA++ II  + 
Sbjct: 301 MMGTPAMIRIIRMLG 315


>gi|172062964|ref|YP_001810615.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171995481|gb|ACB66399.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 314

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 79/284 (27%), Positives = 147/284 (51%), Gaps = 1/284 (0%)

Query: 44  RMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLR 103
           R +  A  ++   ++ ++          +R   ++ L    ++L +   +    +  +L 
Sbjct: 32  RRRIAARVQQAAGQRSLSLAAGRLQPGEVRQDLTRRLAQLGERLPVLDPMQRVKLGLQLT 91

Query: 104 AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA 163
            AGFR   +++ ++ ++L   ++F    I++     +L E+ F +R  A++    +G   
Sbjct: 92  RAGFRERRAVSAMIGIKLSCGVLFAGFAIVFSPYIPRLGEF-FVIRAVAMVGAFVIGVIV 150

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P   +  ++++R+  I   +PDALDLL+IC  +G S+   +RRVA ++     PL++E+ 
Sbjct: 151 PEYVLGAMIRRRRRIIAACFPDALDLLVICTMAGNSLASGVRRVARELERICPPLADELT 210

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
           +   EL+   N   A  +F  R      R+    L QS R+GT I  +LR L    R+E+
Sbjct: 211 VCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSERTEQ 270

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           ++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+  K
Sbjct: 271 VVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIEVFK 314


>gi|107028240|ref|YP_625335.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116687151|ref|YP_840398.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|105897404|gb|ABF80362.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116652866|gb|ABK13505.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 324

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 73/321 (22%), Positives = 147/321 (45%), Gaps = 6/321 (1%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                  +  +     + +   +  V +       +++R++                   
Sbjct: 1   MQNLSVVQAVMLGGLFIFVAGGVL-VAMLLFAPRGIQRRLQQAGGTGAGGVAGAGDGDD- 58

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
              +SR   +  +      K    K    +  +  +L  AG+R++ +  +    + ++ +
Sbjct: 59  --MASRWVAKLVELSSPISKLSVPKEGWENSPLRIRLMNAGWRNQSAAAVYFTAKTMLAL 116

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                 ++ +       E      +   +    +G+  P++ +S  V+ RQ  I   +PD
Sbjct: 117 GLPCAALLALITTSLGDERALLSLILVAL--AGIGYYIPNIVLSQRVKVRQRKIFEDFPD 174

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL +V+E++  +S  ++ E+ L + E+     ++ A  N   R
Sbjct: 175 ALDLLTVCVEAGLGLDAALMKVSEELRFRSEVVASELDLLLLEMRSGFTKETALRNLALR 234

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 235 TGVEDIESFCAMLIQADRFGTSISESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFC 294

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L++V++GPA++ +   +
Sbjct: 295 IFPALMMVLLGPAMIHVYRVL 315


>gi|322434108|ref|YP_004216320.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161835|gb|ADW67540.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 302

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 73/314 (23%), Positives = 147/314 (46%), Gaps = 20/314 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
             V+I   +     +    +    S  + +R+  V                K +    L+
Sbjct: 5   FFVSILVLMFSAMGLAGSFLLLRNSRGITERVLQVTQG------GTGAIQPKHAVREELK 58

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            +  +++     +L +     +  +  + + AGFR+  + +I    RL+ P   ++ GII
Sbjct: 59  KKVFEAVHVVRARLGMN---ENAKLSERFQGAGFRTASARDIYFAARLIGPAAAIVFGII 115

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                        Q +V  ++++G + + AP + +S +V+ R+  I+ + PD +DLL+IC
Sbjct: 116 M-----------PQNKVFWMMMVGGILYLAPDIILSRMVKGRREKIRLSIPDMIDLLVIC 164

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V++G+ +DQA+ RV +++G     + EE++    E      R  +++    RTQ+  +  
Sbjct: 165 VDAGLGMDQAMLRVGQELGTTHPQIYEEIMQINREQRAGKLRLESWQAMAQRTQLPEIDG 224

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L+Q++R+GT I  +L       R +R   AE+ AA    K+  P+++F  P + +V
Sbjct: 225 FVNMLMQNERFGTPIARALSTFGDNIRQKRRQRAEELAAKTTVKIIFPLVLFIFPSMFIV 284

Query: 314 IIGPAILSIIDTMK 327
           ++GPA +SI   + 
Sbjct: 285 LLGPAGISIARGLA 298


>gi|115358176|ref|YP_775314.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115283464|gb|ABI88980.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 314

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 83/303 (27%), Positives = 155/303 (51%), Gaps = 1/303 (0%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
             L+ A V  +L +     R +  A  ++   ++ ++          +R   ++ L    
Sbjct: 13  LLLLIACVAAALATPGGGTRRRIAARVQQAAGQRSLSLAAGRLQPGEVRQDLTRRLAQLG 72

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
           ++L +   +    +  +L  AGFR   +++ ++ ++L   ++F    I++     +L E+
Sbjct: 73  ERLPVLDPMQRVKLGLQLTRAGFRERRAVSAMIGIKLSCGVLFAGFAIVFSPYIPRLGEF 132

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
            F +R  A++    +G   P   +  ++++R+ +I   +PDALDLL+IC  +G S+   +
Sbjct: 133 -FVIRAVAMVGAFVIGVIVPEYVLGAMIRRRRRTIAACFPDALDLLVICTMAGNSLASGV 191

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
           RRVA ++     PL++E+ +   EL+   N   A  +F  R      R+    L QS R+
Sbjct: 192 RRVARELQRICPPLADELTVCADELTLSGNVSEALAHFALRVNFSSARSLATTLTQSQRF 251

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           GT I  +LR L    R+E+++  E+KAA L PK+TVPM++F LP + L+  GPA + +I+
Sbjct: 252 GTPITQALRTLSRSERTEQVVALEEKAAKLAPKITVPMMLFILPTVGLIAAGPAAIRLIE 311

Query: 325 TMK 327
             K
Sbjct: 312 VFK 314


>gi|325964118|ref|YP_004242024.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470205|gb|ADX73890.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 292

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 63/239 (26%), Positives = 117/239 (48%), Gaps = 9/239 (3%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L     +  +   L  AG  +   L  +++ + ++ +   ILG++           P  
Sbjct: 62  RLTPSGYEAKLDRWLSLAGRPASLPLERVIIAKPLLALTGAILGLLMY------ASSPSA 115

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             +   + +  + +  P + I N   KRQ  I+   P+ LD LLI VE+G+  + A+   
Sbjct: 116 QIIALGLFMSALLYFLPDLLIYNKGIKRQQEIELELPNTLDQLLISVEAGLGFEAAM--- 172

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A   G     LS+E++ T+ ++     RQ A++   +R+ +  +R+  +A+IQ+D+YG  
Sbjct: 173 ARAGGYGDGALSQELMRTLQDIQVGRPRQDAYQALADRSSVQDLRSFVRAVIQADKYGIG 232

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           I   LR    + R +R   AE+KA  L  K+  P+++   PVL +V++GPA + I++  
Sbjct: 233 IAKVLRTQAKQARVKRRQRAEEKAMKLPVKVLFPLLLCIFPVLFIVLLGPAAIKIVEAF 291


>gi|197335643|ref|YP_002155274.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
 gi|197317133|gb|ACH66580.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
          Length = 290

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 116/250 (46%), Gaps = 5/250 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                 +  ++K    +    +E I  KLR AG+ +   +++ + ++  V +I  ++  I
Sbjct: 43  KTKENEIGGWLKSKASELNPDEEEIKQKLRQAGWSNTQYVHLFMPIKYSVLLIGEVIFGI 102

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
             +             V    L       AP +++   ++ R   +    P  LDL+ +C
Sbjct: 103 AYY----QSFLSSTAWVITASLWMVFVIIAPDMYLQAKIKARIHRVSTQMPYLLDLMAVC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V++G++++ +L  +A+++ G +  L++ +             + + E  Y     + +R+
Sbjct: 159 VQTGMTVEASLSYLAKEMKGFNKDLTQVLTKMNERSRM-VGLEKSLEEMYVEIPSNEMRS 217

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L QS  YG+SI   L  L S+ R  +++E E++   L  K++VP+I+F +  ++++
Sbjct: 218 FVMTLTQSMHYGSSIYSVLTTLASDIREVQMLELEERIGKLAAKMSVPLIVFIMIPIVIL 277

Query: 314 IIGPAILSII 323
           I  P ++ ++
Sbjct: 278 IAAPGVMRLM 287


>gi|227819312|ref|YP_002823283.1| TadC pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338311|gb|ACP22530.1| TadC pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 313

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 64/298 (21%), Positives = 140/298 (46%), Gaps = 4/298 (1%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
             +  +V+I  + + E+  R + V V       +  ++   D A + L   +++ +R + 
Sbjct: 9   LIVFLSVLIFVVTASEVVFRRREVGVRLSEAGSRVASNDIGDGAIADLSDAENRLIRRYF 68

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
           +    +      +  N+L  AG+ S  ++     +R +V I  ++L          L E 
Sbjct: 69  E--ITRRDANANSTQNRLIRAGYFSANAVTTFHAIRAIVCIGMMVLT--VWAFNRFLPET 124

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
              + +   + +  + F   +++I      ++   +R +PD +D+L++C+++G+S++ A 
Sbjct: 125 SRLMTLVIAMFVAGMTFILVNIYIDRRGSAKEREYRRLFPDFMDMLIVCLDAGMSLEAAA 184

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
            RVA +   +       + + + E+      + A  N   R ++D  R+      QS+  
Sbjct: 185 NRVAREFVSKRKDFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARSLAVLFRQSEEL 244

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           GTS+  +LRV   E R  R++ AE+KA SL  K+ +P+  F  PV +++++ P ++ +
Sbjct: 245 GTSVTQTLRVYSKEMRDLRIVRAEEKANSLPIKMLLPLGAFLFPVSLVIVLVPIVIRV 302


>gi|90419768|ref|ZP_01227677.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
 gi|90335809|gb|EAS49557.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
          Length = 335

 Score =  129 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 53/316 (16%), Positives = 121/316 (38%), Gaps = 21/316 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   + + ++  +L +A + P +      +  ++     +  R+    +  +     + R
Sbjct: 7   ILFILFSTIAAGALAFAFLQPRIAKERKVENRRAQYTRDDTERRSLKVARDRLKEQDKRR 66

Query: 74  TRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                SL+    +   +        +  +L  AG+    S+   +++ +V+ ++ L +  
Sbjct: 67  KTIQSSLKELESRQKERDKHTGKLTLQRQLEQAGW--TMSVKQFVLLSIVMGVVSLFVAA 124

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           I+               +  +  +   G   P   +S   +KR       +P+A+DL++ 
Sbjct: 125 IFGAPL-----------LLLIGAVVVGGLGLPRFLLSRARKKRFHKFGEEFPNAIDLIVR 173

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            V+SG+ ++  LR V+   G    P+  E    I           A E  Y         
Sbjct: 174 GVKSGLPLNDTLRIVS---GETLDPVRSEFRKIIESQQMGVPISEAVEKLYRNIPTPEAN 230

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                +    + G ++ ++L  L +  R  + M A+ +A S+  K +   II  LPV++ 
Sbjct: 231 FFAIVIAIQSQAGGNLSEALGNLSNVLRDRKKMRAKVQAMSMEAKASGG-IIGALPVVVA 289

Query: 313 VIIG---PAILSIIDT 325
            ++    P  +S++ T
Sbjct: 290 GLVYITTPDYISVLFT 305


>gi|313902406|ref|ZP_07835809.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
 gi|313467337|gb|EFR62848.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
          Length = 326

 Score =  129 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 68/314 (21%), Positives = 128/314 (40%), Gaps = 8/314 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +     + +     A++ PS       KR++ + +      + +   L +  +   LR  
Sbjct: 18  LLWLVFMIVALTTLALLAPSEAEHIARKRLRDLRLRGVPPDQAEQEELARPFSQRVLRPA 77

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII--FLILGII 133
             + +    +        V       L AAG          L        +    + G  
Sbjct: 78  WERMVEAAERW---TPQGVAARWERLLAAAGRPLGLGTLAFLKAAGAAAGLVPGWVAGGW 134

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
              G           +     L    G+  P   +     +R+  + RA PD +DLL + 
Sbjct: 135 LAAGMSGAGAAGAAFQPVVAALGAATGWILPDAALKARATRRKRQLARALPDVMDLLSVA 194

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VE+G+ +D A+++V E       P+S E    + EL    +R+ A  +  +R ++  +R+
Sbjct: 195 VEAGLGLDGAVQKVTEKFP---APVSTEFRQYLKELRLGVSREEALRSLADRAELPELRS 251

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              A+IQ+DR G S+   LRV   + R +R   AE++A     K+ +P+++F  P L +V
Sbjct: 252 FAAAVIQADRLGVSLARVLRVQAEQLRFQRKQRAEEQAMKTPIKMLLPLVLFIFPTLFIV 311

Query: 314 IIGPAILSIIDTMK 327
           ++GPA++ I+    
Sbjct: 312 LLGPALIQILSAFA 325


>gi|83747913|ref|ZP_00944945.1| TRANSMEMBRANE TIGHT ADHERENCE TADC RELATED PROTEIN; tadC2
           [Ralstonia solanacearum UW551]
 gi|207739454|ref|YP_002257847.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
 gi|83725446|gb|EAP72592.1| TRANSMEMBRANE TIGHT ADHERENCE TADC RELATED PROTEIN; tadC2
           [Ralstonia solanacearum UW551]
 gi|206592830|emb|CAQ59736.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
          Length = 326

 Score =  129 bits (323), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 57/325 (17%), Positives = 124/325 (38%), Gaps = 15/325 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVI-PSLGSGELEKRMKSVAVEREILRKQQITSL---- 63
            D   L +++T A +   +   V++   L      +++ +   +      Q         
Sbjct: 1   MDDALLTLSLTAATAGLLVFGGVLVHAVLTRYRSARKLDTALTDVRTAGTQAAAPAGTPL 60

Query: 64  --QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
              K  A ++   +    +        L   +V E     L   G+  E +  +    R+
Sbjct: 61  PVPKPRAQAQQLQQQVAKVGQRWIDTGLGQRIVTEEDRRLLEECGYYGEQARTVFGGTRI 120

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++P    +LG+++           F   +        +G+  P   ++   + R+  +  
Sbjct: 121 LLPPFLCVLGVLYAAA--------FWKALLWGFAGFALGYLGPKWLLTRRKESRRRRVDD 172

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +    R+     
Sbjct: 173 ELPVMVDMLRLLQGVGLSIDQSLQVIANEFYGMLPVLAGEFGRANQQFASGRPREQTLLR 232

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
                  + ++     L Q DR+G ++ + LR      +  R    +++   L  K+TV 
Sbjct: 233 IAKMFDSEDLKGLITLLTQVDRFGGAVQEPLRQFGVRLQENRRSRLKERVGKLTVKMTVV 292

Query: 302 MIIFFLPVLILVIIGPAILSIIDTM 326
           M++  LP L+++  GP  +S+  T+
Sbjct: 293 MVLTLLPALLIITAGPGFVSVTRTL 317


>gi|300694107|ref|YP_003750080.1| type II secretion system protein [Ralstonia solanacearum PSI07]
 gi|299076144|emb|CBJ35457.1| Type II secretion system protein [Ralstonia solanacearum PSI07]
          Length = 324

 Score =  129 bits (323), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 58/323 (17%), Positives = 128/323 (39%), Gaps = 13/323 (4%)

Query: 9   FDATEL---AVAITTAVSIFS--LIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
            D + L     A T  + +F    ++AV++      +L+  +  V              +
Sbjct: 1   MDDSLLTLSLTAATAGLLVFGGIAVHAVLMRYRSVRKLDTALSDVRTAGTQAAAPAGAPV 60

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
            K    ++   +    +       +L   +V E     L A G+  E +  +    R+++
Sbjct: 61  PKPRPQAQQLQQQVAKVGERWIDTSLGHRIVTEEDRKLLEACGYYGEQARTVFGGTRILL 120

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
           P +  ++G+++     K         +        +G+ AP   ++   + R+  +    
Sbjct: 121 PPLLCVVGVLYAGELGK--------ALLWGFAGFALGYLAPKWLLARRKESRRRRVDDEL 172

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           P  +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +    R+       
Sbjct: 173 PAMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRANQQFASGRPREQTLLRIA 232

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
                + ++     L Q DR+G ++ + LR      +  R    +++   L  K+TV M+
Sbjct: 233 RLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGVRLQENRRSRLKERVGKLTVKMTVVMV 292

Query: 304 IFFLPVLILVIIGPAILSIIDTM 326
           +  LP L+++  GP  +S+  ++
Sbjct: 293 LTLLPALLIITAGPGFMSVTRSL 315


>gi|300697738|ref|YP_003748399.1| type II secretion system protein [Ralstonia solanacearum CFBP2957]
 gi|299074462|emb|CBJ54012.1| Type II secretion system protein [Ralstonia solanacearum CFBP2957]
          Length = 326

 Score =  128 bits (322), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 55/325 (16%), Positives = 124/325 (38%), Gaps = 15/325 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVI-PSLGSGELEKRMKSVAVEREILRKQQITSL---- 63
            D   L +++T A +   +   +++   L      +++ +   +      Q         
Sbjct: 1   MDDALLTLSLTAATAGLLVFGGILVHAVLTRYRSVRKLDTALTDVRTAGTQAAAPAGTPL 60

Query: 64  --QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
              K  A ++   +    +        L   +V E     L   G+  E +  +    R+
Sbjct: 61  PVPKPRAQAQQLQQQVAKVGQRWIDTGLGQRIVTEEDRRLLEECGYYGEQARTVFGGTRI 120

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++P    +LG+++           F   +        +G+  P   ++   + R+  +  
Sbjct: 121 LLPPFLCVLGVLYAGA--------FWKALLWGFAGFALGYLGPKWLLTRRKESRRRRVDD 172

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +    R+     
Sbjct: 173 ELPVMVDMLRLLQGVGLSIDQSLQVIANEFYGMLPVLAGEFGRANQQFASGRPREQTLLR 232

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
                  + ++     L Q DR+G ++ + LR      +  R    +++   L  K+TV 
Sbjct: 233 IAKMFDSEDLKGLITLLTQVDRFGGAVQEPLRQFGVRLQENRRSRLKERVGKLTVKMTVV 292

Query: 302 MIIFFLPVLILVIIGPAILSIIDTM 326
           M++  LP L+++  GP  +S+  ++
Sbjct: 293 MVLTLLPALLIITAGPGFVSVTRSL 317


>gi|209886534|ref|YP_002290391.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874730|gb|ACI94526.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score =  128 bits (322), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 56/319 (17%), Positives = 124/319 (38%), Gaps = 26/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   LA+A  +AV++  L +  + P+L         ++      + R + I    + + 
Sbjct: 1   MNLQTLAIAFMSAVTLGGLAWVFLYPALSGER-----QAEKRRASLARPENIARRVERNP 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   +L++   +           +  +L  AG    ++    ++   V+ I   
Sbjct: 56  QRSRREQVEDTLKDVENR---AKQAKKVPLNIRLEQAGV--NWTKRQFMIGSAVLGIATF 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  I    +           +  +   G  GF  P   ++ L ++R+     A PDA+D
Sbjct: 111 LLFYIVDANF-----------LATIAFAGAAGFGLPRWVLNFLKKRREKKFLDALPDAVD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  V++G+ +  +L+ V         PL  E    I   S       A    Y R  +
Sbjct: 160 VIVRGVKAGLPLFDSLKVVVN---DSPEPLRSEFRAIIETQSIGMPLGEACMRLYERMPL 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M+A+ +A S+  K +  +I    P
Sbjct: 217 PEANFFGIVVGIQMKSGGNLSEALGNLSKVLRDRKKMKAKIQAMSMEAKASAGIIGSLPP 276

Query: 309 VLILVI--IGPAILSIIDT 325
            +++++  + P  +S++ T
Sbjct: 277 AVMMIVYFMSPDYISLLWT 295


>gi|295395216|ref|ZP_06805424.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971978|gb|EFG47845.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 312

 Score =  128 bits (322), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 125/310 (40%), Gaps = 9/310 (2%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D   +  A+  +V +    + + +P +    LE R+       ++  ++   +   ++ 
Sbjct: 4   IDHPLVIGALGLSVGLSLTFFVLSLPVMRRPRLEDRIGPYLRTTQVAEEKYHLTAPTETG 63

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
              L    +    +++       +  D ++  +L   G    ++++     ++++ I  L
Sbjct: 64  FGGLARHFAHRALHWLN----SRMTTDVSVTLRLSKLG--PSHTVDSFRARQVLLIIAGL 117

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++G +          +   + V  ++L G  G       ++  V+KR+  I   +P   +
Sbjct: 118 VVGALMCTVIIVARGFNPVVCVVLIVLGGVGGHFLNDWLLTQAVKKREERILAEFPTIAE 177

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL + + +G     AL RV       +  LS+E+ + +A+     +   A +    RT +
Sbjct: 178 LLALSITAGEGTVDALNRVCH---TATGELSDELRIALAQARTGTSLVDALDAMARRTNI 234

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +      L  +   GT + + LR   ++ R E   +  + +      + VP+++F LP
Sbjct: 235 QSLIQFVDGLAIALSRGTPLSEVLRAQAADVREEGRRKLMELSGKKEVGMLVPVVLFVLP 294

Query: 309 VLILVIIGPA 318
           + +L  + P+
Sbjct: 295 ITVLFAVYPS 304


>gi|83720640|ref|YP_442975.1| type II secretion system protein F [Burkholderia thailandensis
           E264]
 gi|83654465|gb|ABC38528.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis E264]
          Length = 290

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 136/265 (51%), Gaps = 1/265 (0%)

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV
Sbjct: 27  PADDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFRERRAVSVMAGLKLVV 86

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
                +  ++      ++ +Y F LRV  +     +G   P   +   V +RQ +I    
Sbjct: 87  GACAGLAALVVGAHVPRVGDY-FVLRVLMMAGAFVIGMMLPEHALGFAVARRQKTIAAYL 145

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLL+IC  +G S+  A+RRVA ++G    PL++E  +   EL    +   A     
Sbjct: 146 PDALDLLVICTNAGNSLAVAIRRVASELGTICPPLADEFSVCADELQIGGDAAFALNAMA 205

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM+
Sbjct: 206 ARIGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMM 265

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
           +F +P + L+  GPA++ +I     
Sbjct: 266 LFVMPTVALIAAGPAVIRLIAVFHK 290


>gi|86748903|ref|YP_485399.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
 gi|86571931|gb|ABD06488.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
          Length = 324

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/319 (18%), Positives = 122/319 (38%), Gaps = 27/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   LA+    AVS+  L +  + P L         K     R  + +      Q + +
Sbjct: 1   MEMQSLALGFLAAVSVGGLAWVFIYPLLSGE------KQAEQRRTSVARTTPAVRQIEKS 54

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   SLR    +   +    + ++  KL  AG   +++ N  + V   +  +  
Sbjct: 55  QRSRREQVEGSLREIEARSQKQK---NVSLGTKLTQAGL--DWTPNKFIGVSAGLGTVAF 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
              +I   G            + AV L    GF  P   +  L ++R+     A PDA+D
Sbjct: 110 ATTMILGGGL-----------LAAVGLAFAAGFGLPRWVLGFLKKRREKKFINALPDAVD 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  +++G+ +  +L+ VA        PL  E    I   +       A    Y+R  +
Sbjct: 159 VIVRGIKAGLPLFDSLKVVA---ADSPEPLKSEFNAIIETQAIGMPLGEACARLYDRMPL 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M  + +A S+  K +  +I    P
Sbjct: 216 PEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAAIIGSLPP 275

Query: 309 VLILV--IIGPAILSIIDT 325
           +++L+  +  P  ++++ T
Sbjct: 276 IVMLLVYLSTPDYIALLWT 294


>gi|260462613|ref|ZP_05810819.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031519|gb|EEW32789.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/280 (21%), Positives = 121/280 (43%), Gaps = 2/280 (0%)

Query: 47  SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAG 106
              VE+ +L +         +     R    + +  + + L  +       +  KL  AG
Sbjct: 43  RRLVEQSLLSEGITNRRSLYAQQELNRISAKRPVDAYFRTLEKERG-EPNALEAKLFRAG 101

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           F    +  I  + RL    +   LG   +       + P         LIG      PS+
Sbjct: 102 FYQASAPTIYTLTRLGAVCVGF-LGTYAVLTAVLPPQVPGFAAFAGAALIGLGCLVIPSI 160

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
            +      ++   +R +PD +D+++ C ++G+S++ A+ RV  ++ G    L  ++ +  
Sbjct: 161 ALDRFENGQKRIYRRGFPDFMDMMITCADAGMSLEAAVERVGAELAGTHKWLGIQLSIMT 220

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            +L      + A     +R  ++  R       QS+  GTS+ D+LR+   E R +R++ 
Sbjct: 221 LQLRAGKPLREALRELADRIGLEEARALAVLFRQSEELGTSLTDALRIYSDEMRGQRILH 280

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           AE++A +L  K+ +P+ +   PV+++VI+ P I+ +    
Sbjct: 281 AEERANALPVKMMIPLGLCIFPVVMMVIMLPLIIRMKGVF 320


>gi|299132290|ref|ZP_07025485.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
 gi|298592427|gb|EFI52627.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
          Length = 323

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/319 (17%), Positives = 118/319 (36%), Gaps = 28/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                LA+A  +AV++  L +  + P L      ++ ++     E   ++       D  
Sbjct: 1   MKIQTLAIAFMSAVTLGGLAWVFLYPLLSGERQAEKRRASFSRTEAATRRI------DRN 54

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   +L++   +           +  +L  AG    +S    ++    + ++  
Sbjct: 55  QRSRREQVEDTLKDVEDR---AKQAKKVPLNTRLAQAGV--SWSRRQFIIGSAALGLLVF 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            +  +                +    L    G   P   +S L ++R+     A PDA+D
Sbjct: 110 FICFV------------TANLIATAALALSAGLGLPRWVLSYLKRRREKQFLEALPDAVD 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  V++G+ +  +L+ V         PL  E    I   S       A    Y R  +
Sbjct: 158 VIVRGVKAGLPLFDSLKVVVN---DSPEPLRSEFRAIIETQSIGMPLGEACMRLYERMPL 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M A+ +A S+  K +  +I    P
Sbjct: 215 PEANFFGIVIGIQTKSGGNLSEALGNLSKVLRDRKKMRAKIQAMSMEAKASAAIIGALPP 274

Query: 309 VLILV--IIGPAILSIIDT 325
           V++++  I+ P  +S++ T
Sbjct: 275 VVMIIVYIMSPDYISLLWT 293


>gi|167581954|ref|ZP_02374828.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis TXDOH]
          Length = 271

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 136/265 (51%), Gaps = 1/265 (0%)

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV
Sbjct: 8   PADDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFRERRAVSVMAGLKLVV 67

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
                +  ++      ++ +Y F LRV  +     +G   P   +   V +RQ +I    
Sbjct: 68  GACAGLAALVVGAHVPRVGDY-FVLRVLMMAGAFVIGMMLPEHALGFAVARRQKTIAAYL 126

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLL+IC  +G S+  A+RRVA ++G    PL++E  +   EL    +   A     
Sbjct: 127 PDALDLLVICTNAGNSLAVAIRRVASELGTICPPLADEFSVCADELQIGGDAAFALNAMA 186

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM+
Sbjct: 187 ARIGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMM 246

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
           +F +P + L+  GPA++ +I     
Sbjct: 247 LFVMPTVALIAAGPAVIRLIAVFHK 271


>gi|134291849|ref|YP_001115618.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135038|gb|ABO59363.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 327

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 74/321 (23%), Positives = 145/321 (45%), Gaps = 3/321 (0%)

Query: 6   FDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
                     +     + +   + A  +       L++R++  +     +      +   
Sbjct: 1   MQNLSVVHTVMLAGLFLFVAGGVLA-AMLLFAPRNLQRRLQQASGASVAVGAAGAGADDA 59

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
            +   R   R  +  +   K    +    +  +  +L  AG+R   +  +    + V+ +
Sbjct: 60  GAPGPRWIARLVELSQPISKLSVPQDGWENSPLRVRLMNAGWRDPSAAGLYFTAKTVLAL 119

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
                 ++ +       +      +   +    +G+  P+  +S  + KRQ +I   +PD
Sbjct: 120 ALPGAALLALATTRLADQRMLLSFILVAL--AGIGYYLPNFVLSRRITKRQRTIFEDFPD 177

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL +CVE+G+ +D AL RV+E++  +S  +S E+ L + E+     +  A  N   R
Sbjct: 178 ALDLLTVCVEAGLGLDAALMRVSEELRFRSEVVSGELDLLLLEMRSGFTKDTALRNLALR 237

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
           T ++ + +    LIQ+DR+GTS+ +SLRVL    R+ R M AE++AA +  KL  P+I  
Sbjct: 238 TGVEDIESFCAMLIQADRFGTSVAESLRVLSDMLRTRRRMRAEERAARIALKLLFPLIFC 297

Query: 306 FLPVLILVIIGPAILSIIDTM 326
             P L+ V++GPA++ +   +
Sbjct: 298 IFPALMGVLLGPAMIHVYRVL 318


>gi|218461576|ref|ZP_03501667.1| putative component of pilus protein [Rhizobium etli Kim 5]
          Length = 165

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 109/165 (66%), Positives = 135/165 (81%)

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
            AP+++ISN + KRQ SIKRAWPDALDL+LICVESGISI+ A+RRV+E++G QS  L+EE
Sbjct: 1   YAPNIYISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPALAEE 60

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           M+LT AELSFLP+R+VA EN   RTQ++ VR+ TQALIQ+DRYGT +  +LRVL  E R 
Sbjct: 61  MVLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRD 120

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           ER+ EAEKKAA+L PKLTVPMI+FFLPVLI VI+GPA + + D  
Sbjct: 121 ERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVADKF 165


>gi|323341960|ref|ZP_08082193.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464385|gb|EFY09578.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 306

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/315 (21%), Positives = 135/315 (42%), Gaps = 12/315 (3%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +  AIT A+  +  +  V+    G    ++KR+                 +   +   R 
Sbjct: 1   MIKAITGAIFAYVFVDFVMSVLTGKSLVIKKRLDETKNSSSQKHGSD--DILDKTFQERF 58

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                  L + V  +          + ++L  AG     +      + +++ + F ++G+
Sbjct: 59  LQPIVDKLIHAVSTMLPVKAESQLKLADRLLKAGI--TTNPKDYRAMNVIIIVGFGLVGL 116

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
                  +        R+  +++    G+      +   + KR+  IK   P+ +D+L +
Sbjct: 117 YLAITSHQRG----FSRIMYMMMGMAGGYVYRRYSLEGKITKRKKIIKGQLPEVMDILSV 172

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            V +G+S DQAL  V         PL EE  +   E+     R+ A      RT+++ V+
Sbjct: 173 SVVAGLSFDQALGHVTTK---AEGPLIEEFRICQREIMLGKPRKEALNRLSERTEIEEVK 229

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           + T A+IQ+D  G S+ + L       R+    + E++AA +  K+ +PM++F  PV+ +
Sbjct: 230 SFTNAIIQADELGISLQNVLMSQSQMIRTSHRQDVEERAAKIPVKILIPMVLFIFPVIFI 289

Query: 313 VIIGPAILSIIDTMK 327
           +++GPA+ +IID + 
Sbjct: 290 ILLGPAVPTIIDALG 304


>gi|311743553|ref|ZP_07717359.1| type II secretion system protein F protein [Aeromicrobium marinum
           DSM 15272]
 gi|311312683|gb|EFQ82594.1| type II secretion system protein F protein [Aeromicrobium marinum
           DSM 15272]
          Length = 298

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/314 (21%), Positives = 144/314 (45%), Gaps = 18/314 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + V   T + +      V +  + + + + R + V VE   +              +RL+
Sbjct: 1   MIVIAVTLLGLSLAALCVALGLIQTTDAKTRERLVGVESGGVHVANDGRT----GLARLQ 56

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               +     V  + L+       +   L  AG+ + ++   +L++++  P+I  +    
Sbjct: 57  FEGPEDAARLVIPMRLR-----TRLERNLMLAGYPAGWTWQKILILKIAAPLILAVA--- 108

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                +        +     +    V +  P + +S+  ++RQ++++   PDALD ++I 
Sbjct: 109 ---MREFAFSEFSMVNTTVGVGSVIVAYLLPDLLLSSRARERQAAMELELPDALDKIVIS 165

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           +ESG+  + AL   AE   G     ++E++ T+ ++     R+ A+E   NRT+ + +R 
Sbjct: 166 LESGLGFESALMNAAETGKG---DFADELVRTLQDIQVGMPRRAAYEALVNRTESEDIRR 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             ++LIQ++  G S+   +R   ++ R +R + AE KA  +  KL  P+I    PVL ++
Sbjct: 223 FVRSLIQAEETGVSVSTVVRNQSADMRMKRKLRAEGKAQQVSVKLLFPLIFCLFPVLFVI 282

Query: 314 IIGPAILSIIDTMK 327
           ++ P +++ I+  K
Sbjct: 283 VLAPGVMTAIEGFK 296


>gi|171321820|ref|ZP_02910723.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171092891|gb|EDT38141.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 330

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/319 (18%), Positives = 129/319 (40%), Gaps = 8/319 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L V +   +++     A          L++RM ++   +  +        + D+   +  
Sbjct: 16  LGVLLLGMLAVLRASAATRAERALVDALDRRMAALDAAKTRVTPNAEAPAKPDARGGQRV 75

Query: 74  TRDSKSLRNFVKKL---NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            R  + L     +     L   +V +     L   G+    +  + L  R+   ++  +L
Sbjct: 76  ARFLERLSTAGMRWLDTGLGKHIVADEDRRLLEQCGYVDARTRGLFLSARIACGLVLPLL 135

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             ++  G  K   +     V  + ++  +GF  P +++      R+ S+    P  +D+L
Sbjct: 136 FALFASGRLKGSHW-----VIGMFVVFGLGFMLPKLYVKRRAAARRQSVVDELPLFVDML 190

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +    G+S+DQ+L+ V  D  G    LS E+ +          R+ + +        + 
Sbjct: 191 RLLQGVGLSLDQSLQVVTNDFRGMMPVLSSEVGIAQRHFVAGRTREQSMQRLSGGFDNED 250

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +R   + ++Q D++G ++ + L+      R  R     ++   L  K+T  M++  LP L
Sbjct: 251 LRAIVRLMVQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPAL 310

Query: 311 ILVIIGPAILSIIDTMKDH 329
           ++V  GP +L+++  +  H
Sbjct: 311 LIVTAGPGMLAVMRALSHH 329


>gi|255658710|ref|ZP_05404119.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
 gi|260849099|gb|EEX69106.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
          Length = 307

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 55/313 (17%), Positives = 128/313 (40%), Gaps = 9/313 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L   ++    +F ++  ++   +      ++        ++              + +  
Sbjct: 4   LLFVLSLTAVLFLILLGLIRSKVQPKSTMRQRIESLETLDVQPGAFGQPQAAQPEARKPA 63

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               + L      L    +     I  ++  AG   E+ +           ++  ++  +
Sbjct: 64  GGIKQMLGALATTLTPLRL--RPIIQKRIMLAGKSREWGVAEFFGSC----LLGAVVMWL 117

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +     +   Y    +   V L+G +G   P V+++  +Q+RQ  I+   P+ LDLL + 
Sbjct: 118 FALVMVRTATYAPVQKAMMVFLLGLLGGLMPVVFLNTTIQRRQKQIEHQLPEVLDLLCVS 177

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V++G+S D AL ++   + G   P  +E      ++     R+ A  +  +R  ++ V  
Sbjct: 178 VQAGLSFDAALSKITARMKG---PFIDECRRMQDDIRMGVVRRTAMRSMADRCGLEDVSL 234

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              ++IQ++R GTS+G +L+      R  R    + +A     K+  P+++F  P + +V
Sbjct: 235 FMTSIIQAERLGTSMGKTLKNQADNIRERRRQYVKAQAMKAPVKIVFPLVLFIFPAIFVV 294

Query: 314 IIGPAILSIIDTM 326
            + P++L ++  +
Sbjct: 295 TLVPSLLYLLKNL 307


>gi|294102185|ref|YP_003554043.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617165|gb|ADE57319.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
          Length = 296

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 14/276 (5%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
             LR  +    +  S   R+       +    +    +  +    +      AG      
Sbjct: 34  RALRFAEEWDDETASFRERVVDPLRAKISRIGRFFFPQEAI--ARMDRYCLLAGRPRGLR 91

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
             +L  +++   +I  ++    I         P   R+   I++G +G+  P +WI+N  
Sbjct: 92  GEVLAGLKVSFALILAMVSFFLI---------PDPFRISGAIILGALGYMIPGLWITNKG 142

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ   +   PD +DL+++ VE+G+ +D A+ RVA+ + G   P+ E     + E+S  
Sbjct: 143 KQRQVEARNQLPDVMDLMVVSVEAGLGLDAAMSRVADRLRG---PMGENFARALHEISLG 199

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +RQ AF     R  ++ VR+   +LIQ++  G ++ + LR      +  R ++AE+ A 
Sbjct: 200 ESRQAAFRGIMERLPIEEVRHFIASLIQAEELGVAVSEVLRSQAGTLKRLRRLKAEEHAR 259

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
               K+  PMI+F  P L +VI+GPA LSI++T+  
Sbjct: 260 KAPIKILFPMILFIFPSLFVVILGPAFLSIMETLAK 295


>gi|153008063|ref|YP_001369278.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559951|gb|ABS13449.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
          Length = 337

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 110/316 (34%), Gaps = 21/316 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   +   V+  +L YA+    LG  +   R           R    +   +++   + R
Sbjct: 9   VMFIVLAVVACAALFYALFYEKLGKKDHAARRFETVRNSGSERAITRSERDRNADIQKRR 68

Query: 74  TRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            +   ++++   +   +        +   L  AG     +L    +   V   +   + +
Sbjct: 69  KQLQDNIKDLEARQKQREKNQKYPPLRILLAQAGL--SLTLQKFYIYSGVAAFLATFIAL 126

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           I+      L             +     F  P  ++    ++R       +P+ALD+++ 
Sbjct: 127 IFGAPLLFLPG-----------IAIAGFFGLPRWFVLQKRKRRLKKFLEEFPNALDVIVR 175

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
              +G+ ++  LR +A        P+  E    +       +   A     +        
Sbjct: 176 ATRAGLPLNDGLRLIAS---EAVEPVKSEFKKVVEAQQIGLSIPEAVGKMPDSMPCPETN 232

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                +    + G ++ ++L  L    R  + M+A+  A S+  K +   II  LP +++
Sbjct: 233 FFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVDALSMEAKASAA-IIGALPFIVM 291

Query: 313 VII---GPAILSIIDT 325
           V++    P  ++++ T
Sbjct: 292 VLVYLTSPQYMTLLFT 307


>gi|197123313|ref|YP_002135264.1| type II secretion system protein [Anaeromyxobacter sp. K]
 gi|196173162|gb|ACG74135.1| type II secretion system protein [Anaeromyxobacter sp. K]
          Length = 306

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 69/273 (25%), Positives = 136/273 (49%), Gaps = 4/273 (1%)

Query: 54  ILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
                 +    + +A+  +    +  L+  +  +   +      +  +L  AG R   + 
Sbjct: 30  RREADPVVRRLRATAAGAVDGDPALQLQPGLAAVEGDSSEGGSRLRRELVWAGIRRAGAP 89

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
              +  ++        + +      + L   P +  +    LI  + F  P++W+ + VQ
Sbjct: 90  QGFVAAKM----ALATVALTGFAALNALRTEPVRTGLPMAALITGIAFFLPNLWLRSRVQ 145

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            RQ+ + R+ PDALDLL+ CVE+G+ +D AL+RV++++      LS+E+ L   E+    
Sbjct: 146 ARQTQLDRSLPDALDLLVTCVEAGLGLDSALQRVSDEVALAHPLLSKELRLVFLEVKAGI 205

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
            R  AF     RT    +R+ +  L Q++ +GTS+G +LR+     R  R+  AE+KAA 
Sbjct: 206 PRIAAFRRMAERTGAPELRSLSATLAQTELFGTSVGAALRIQAEGIRIRRMHRAEEKAAY 265

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +  K+++P+++  LP +  V++GPA++++ D +
Sbjct: 266 VSVKMSLPLVLCILPCVFAVVLGPAVVNMADRL 298


>gi|253687073|ref|YP_003016263.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753651|gb|ACT11727.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 319

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 68/275 (24%), Positives = 138/275 (50%), Gaps = 4/275 (1%)

Query: 54  ILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
               Q+     + +  S L  +  + +    ++L+  +     N+   L  AG R   ++
Sbjct: 49  EAASQENILRGQGTTLSPLLEKLLQPIATQGERLS-GSERDRRNLRRLLDLAGIRRNEAV 107

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
             L++ +        +  I  ++G+    +      V A ++  +VG   P  W+     
Sbjct: 108 GWLVMGKFA---AGALFAIALVWGWLPPADRAGLTGVAAGLIGFFVGSMVPEWWLKWRAA 164

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  +++E+  T AEL  L 
Sbjct: 165 SRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMADELHYTAAELQILS 224

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  E+R   ++  E+KA  
Sbjct: 225 DRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADESRKTLILSLEEKAGK 284

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           L  +L+VP++   LP +I ++  PA++ ++  +  
Sbjct: 285 LPAQLSVPLMALILPPIIAIMASPALVRVVRLLAQ 319


>gi|167589644|ref|ZP_02382032.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 264

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 73/260 (28%), Positives = 139/260 (53%), Gaps = 1/260 (0%)

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
               +R   ++ L    ++L +   +    +  +L  AGFR   +++ ++ ++L V ++F
Sbjct: 6   QPGDVRQDVTRRLAQLGERLPVLDPMQRVKLGLQLTRAGFRERRAVSSMIGIKLSVGVLF 65

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + I++     +L EY F +R  A++    +G   P   +  ++++R+  I    PDAL
Sbjct: 66  ACVAIVFSPYIPRLGEY-FVIRALAMVAAFVIGVIVPEYVLGAMIRRRRRIIAGCLPDAL 124

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL+IC  +G S+   +RRVA ++     PL++E+ +   EL+   +      +F  R  
Sbjct: 125 DLLVICTMAGNSLASGVRRVAHELARICPPLADELSVCADELTLSGDVAATLTHFATRVD 184

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +   R+    L QS R+GT I  +LR L    R+E+++  E++AA L PK+T+PM++F L
Sbjct: 185 LPSARSLATTLTQSQRFGTPITQALRTLARTERTEQIVALEERAAKLAPKITLPMMLFIL 244

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P + L+  GPA + +++  +
Sbjct: 245 PTVCLIAAGPAAIRLLEVFR 264


>gi|17549304|ref|NP_522644.1| putative tight adherence TadC related transmembrane protein
           [Ralstonia solanacearum GMI1000]
 gi|17431556|emb|CAD18234.1| probable pilus assembly tadc transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 326

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/325 (16%), Positives = 131/325 (40%), Gaps = 15/325 (4%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVI--PSLGSGELEKRMKSVAVEREILRKQQITS---- 62
            D + L +++T A++   +   + +    +    + K   +++  R    +    +    
Sbjct: 1   MDDSLLTLSLTAAMAGLLVFGGIAVHAVLMRHRSVRKLDTALSDVRAAGTQAVAPAGVPV 60

Query: 63  -LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
              K    ++   +    +        L   +V E     L   G+  E +  +    R+
Sbjct: 61  SAPKPRPQAQQLQQQVAKVGQRWIDTGLGHRIVTEEDRKLLEECGYYGEQARTVFGGTRI 120

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
           ++P +  ++G+++           F+  +        +G+ AP   ++   + R+  +  
Sbjct: 121 LLPPLLCVVGVLYA--------ASFREALLWGFAGFALGYLAPKWLLARRKESRRRRLDD 172

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  +D+L +    G+SIDQ+L+ +A +  G    L++E      + +   +R+     
Sbjct: 173 ELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLADEFGRANQQFASGRSREQTLLR 232

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
                  + ++     L Q DR+G ++ + LR      +  R    +++   L  K+TV 
Sbjct: 233 IARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGLRLQENRRSRLKERVGKLTVKMTVV 292

Query: 302 MIIFFLPVLILVIIGPAILSIIDTM 326
           M++  LP L+++  GP  +S+  ++
Sbjct: 293 MVLTLLPALLIITAGPGFMSVTRSL 317


>gi|304320651|ref|YP_003854294.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
 gi|303299553|gb|ADM09152.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
          Length = 330

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 125/320 (39%), Gaps = 23/320 (7%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
             D   L       V+I  L +A+ +   G G   KR++S++   +  +++         
Sbjct: 2   TLDQNSLIALGIGLVAIVGLAFAL-LGFDGGGATNKRVQSLSGNAKQAKRK----TSAKE 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            +   R   S SL+    K          ++   +  AGF  ++S+        +V ++ 
Sbjct: 57  QTRDRRKTISDSLKKIEDKQKEANQKKKVSLDKLIEQAGF--DFSVRDFWTASAIVAVVM 114

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           + +G +             Q  +  + +    G   P  ++    +KRQ   +  + +A+
Sbjct: 115 IGIGYV-----------SGQNALVILAMGIVGGLGIPRWFLYQTRRKRQKKFENEFSNAI 163

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  V+SG+ +++ L+ ++        P+ EE  L +         + + E  YNR  
Sbjct: 164 DVIVRGVKSGLPVNECLKIISR---DAQSPVKEEFQLLVEGQRIGLTLEQSLERLYNRMP 220

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG--PKLTVPMIIF 305
           +  V      L+   + G ++ D+L  L +  RS + M  +  A S+       +   + 
Sbjct: 221 ISDVNFFAIVLVIQQQTGGNLADALGNLSTVLRSRKTMLGKIAALSMEAKASAAILAAMP 280

Query: 306 FLPVLILVIIGPAILSIIDT 325
           F    ++ +  P  ++ + +
Sbjct: 281 FFVSGLVYLAAPDYIAPLFS 300


>gi|288956974|ref|YP_003447315.1| type II secretion system [Azospirillum sp. B510]
 gi|288909282|dbj|BAI70771.1| type II secretion system [Azospirillum sp. B510]
          Length = 334

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 83/290 (28%), Positives = 148/290 (51%), Gaps = 4/290 (1%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKD---SASSRLRTRDSKSLRNFVKKLNLKAILVD 95
             + +R+  VA  +  +                   L  R  +S    +  L +      
Sbjct: 43  DSVRERLDWVARRQAGILVDAADDEDPGVSVRRPGELAARMLRSAHGILGSLAMANAAEQ 102

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
             I  +L  AGFR   ++++ L  +LV  +  + L ++ + G+D +       R GA+I 
Sbjct: 103 ARIRQRLLNAGFRDPETVSLFLTAKLVFGLAAIALAMVAVLGFDLVSGGAVP-RFGAIIA 161

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
             Y G   P   ++ L ++RQS+I R  PDALDLL+IC  +G S+D +L RV  ++   +
Sbjct: 162 AAYAGTILPERILALLAKRRQSAIARTLPDALDLLIICANAGYSLDLSLARVGREMRLAA 221

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             +SEE+++T  EL  L +R+ A  N   R  ++ +R+    L+Q+ +YGT +  +LR L
Sbjct: 222 RAMSEELVITADELRVLTDRREALRNLAERNDLEALRSLVATLLQAQKYGTPLTQALRTL 281

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            +E R  R+M  E++AA L   ++VP+++  LP + +++ GPA++ +  T
Sbjct: 282 AAEMRHARMMAIEERAARLPALISVPLMVLILPAVFIIVAGPAVIQVART 331


>gi|217978831|ref|YP_002362978.1| type II secretion system protein [Methylocella silvestris BL2]
 gi|217504207|gb|ACK51616.1| type II secretion system protein [Methylocella silvestris BL2]
          Length = 320

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 84/308 (27%), Positives = 156/308 (50%), Gaps = 6/308 (1%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
               +  L   +   +L       R   VA   + L+   I +   D   + L    +  
Sbjct: 15  LMAPLGMLALVIGGAALIGSGRRTRADLVAQRVDRLQSSAIAAPSSDEPEAHLTAARAPP 74

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           L      L+         + +KL+A    ++ +L    + RL +   F  L +I++    
Sbjct: 75  LLAL--SLSPAERRQVVWLFSKLQA---PADQALLYFTIARLGIAASFGALTLIFVGRLS 129

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
            +    F   + A +    VG+  P+++I+  V++R  +     PDAL+LL++CVE+G+S
Sbjct: 130 IVAG-SFLTPLMAGLAATAVGWILPAIFIAFGVRRRTKAAAAGLPDALELLVVCVEAGLS 188

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           ++ AL+RVA+++      L++E+ LT AE++ LP+R+ A  N  +R  +  V++    + 
Sbjct: 189 LEDALQRVAQELKNSQPALADELTLTWAEINILPSREQALANLADRVNVPTVKSMVSMIS 248

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           QS RYGT +  SLRV  +E R++++   E++A  L   +T+P+++F +P L L++ GPA 
Sbjct: 249 QSMRYGTPLAQSLRVGATEMRNDQMTLLEERANRLPALMTIPVMLFIMPTLFLIVGGPAA 308

Query: 320 LSIIDTMK 327
           L +ID  +
Sbjct: 309 LRLIDMFR 316


>gi|170700844|ref|ZP_02891833.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170134252|gb|EDT02591.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 324

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 75/310 (24%), Positives = 146/310 (47%), Gaps = 6/310 (1%)

Query: 18  ITTAVSIFSLIYAVV-IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           +   + IF     +V +       +E+R++  +     +         + S         
Sbjct: 11  MLAGLFIFVAGGVLVAMLLFAPRNIERRIQQASGASVGIGGGADGDDGQTSRWIAKLVEL 70

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
           S+ +         +    +  +  +L  AG+R+  +  +    + V+ ++     ++ + 
Sbjct: 71  SQPISRLS---VPQEGWENSPLRIRLMNAGWRNPNAGALYFAAKTVLALVLPGAALLALA 127

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                 +      +   +    +G+  P++ ++  +  RQ  I   +PDALDLL +CVE+
Sbjct: 128 TTRLADQRMLLSFILVAL--AGIGYYVPNMILTRRIATRQRVIFEDFPDALDLLTVCVEA 185

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+ +D AL RV+E++  +S  +S E+ L + E+     ++ A  NF  RT  + + +   
Sbjct: 186 GLGLDAALMRVSEELRFRSEVVSGELDLLLLEMRSGFTKETALRNFALRTGTEDIESFCA 245

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I    P L+ V++G
Sbjct: 246 MLIQADRFGTSIAESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMCVLLG 305

Query: 317 PAILSIIDTM 326
           PA++ +   +
Sbjct: 306 PAMIHVYRVL 315


>gi|116626772|ref|YP_828928.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229934|gb|ABJ88643.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 312

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 68/314 (21%), Positives = 144/314 (45%), Gaps = 8/314 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + + +   +   +    + +    S EL +R +    +R    + Q   +   +   +  
Sbjct: 1   MIIDLLLFLFTGAT---LSLILWTSFELFRRQEDPLNDRLEGLQSQAMVVAARATRRKQS 57

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            +       F+  L              L  AG R + +L +  +  L+  + FL  G +
Sbjct: 58  AQGLDRFLYFIA-LVPGGDDWMNGTEKLLAQAGIRRKSALALYCIFVLIF-VFFLSAGTV 115

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           ++   +          +G +     +GF  P   +  LV+  ++ ++ A PD +DLL I 
Sbjct: 116 YLQRNNPNGASSL---LGGLAAAFLLGFILPKQILYRLVKSYRTKLQDALPDTVDLLGIV 172

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           + +G+ +DQA+ RV+E++      L+ E    + ++    +R  +F  F  RT ++ +++
Sbjct: 173 LGTGLGLDQAMMRVSEEMQFIYPELANEFATVVMQVRAGQDRGKSFNQFVRRTGIEDIKS 232

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            +  +IQS+++GTS+  +L+V     R+ R + AE      G K+  P+++F LPVL ++
Sbjct: 233 LSAMIIQSEKFGTSLAQALKVYADALRTRRRLRAEAAVGKAGIKMLFPIVVFILPVLFVI 292

Query: 314 IIGPAILSIIDTMK 327
            + P +LS++  +K
Sbjct: 293 TLVPGMLSVMKDLK 306


>gi|197337342|ref|YP_002157817.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
 gi|197314594|gb|ACH64043.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri MJ11]
          Length = 293

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 111/244 (45%), Gaps = 6/244 (2%)

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
                + L   A    ++I  K  +AG       ++ + V+ +   I   +  + +    
Sbjct: 52  FDKVERFLPSVASNDADSIERKFYSAGLYESKYAHLYMPVKYLSAAIGSGIIYLLLGKDS 111

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
            +      + +  V+ I       P   +S+  +  +  +    P  LDLL +CV +G++
Sbjct: 112 SMTTQVALMCIWLVVCIS-----IPDAILSSRKKALEEKLSGQLPYLLDLLAMCVHTGMT 166

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           I+ +L  +A+++ G    L+  +  T    +     + A +  Y R   + +R+    L 
Sbjct: 167 IESSLSYLAKEMQGFDKDLAHMIARTNDRANI-VGLEPALDELYVRVPTNEMRSFVMTLK 225

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           QS  YG+SI + L  L ++ RS RL+  E+K   L  K++VP+I+F +  ++++I  P +
Sbjct: 226 QSLHYGSSIYEILNTLAADIRSVRLLSLEEKVGKLAAKMSVPLILFIMIPVVILIAAPGV 285

Query: 320 LSII 323
           + ++
Sbjct: 286 MRMM 289


>gi|115525753|ref|YP_782664.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519700|gb|ABJ07684.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
          Length = 324

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 56/319 (17%), Positives = 119/319 (37%), Gaps = 27/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                LA+A    V++  + +  + P L         K     R  L + +  + Q D  
Sbjct: 1   MQMQTLAIAFMATVAVGGVAWVFLYPLLSGE------KKAEQRRASLARPEPVARQVDKG 54

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   +L+    +   +  +    I  +L  AG   +++     +   V+     
Sbjct: 55  QRSRREQVELTLKEVDARRQKEKKV---AISTRLTQAGL--DWAPKNFYIGSAVLGAAVF 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L  +   G              AV L    GF  P   +S L ++R+ +  +A PDA+D
Sbjct: 110 ALVYLSRGGITP-----------AVGLGFAAGFGLPRWLLSFLKKRRERNFLKALPDAVD 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  +++G+ +  +++ VA        PL  E L  +   +       A    Y R  +
Sbjct: 159 VIVRGIKAGLPLYDSIKVVA---ADAPEPLRTEFLTILDTQAIGMPLGEACGRLYERMPL 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M  + +A S+  K +  +I    P
Sbjct: 216 PEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQAMSMEAKASAGIIGSLPP 275

Query: 309 V--LILVIIGPAILSIIDT 325
           +   ++ +  P  ++++ T
Sbjct: 276 IVMFLVYLTTPDYIALLWT 294


>gi|257139199|ref|ZP_05587461.1| type II secretion system protein F [Burkholderia thailandensis
           E264]
          Length = 314

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 136/265 (51%), Gaps = 1/265 (0%)

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
             D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV
Sbjct: 51  PADDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFRERRAVSVMAGLKLVV 110

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
                +  ++      ++ +Y F LRV  +     +G   P   +   V +RQ +I    
Sbjct: 111 GACAGLAALVVGAHVPRVGDY-FVLRVLMMAGAFVIGMMLPEHALGFAVARRQKTIAAYL 169

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDLL+IC  +G S+  A+RRVA ++G    PL++E  +   EL    +   A     
Sbjct: 170 PDALDLLVICTNAGNSLAVAIRRVASELGTICPPLADEFSVCADELQIGGDAAFALNAMA 229

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM+
Sbjct: 230 ARIGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMM 289

Query: 304 IFFLPVLILVIIGPAILSIIDTMKD 328
           +F +P + L+  GPA++ +I     
Sbjct: 290 LFVMPTVALIAAGPAVIRLIAVFHK 314


>gi|296131925|ref|YP_003639172.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296030503|gb|ADG81271.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 319

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 73/311 (23%), Positives = 144/311 (46%), Gaps = 23/311 (7%)

Query: 16  VAITTAVSI---FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           + I TA+++      +  + +  L    L + + +   +R+ LR +   +          
Sbjct: 18  IVIVTALALCSWALAVTCLYLHWLNKKNLFEYLGAKKEKRKKLRLKTRLTTG-------- 69

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                K      ++  L   +  E +  +L  AG  S+ ++   L +R V+ +  L++  
Sbjct: 70  VIELGKKFAPVGQRFKL--FVSAEKLERQLALAGNPSDLNVGGFLGLRFVLFVAGLLIAD 127

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +W++       +   L +  +I++   GF  PS+WI+ L + RQ  I    PD LD + +
Sbjct: 128 VWLY-------FGMPLALFVLIVLPMCGFVLPSIWINMLAKSRQEQIALGLPDFLDGMSV 180

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            +++G+ +D A+ +V   + G   PL+EE+     EL     R+ A+    NR + + + 
Sbjct: 181 TLQAGVPLDAAMNQVVNHMEG---PLAEELQRFNRELELGVPREEAYHRLVNRNECEELE 237

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
              Q+LIQ  + G  I  + +V+  + R  R  + ++KAA   PK+T+       P ++L
Sbjct: 238 TLVQSLIQGSKLGVPIARTFKVMADDMRITRFNKVKEKAAKASPKVTLVTSFIITPGVML 297

Query: 313 VIIGPAILSII 323
            I+G  +L+II
Sbjct: 298 AILGLIVLNII 308


>gi|42522078|ref|NP_967458.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
 gi|39574609|emb|CAE78451.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
          Length = 258

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/237 (21%), Positives = 113/237 (47%), Gaps = 6/237 (2%)

Query: 87  LNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
           + +++    + +   ++ +G  SE + +  + ++ +  I+F I  +I  F          
Sbjct: 24  MKIRSESYRKKVRKYIKTSGLSSELNEDEFIGLQFLWGIMFPIFLLIMNFSL------QL 77

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
            L    V+ +G +GF  P +      ++R+ S++   P  +DLL + VE+G+    A+++
Sbjct: 78  GLSPMVVVGMGLIGFYLPQIHARGEKKRRELSVRADLPFFIDLLALSVEAGLDFFSAIQK 137

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           + +   G    L+EE  + + ++    ++  A +    R  M+ + +    L+ ++  G 
Sbjct: 138 IVDKANGTDSVLAEEFSIVLKDIKIGSSKAQALKEMAERLDMNEITSFVAVLVDAESTGA 197

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
           SI   L+    + R ER + AEK  A     + +P+++F LP + +++ GP  +S +
Sbjct: 198 SISQVLKDQSVQMRLERFVRAEKAGAQASQTMLIPLMLFILPAVFIIVFGPVAVSFM 254


>gi|329905442|ref|ZP_08274132.1| Flp pilus assembly protein TadC [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547599|gb|EGF32397.1| Flp pilus assembly protein TadC [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 312

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 58/323 (17%), Positives = 120/323 (37%), Gaps = 20/323 (6%)

Query: 7   DLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
                   +  I        L  A++   +G    E            +  +        
Sbjct: 4   TNMTPPSHSTLIFLLALAIGLSVALIGWLVGRSVAE------------VPTETRDYKDAP 51

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
               R+     + + +++  L + +      +  ++R AG     + +  L  RL+   +
Sbjct: 52  PLGFRMAWWPIQWISHYLALLGIASSDDKSWL--RIRRAGLDYMLTPSQFLAARLLCMCL 109

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGA----VILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
              L    +     +        + A     +     G+  P +W+ + +  RQ  I ++
Sbjct: 110 AAALCCWLLNTLAHVRVGAEPFSMAAYGQAALFGMLSGWFVPRLWLHDRIALRQREILKS 169

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
            P  LD++ +CVE+G+++  AL +  +   G      +E    + ++     R  A    
Sbjct: 170 LPFFLDIVTLCVEAGLNLQGALSQAVD--KGPPGAFRDECQRVLRDVRAGKARAEALRAM 227

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R +   + +   ++IQ++  G ++G  LR    + RSER   AEKKA     KL +P+
Sbjct: 228 AERLREPGITSFVTSVIQAESMGMNLGPVLRAQADQRRSERFQRAEKKALEAPVKLLLPL 287

Query: 303 IIFFLPVLILVIIGPAILSIIDT 325
           I F  P   +V+  P ++  +  
Sbjct: 288 IAFIFPCTFIVLFFPIVMQFLHA 310


>gi|114798049|ref|YP_761687.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738223|gb|ABI76348.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 58/315 (18%), Positives = 118/315 (37%), Gaps = 10/315 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            +    A   F  I  + +   G  +   R ++ A+               D    R   
Sbjct: 1   MIPYIVAALAFLAIAGLGLVLTGGNDDAARKRARAISAGRGGAPVKGGKVVDENIRRRAK 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                     +    +      NI +KL  AG   E  + +  ++  V  +I   +  I 
Sbjct: 61  TQEMLEGLRRQDKERRRNDPMRNIGSKLTQAGL--EIPVPMFWLLSAVCGLICAGIVYIS 118

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVG-FCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                 +     + R   +    + G    P   ++ L++ R + +   + DALD+++  
Sbjct: 119 GADGLVINGISLKSRPVLIAAAFFGGTLGIPQFILNFLIKGRHTKMINQFADALDIIVRG 178

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V SG+ +++ +R +A+       PL +E L     L+     + +    Y R  +  +  
Sbjct: 179 VRSGLPLNECIRVIAK---ESPEPLRKEFLTFADNLAMGAGLERSLAALYKRLPLQEINF 235

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV---L 310
               LI   + G ++ ++L  L +  RS ++M  + KA S   K +  MII  LP+   +
Sbjct: 236 FAIVLIIQSKAGGNLSEALHNLSTVIRSRKMMREKVKALSSEAKASA-MIIGSLPIAVGV 294

Query: 311 ILVIIGPAILSIIDT 325
           ++ +  P  +  + T
Sbjct: 295 MVFLTTPDYIMTLFT 309


>gi|159901127|ref|YP_001547374.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894166|gb|ABX07246.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 301

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 72/308 (23%), Positives = 137/308 (44%), Gaps = 11/308 (3%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + +   + +  +++ V    L     ++R       R     ++  +L+          R
Sbjct: 1   MPLLIGLVVLVIVFGVGFMVLN----QRRQTDTVSSRLAQFTERSMNLEDLELQLPFMQR 56

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               + N V     ++   ++ + N L  AG     +  +   +R+ + +    +    I
Sbjct: 57  VVTPMLNNVFVKLGQSGKGNDKLRNNLMLAGNPGNLTPTMFTGMRIFMALALFGV----I 112

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
           F    L +      +    + G +GF  P++W+   ++KRQ  I +A PDALDLL I V 
Sbjct: 113 FLICMLAKVQTLSAIQWSGVGGALGFLLPAMWLGRQIKKRQKLILKALPDALDLLSISVT 172

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+  D AL+RVAE        L  E    ++++     R  AF +   RT ++ + +  
Sbjct: 173 AGLGFDAALQRVAEK---WDNELCREFRRALSDIRLGTQRHEAFRSMTVRTGVEDLTSFV 229

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            A+IQ+D+ G S+G  L++   + R  R   AE++A     K+  P++    P + +VI+
Sbjct: 230 SAVIQADQLGVSMGKMLKIQSDQLRLRRRQRAEEEAQKAPIKMLFPLVFLIFPSMFVVIL 289

Query: 316 GPAILSII 323
           GPAI  ++
Sbjct: 290 GPAIPRLL 297


>gi|27365656|ref|NP_761184.1| type II/IV secretion system protein TadC [Vibrio vulnificus CMCP6]
 gi|27361804|gb|AAO10711.1| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus CMCP6]
          Length = 293

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 68/313 (21%), Positives = 143/313 (45%), Gaps = 20/313 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            V     + + +L+  VV   L     +++ +   +   + R+   +S       + +  
Sbjct: 1   MVIAQIVMLVSALMLLVVTSLLWHNTSQRKRREARLSHYVKRQAAASSSNHSLMHNWITQ 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            +   L                     L  AGF    +L+ LL+ +    I  L+  ++ 
Sbjct: 61  NEKARLS------------------RLLANAGFHKPQALSWLLLAKFGSGI--LVALLLL 100

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +            L +  V++   +G   P  W++    + +  +K++ PDA+DLL++CV
Sbjct: 101 MRQSINGEAIVSMLSLTLVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLCV 160

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ESG+S+++A  RVA  +  Q  P++E+  +T AEL  L +R  A  N   RT +  +   
Sbjct: 161 ESGLSLNRAFERVARYLQEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHTL 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L  +D+YG+ + D+LR +  + R +R ++ E++A  L  K+T+  +   +  +++++
Sbjct: 221 ATTLTMADKYGSPLADTLRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVMV 280

Query: 315 IGPAILSIIDTMK 327
           I P +  ++ ++ 
Sbjct: 281 ISPILSQLLTSLA 293


>gi|260461945|ref|ZP_05810190.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032192|gb|EEW33458.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 337

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 118/320 (36%), Gaps = 21/320 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T LA  +    S  ++ YA +   + +     +        E  R     +  + + 
Sbjct: 4   IDGTVLAFVVLAGFSAGAVAYAFLFNQISNERQTGKRLETIKAAETDRSVVKATRDRATD 63

Query: 69  SSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           +++ R     SL+   +K   K   +    +  +LR AG   +  +    +   +  I  
Sbjct: 64  AAKRRKSVQDSLKELDEKQKSKDSAIKKPPLKAQLRQAGM--KVPIERFYIYSAICGIAL 121

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            ++  +       L           V+L G +G   P  ++S    +R  +    +P+AL
Sbjct: 122 TVIAFVAGAPLIVLPG---------VLLAGALG--LPRWFVSFRRSRRVKAFLNEFPNAL 170

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  V+SG+ ++ A+R +A        P+  E    +       +   A         
Sbjct: 171 DIIVRAVKSGLPLNDAVRLIAN---EAPEPVKTEFRRIVDSQQMGLSIPDATLRMPETMP 227

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
                     +    + G ++ ++L  L    R  + M+A+ +A S+  K +   II  L
Sbjct: 228 CTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQALSMEAKASAA-IIGAL 286

Query: 308 PVLILVII---GPAILSIID 324
           P ++  ++    P+ L  + 
Sbjct: 287 PFIVAFLVYLSSPSYLMPLF 306


>gi|50119739|ref|YP_048906.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610265|emb|CAG73708.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 319

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 76/291 (26%), Positives = 145/291 (49%), Gaps = 5/291 (1%)

Query: 39  GELEKRMK-SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDEN 97
            +LE RM+  +         Q      + +A S L  +  + L    ++L+  +     N
Sbjct: 33  KQLEIRMRGHLPSASIEAASQDNILRGQGTALSPLLEKLLQPLATQGERLS-GSDRDRRN 91

Query: 98  IVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           +   L  AG R   ++  L++ +         L I  ++G+    +      V A ++  
Sbjct: 92  LRRLLDLAGLRRNEAVGWLVMGKFA---AGAFLAIALVWGWLPPADRAGLTGVAAGLIGF 148

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           +VG   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  
Sbjct: 149 FVGSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPE 208

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +++E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  
Sbjct: 209 MADELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIAD 268

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           E+R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ +I  +  
Sbjct: 269 ESRKTLILGLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVIRLLAQ 319


>gi|254293218|ref|YP_003059241.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041749|gb|ACT58544.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 331

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 53/316 (16%), Positives = 110/316 (34%), Gaps = 20/316 (6%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +  +    A   F  +  V     G G  + + K               +   D+   R 
Sbjct: 3   QTMIVYLIAGLAFVSVVGVGFAFTGGGTTKAQQKRFKQVAVGAGSGGKKNSSVDATLMRR 62

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           +           ++   +       I +KL  AG+              + P +F +L  
Sbjct: 63  KQMQDSMKTLRERENKRRKDTRGRTIKDKLAQAGW-------------TIEPAMFWVLSA 109

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +       +     Q  +             P   +   +  RQ    + + D +D+++ 
Sbjct: 110 VTGVVVAGITFVLGQTPLIIAGAGFAGALGLPRWVVGMGISARQKKFTQQFSDGIDVIVR 169

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            V+SG+ + + LR +A        PL  E    I  +      + +  N YNR  +  V 
Sbjct: 170 GVKSGLPLIECLRIIAS---ESPAPLGTEFKRVIDAIQMGTTVEKSLSNMYNRMPLPEVN 226

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                +    + G ++ ++L  L    RS +++  + KA S   K +  MII  LP+ ++
Sbjct: 227 FFGIVIGIQQQSGGNLSEALGNLSEVLRSRKMLAEKVKALSSEAKASA-MIIGALPIAVM 285

Query: 313 VII---GPAILSIIDT 325
           +++    P  ++++ T
Sbjct: 286 ILVYFSSPDYITLLFT 301


>gi|167842403|ref|ZP_02469087.1| bacterial type II secretion system protein F domain [Burkholderia
           thailandensis MSMB43]
          Length = 244

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 124/244 (50%), Gaps = 1/244 (0%)

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
           +++ +        +  +L +AGFR  +++++++ ++LVV      L  + +  +      
Sbjct: 2   ERVPVVDATQRMKLAARLASAGFRECHAVSVMVGLKLVVG-ACAGLAALVVGAHVPRAGD 60

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
              LRV  +     +G   P   +   V +RQ +I    PDALDLL+IC  +G S+  A+
Sbjct: 61  YVVLRVLMMAGAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVICTNAGNSLSVAI 120

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
           RRVA ++     PL++E  +   EL        A      R  +  +R     L+QS +Y
Sbjct: 121 RRVASELKTICPPLADEFSVCANELQIGGEPAFALNAMAARIGLPSMRALVTTLVQSQQY 180

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           GT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I 
Sbjct: 181 GTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLIA 240

Query: 325 TMKD 328
               
Sbjct: 241 VFHK 244


>gi|37680188|ref|NP_934797.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37198935|dbj|BAC94768.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 293

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 67/313 (21%), Positives = 142/313 (45%), Gaps = 20/313 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            V     + + +L+  VV   L     +++ +   +   + R+   +S       + +  
Sbjct: 1   MVIAQIVMLVSALMLLVVTSLLWHSTSQRKHREARLSHYVKRQAVASSSNHSLMHNWITQ 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            +   L                     L  AGF    +L+ LL+ +    I  L+  ++ 
Sbjct: 61  NEKARLS------------------RLLANAGFHKPQALSWLLLAKFGSGI--LVALLLL 100

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +              +  V++   +G   P  W++    + +  +K++ PDA+DLL++CV
Sbjct: 101 MRQSINGEAIVSMWSLTLVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLCV 160

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ESG+S+++A  RVA  +  Q  P++E+  +T AEL  L +R  A  N   RT +  +   
Sbjct: 161 ESGLSLNRAFERVARYLQEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHTL 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L  +D+YG+ + D+LR +  + R +R ++ E++A  L  K+T+  +   +  +++++
Sbjct: 221 ATTLTMADKYGSPLADTLRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVMV 280

Query: 315 IGPAILSIIDTMK 327
           I P +  ++ ++ 
Sbjct: 281 ISPILSQLLTSLA 293


>gi|170704228|ref|ZP_02894801.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170130863|gb|EDS99617.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 255

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 137/255 (53%), Gaps = 1/255 (0%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           R   ++ L    ++L +   +    +  +L  AGFR   +++ ++ ++L   ++F    I
Sbjct: 2   RQDLTRRLAQLGERLPVLDPMQRVKLGLQLTRAGFRERRAVSAMIGIKLSCGVLFAGFAI 61

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           ++     +L E+ F +R  A++    +G   P   +  ++++R+  I   +PDALDLL+I
Sbjct: 62  VFSPYIPRLGEF-FVIRAVAMVGAFVIGVIVPEYVLGAMIRRRRRIIAACFPDALDLLVI 120

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           C  +G S+   +RRVA ++     PL++E+ +   EL+   N   A  +F  R      R
Sbjct: 121 CTMAGNSLASGVRRVARELQRICPPLADELTVCADELTLSGNVSEALAHFALRVNFSSAR 180

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    L QS R+GT I  +LR L    R+E+++  E+KAA L PK+TVPM++F LP + L
Sbjct: 181 SLATTLTQSQRFGTPITQALRTLSRSERTEQVVALEEKAAKLAPKITVPMMLFILPTVGL 240

Query: 313 VIIGPAILSIIDTMK 327
           +  GPA + +I+  K
Sbjct: 241 IAAGPAAIRLIEVFK 255


>gi|13474664|ref|NP_106233.1| hypothetical protein mlr5603 [Mesorhizobium loti MAFF303099]
 gi|14025419|dbj|BAB52019.1| mlr5603 [Mesorhizobium loti MAFF303099]
          Length = 337

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 119/320 (37%), Gaps = 21/320 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T LA  +    S  ++ YA +   + + +   +        E  R     +  + + 
Sbjct: 4   IDGTVLAFVVLAGFSAGAVAYAFLFTQISNEKQAGKRLETIKTAETDRSIVKATRDRATD 63

Query: 69  SSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           +++ R     SL+   +K   K   +    +  +LR AG   + S+    +   +  +  
Sbjct: 64  AAKRRKSVQDSLKELDEKQKTKDSAIKKPPLKAQLRQAGM--KVSIERFYIYSAICGLAL 121

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            ++  +       L           V+L G +G   P  ++S    +R  +    +P+AL
Sbjct: 122 TVVAFVVGAPMLVLPG---------VLLAGALG--LPRWFVSFRRARRVKAFLNEFPNAL 170

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  V+SG+ ++ A+R +A        P+  E    +       +   A         
Sbjct: 171 DIIVRAVKSGLPLNDAVRLIAN---ESPEPVKAEFRRIVDSQQMGISIPDATLRMPETMP 227

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
                     +    + G ++ ++L  L    R  + M+A+ +A S+  K +   II  L
Sbjct: 228 CTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQALSMEAKASAA-IIGAL 286

Query: 308 PVLILVII---GPAILSIID 324
           P ++  ++    P  L  + 
Sbjct: 287 PFIVAFLVYLSSPDYLMPLF 306


>gi|227114881|ref|ZP_03828537.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 319

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 72/291 (24%), Positives = 144/291 (49%), Gaps = 5/291 (1%)

Query: 39  GELEKRMK-SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDEN 97
            +LE RM+  +         Q+     + +  S L  +  + L    ++L+  +     N
Sbjct: 33  KQLEVRMRGHLPSASIEAASQENILRGQGTTLSPLLEKLLQPLATQGERLS-GSDRDRRN 91

Query: 98  IVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           +   L  AG R   ++  L++ +     +  I     ++G+    +      V A ++  
Sbjct: 92  LRRLLDLAGLRRNEAVGWLVMGKFAAGALLAIAL---VWGWLPPADRAGLTGVAAGLIGF 148

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           +VG   P  W+      R   +  A PDALDL+++C E+G+ I + L+ V++++G  S  
Sbjct: 149 FVGSMVPEWWLKWRAASRGEKLACAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPE 208

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +++E+  T AEL  L +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  
Sbjct: 209 MADELHYTAAELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIAD 268

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           E+R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ ++  +  
Sbjct: 269 ESRKTLILSLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVVRLLAQ 319


>gi|227326306|ref|ZP_03830330.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 319

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 69/275 (25%), Positives = 138/275 (50%), Gaps = 4/275 (1%)

Query: 54  ILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
               Q+     + +  S L  +  + +    ++L+  +     N+   L  AG R   ++
Sbjct: 49  EAASQENILRGQGATLSPLLEKLLQPIATQGERLS-GSDRDRRNLRRLLDLAGIRRSEAV 107

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
             L++ +        +  I  ++G+    +      V A ++  +VG   P  W+     
Sbjct: 108 GWLVMGKFA---AGALFAIALVWGWLPPADRAGLTGVAAGLIGFFVGSMVPEWWLKWRAA 164

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  +++E+  T AEL  L 
Sbjct: 165 SRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMADELHYTAAELQILS 224

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
           +R +A ++   RT++  + +    LIQ++RYGT +  +LR +  E+R   ++  E+KA  
Sbjct: 225 DRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADESRKTLILGLEEKAGK 284

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           L  +L+VP++   LP +I ++  PA++ +I  +  
Sbjct: 285 LPAQLSVPLMALILPPIIAIMASPALVRVIRLLAQ 319


>gi|114705451|ref|ZP_01438359.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540236|gb|EAU43356.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 335

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/313 (15%), Positives = 119/313 (38%), Gaps = 19/313 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   + + +S   L YA + P L + +     K+     E  R + I + ++    ++ R
Sbjct: 7   MLFVLLSTISAGCLAYAFMQPKLAASKRVAARKTTYSRDEASRTRVIEAKERMQEQAKRR 66

Query: 74  TRDSKSLRNFVKKLNLKAI-LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                +L++   +   +        +  ++  AG   + +     ++   +     +L +
Sbjct: 67  RALQNNLKDLEDRAKERGGHSAKPTLQQRIDQAGL--KITAKKFRLISAGLAAAAFLLTL 124

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           ++       L            +    G   P  ++SN  +KR +    ++P A+DL++ 
Sbjct: 125 VFGLPILATLG-----------IAVVAGLGLPRAFLSNRRKKRINDFSNSFPTAIDLIVR 173

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            V++G+ ++  LR V  D+     P+S E    +           A +  Y +  +    
Sbjct: 174 GVKAGLPLNDTLRTVVSDVPD---PVSSEFQKVVEAQQMGVTLGDACDRLYKQVPLPETN 230

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF--LPVL 310
                +    + G ++ ++L  L    R  + M  + +A S+  K +  +I     L   
Sbjct: 231 FFAIVIAIQSQAGGNLSEALGNLSRVLRERKKMRQKIQAVSMEAKASASIIGSIPVLVAS 290

Query: 311 ILVIIGPAILSII 323
           ++ +  P  L+++
Sbjct: 291 MIYMTSPDYLNVL 303


>gi|86159245|ref|YP_466030.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775756|gb|ABC82593.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 306

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 70/273 (25%), Positives = 137/273 (50%), Gaps = 4/273 (1%)

Query: 54  ILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSL 113
                 +    + +A+  L    +  L+  +  +  +  +    +  +L  AG R   + 
Sbjct: 30  RREADPVVRRLRATAAGALDGDPALQLQPGLASVEEEPGVGGSRLRRELVWAGIRRAGAA 89

Query: 114 NILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQ 173
              +  +    +   +  +      + L   P +  + A  LI  + F  P++W+   VQ
Sbjct: 90  QGFVAAK----VALAVGALAAFAALNALRTEPVRTGLPAAALITGLAFFLPNLWLRARVQ 145

Query: 174 KRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLP 233
            RQ+ + R+ PDALDLL+ CVE+G+ +D AL+RV++++      LS+E+ L   E+    
Sbjct: 146 ARQTQLDRSLPDALDLLVTCVEAGLGLDSALQRVSDEVALAHPLLSKELRLVFLEVKAGI 205

Query: 234 NRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS 293
            R  AF     RT    +R+ +  L Q++ +GTS+G +LR+     R  R+  AE+KAA 
Sbjct: 206 ARISAFRRMAERTGAPELRSLSATLAQTELFGTSVGAALRIQAEGIRIRRMHRAEEKAAY 265

Query: 294 LGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +  K+++P+++  LP +  V++GPA++++ + +
Sbjct: 266 VSVKMSLPLVLCILPCVFAVVLGPAVVNMAERL 298


>gi|301168390|emb|CBW27980.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 404

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/221 (25%), Positives = 99/221 (44%), Gaps = 8/221 (3%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           L +AG     +       ++ + + F I+        ++      +  +  + +IG VGF
Sbjct: 187 LASAGLTDVLTPEDFFSFKIFLIVGFPIVFFGIRVFLEE------EWPLTLIPIIGAVGF 240

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +WI   ++ RQ  +  A P  +D+L + VE+G+    A+ +V E        LSEE
Sbjct: 241 VYPDIWIKGRIEMRQKEVIMAMPFCVDMLALSVEAGLDFVAAMTKVVEKAKKT--ALSEE 298

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
               I E+    +R  A  N   R  +  + +    LI +D  G SIG  L+ L  E R 
Sbjct: 299 FETMIKEIRIGASRAEALRNLAWRIDLIQISSFCATLIAADSVGASIGPILKALSMEIRQ 358

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           ++  E EK  A+   K+  PM+   +P + +V+  P +L +
Sbjct: 359 KKSSEVEKAGATAATKILFPMLFLIVPAVFIVVAAPIVLEL 399


>gi|163801672|ref|ZP_02195570.1| hypothetical Flp pilus assembly protein TadC [Vibrio sp. AND4]
 gi|159174589|gb|EDP59391.1| hypothetical Flp pilus assembly protein TadC [Vibrio sp. AND4]
          Length = 280

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/263 (17%), Positives = 109/263 (41%), Gaps = 9/263 (3%)

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            T  ++   +  +     ++  +  +          + +  KL  AG+ +          
Sbjct: 23  RTEQRRKKIALYVDGNVHRAPSSVNRFFVRFGKEHRKELEQKLVQAGYYNTEWAKFYFPA 82

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +        +L +  +FG   L +     ++ A+++   V    P   +    +      
Sbjct: 83  K--------LLVLALVFGGVFLSDMKQSNQLIAIMVGLIVVILGPDSLLQMRRKMLIRKT 134

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
               P  LD++ +CV++G++I+ AL  + +++      L  ++  T          + A 
Sbjct: 135 SAQLPYLLDMMSVCVQTGMTIEAALVYLGKELAEFDSDLCYQIKRTSDSAKI-QGLEKAL 193

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
            +   R     VR+    +IQ+ ++GTS+   L  L  + R  +++  E+K   L  K++
Sbjct: 194 TDLSERIPTPPVRSFVLTIIQNLQHGTSVAQILSDLAEDMRKMQILTVEEKVGKLSAKMS 253

Query: 300 VPMIIFFLPVLILVIIGPAILSI 322
           +P+IIF +  ++++I+ P I+ +
Sbjct: 254 LPLIIFIMFPIVILILAPGIMQM 276


>gi|221197785|ref|ZP_03570831.1| type II secretion system protein [Burkholderia multivorans CGD2M]
 gi|221204657|ref|ZP_03577674.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221213135|ref|ZP_03586111.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221167348|gb|EED99818.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221175514|gb|EEE07944.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221181717|gb|EEE14118.1| type II secretion system protein [Burkholderia multivorans CGD2M]
          Length = 330

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 61/294 (20%), Positives = 124/294 (42%), Gaps = 8/294 (2%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL---NLKAILVD 95
             L++RM ++   R     ++  + + D+  S+   R  + L     +     L   +V 
Sbjct: 41  DALDRRMAALEAARTRPAGEEDAAAKPDARRSQRVERLLERLSAAGMRWLDTGLGKHVVA 100

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E     L   G+    +  + L  RL + +   +L  I   G      +     +  +  
Sbjct: 101 EEDRRLLEQCGYVDARTRGLFLSARLAMGVGLPLLFAIVASGRVSGGYW-----MIGMCA 155

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
              VGF  P ++I      R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G  
Sbjct: 156 AFGVGFMLPKLYIRRRAAARRQSVGNELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGML 215

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             LS E+ +   + +    R+ + +   +    + +R   + +IQ D++G ++ + L+  
Sbjct: 216 PVLSSEVGIAQRQFAAGRTREQSLQRLSSGFDNEDLRAVVRLMIQVDKHGGAVQEPLKQF 275

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
               R  R     ++   L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 276 GDRLRETRRALLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGMLAVMRALSPH 329


>gi|300021858|ref|YP_003754469.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523679|gb|ADJ22148.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 332

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/318 (16%), Positives = 122/318 (38%), Gaps = 29/318 (9%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELE-KRMKSVAVEREILRKQQITSLQKDSASS 70
             + V +  A++    IYA+  P       + KR++SV      +              S
Sbjct: 10  LRVIVPLLAALAFAGGIYALAYPYFSGDREKDKRLESVVGRSRKVGGALSE------IQS 63

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
             +   + +L+    + N K  +    +  +L  AG   +++     +   +  I+   L
Sbjct: 64  SRKKSVADTLKEMEDRQNAKKKI---TMGLRLERAGV--KWTPRDFYIGSAIAGIVLGGL 118

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
                        +        V+ +    F  P   ++ L ++RQ+       +A+D++
Sbjct: 119 CF----------NFLNLPIAATVVALFVGAFGIPRWVVAKLTKRRQAKFTSHLANAIDVV 168

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +  V+SG+ +++ L+ +A        PL+ E    + +         A +  Y+R  +  
Sbjct: 169 VRGVKSGLPLNECLQVIAR---ESPEPLAGEFRSVMEQQRLGVPLADALDRMYDRMPLAE 225

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           VR  T  +    + G ++ ++L  L    R  +++  + KA S   K +  M++  LP  
Sbjct: 226 VRFLTIVIAIQQQAGGNLSEALSNLSGVLRDRQMLALKVKALSAEAKASA-MVLASLPPG 284

Query: 311 ILVII---GPAILSIIDT 325
           ++ ++    P  +  + T
Sbjct: 285 VMFMVYMSSPGYMMPLFT 302


>gi|254245561|ref|ZP_04938882.1| Flp pilus assembly protein TadC [Burkholderia cenocepacia PC184]
 gi|124870337|gb|EAY62053.1| Flp pilus assembly protein TadC [Burkholderia cenocepacia PC184]
          Length = 330

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/334 (17%), Positives = 128/334 (38%), Gaps = 18/334 (5%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGS----------GELEKRMKSVAVEREILRKQ 58
             AT++        ++  L+  +V     +            L++RM ++   +    + 
Sbjct: 1   MTATQIGAIALAVGALGVLLLGMVAMLRANAAARAERALVDALDRRMAALEAAKARPAQD 60

Query: 59  QITSLQKDSASSRLRTRDSKSLRNFVKKL---NLKAILVDENIVNKLRAAGFRSEYSLNI 115
              S + +    +   R    L     +          V E     L   G+    +  +
Sbjct: 61  GNVSAKANVRGGQRVERWLDRLSAAGMRWLDTGFGKYAVAEEDRRLLEQCGYIDARTRGL 120

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
            L  R+   I   +L  I   G  K   +     +  +     +GF  P +++      R
Sbjct: 121 FLSARVACGIALPLLFAICASGRMKGSIW-----MVGMCAALGLGFMLPKLYVQRRAASR 175

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           + S+    P  +D+L +    G+S+DQ+L+ V  D  G    LS E+ +   + +    R
Sbjct: 176 RQSVVDELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGMLPVLSSEVGIAQRQFAAGRTR 235

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           + + +   +    + +R   + +IQ D++G ++ + L+      R  R     ++   L 
Sbjct: 236 EQSLQRLSSGFDNEDLRAIVRLMIQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIGRLT 295

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            K+T  M++  LP L++V  GP +L+++  +   
Sbjct: 296 VKMTGVMVLTLLPALLIVTAGPGMLAVMRALSSQ 329


>gi|209809175|ref|YP_002264713.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
 gi|208010737|emb|CAQ81128.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
          Length = 292

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/317 (17%), Positives = 129/317 (40%), Gaps = 28/317 (8%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +  ++ +  A+  +  +  L + +    L    L K + S                    
Sbjct: 1   MITSSVVLYAVLVSFGLVLLFWLLYQIVLQRKALLKFLAS-------------------- 40

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             + + TR+   +    + L        +++  K  +AGF      ++ +  +     I 
Sbjct: 41  --NEILTRNENVINKVEQFLPSSVSTNADDVERKFYSAGFYQFKWAHLYMPAKYAAAAIG 98

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            +        +    +   +  +  + +   +    P + +++ ++  +  +    P  L
Sbjct: 99  GV-----TIYWLSRSDTDPKEIIAYMCIWLVICILIPDLILNSRIKTLRDKLSSQLPYLL 153

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL +CV +G++I+ ++  +A+++ G    L+  +  T           VA +  Y +  
Sbjct: 154 DLLAMCVHTGMTIESSMAYLAKEMRGFDKDLAHMVSRTNDRARI-VGLSVALDELYIKVP 212

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +R+    L QS  YG+SI   L  L  + R+ RL+  E+K   L  K++VP+I+F +
Sbjct: 213 TNEMRSFVMTLKQSLHYGSSIYGILNTLAEDIRNVRLLSLEEKVGKLAAKMSVPLILFIM 272

Query: 308 PVLILVIIGPAILSIID 324
             ++++I  P I+ ++ 
Sbjct: 273 IPVVILIAAPGIMRMMS 289


>gi|325964126|ref|YP_004242032.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470213|gb|ADX73898.1| Flp pilus assembly protein TadC [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 294

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 71/312 (22%), Positives = 138/312 (44%), Gaps = 20/312 (6%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +   VS+  +   V   +     ++K+ +    E        ++                
Sbjct: 3   LIILVSVILVCVPVAGLTWSVLTVDKQGQVAVGELLARGTASVSVASATKR--------- 53

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
             L    ++L     ++   +   L  AG      L  +L  +L + +  L++G+     
Sbjct: 54  TMLETIGRRLTPPGYVLF--LDRLLSLAGRPLSMPLGKVLGTKLALGLTGLVVGLYMTAV 111

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
                     L   A + + ++G+  P + + +  ++RQ  I+    + LD +LI VE+G
Sbjct: 112 ------GTTPLMKLAGLFVLFMGYFIPDLLLYSKGKERQKVIQLELANTLDQMLISVEAG 165

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +  + A+ R  E+  G   PL+EE++ T+ ++    +R+ A+     RT +  +R+  QA
Sbjct: 166 LGFEGAMARAGENGKG---PLAEELVRTLQDMQVGRSRREAYLALAERTSIPELRSFVQA 222

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+D YG +I   LRV     R +R   AE+KA  L   +  P++ F  PVL + I+GP
Sbjct: 223 IIQADTYGIAISRVLRVQAKVMRMKRRQRAEEKAMKLPVMILFPLLFFIFPVLFIAILGP 282

Query: 318 AILSIIDTMKDH 329
           A+++ + T+   
Sbjct: 283 AVINTVVTLSGQ 294


>gi|172065281|ref|YP_001815993.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171997523|gb|ACB68440.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 324

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 75/311 (24%), Positives = 144/311 (46%), Gaps = 6/311 (1%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +     + +   + A  +       +E+R++  +     +         + S        
Sbjct: 11  MLAGLFIFVAGGVLA-AMLLFAPRNIERRIQQASGASVGIGGGADGGDGQTSRWIAKFVE 69

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            S+ +         +    +  +  +L  AG+R+  +  +    + V+ +      ++ +
Sbjct: 70  LSQPISRLS---VPQEGWENSPLRIRLMNAGWRNPNAGALYFAAKTVLALALPGAALLAL 126

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                  +      +   +    +G+  P+V +S  +  RQ  I   +PDALDLL +CVE
Sbjct: 127 ATTRLADQRMLLSFILVAL--AGIGYYVPNVILSRRIATRQRVIFEDFPDALDLLTVCVE 184

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+ +D AL RV+E++  +S  +S E+ L + E+     ++ A  NF  RT  + + +  
Sbjct: 185 AGLGLDAALMRVSEELRFRSEVVSGELDLLLLEMRSGFTKETALRNFALRTGTEDIESFC 244

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I    P L+ V++
Sbjct: 245 AMLIQADRFGTSIAESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFNIFPALMCVLL 304

Query: 316 GPAILSIIDTM 326
           GPA++ +   +
Sbjct: 305 GPAMIHVYRVL 315


>gi|162147495|ref|YP_001601956.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786072|emb|CAP55654.1| putative type II secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 313

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 142/312 (45%), Gaps = 8/312 (2%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK----QQITSLQKDSASSRLRTR 75
           T + I +L+  +         L  RM+        LR+        +    +   R+  R
Sbjct: 5   TMIMIAALLMTIGGIFSACYLLFSRMEQEGRRTLRLRQLHELSVGEANAVRTIDGRIWFR 64

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
             + +  F  +  L +      +   L +  F     L + +  + V  ++ +++G +  
Sbjct: 65  FLERIGVFFARSGLLSAKTLGELQQTLSSVSFLGTRFLPVFIGAKAVTLVVGIVVGWL-- 122

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
               +       L +   +    VG  AP   +  +      ++ +  PDALD+L+IC E
Sbjct: 123 --IHEETRSDGMLYLVLSLGAPVVGLLAPDFVVKRMQAHYLRNVDQGIPDALDMLVICAE 180

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+ I+ A+ RV  ++   +  ++ E  LT  E+    +R+  F +F  RT +  +R   
Sbjct: 181 AGLPIEAAIGRVGREMTAVNRSVANEFRLTAQEMGVASDRRDVFLHFGERTNLSSMRRIG 240

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            AL Q+ + G+S+  +LRVL  E R + L E E +AA L   LT+PMI+F LPV+ LV+ 
Sbjct: 241 SALNQTLQAGSSVTQALRVLSVEMRKDALTEYEARAARLPVLLTLPMILFILPVVFLVVG 300

Query: 316 GPAILSIIDTMK 327
           GPA ++++  + 
Sbjct: 301 GPAAVTVMHALG 312


>gi|320156058|ref|YP_004188437.1| flp pilus assembly protein TadC [Vibrio vulnificus MO6-24/O]
 gi|319931370|gb|ADV86234.1| flp pilus assembly protein TadC [Vibrio vulnificus MO6-24/O]
          Length = 293

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 67/314 (21%), Positives = 139/314 (44%), Gaps = 21/314 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +A    +    ++  V      +    KR ++                     S  ++
Sbjct: 1   MVIAQIVMLLSALMLLVVTSLLWHNTSQRKRREA-------------------RLSHYVK 41

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            +   S  N     N         +   L  AGF    +L+ LL+ +    I  L+  ++
Sbjct: 42  RQAVASSSNHSLMHNWITQNEKARLSRLLANAGFHKPQALSWLLLAKFGSGI--LVALLL 99

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +              +  V++   +G   P  W++    + +  +K++ PDA+DLL++C
Sbjct: 100 LMRQSINGEAIVSMWSLTLVLVGYVLGANGPEWWLNLNADRYRKKLKQSAPDAIDLLVLC 159

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG+S+++A  RVA  +  Q  P++E+  +T AEL  L +R  A  N   RT +  +  
Sbjct: 160 VESGLSLNRAFERVARYLQEQHAPMAEQFRVTSAELDLLNDRTQALNNLSWRTGIPELHT 219

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L  +D+YG+ + D+LR +  + R +R ++ E++A  L  K+T+  +   +  ++++
Sbjct: 220 LATTLTMADKYGSPLADTLRQISEDARRQRALDIEERAGKLPGKITLIQMTMIMLPMLVM 279

Query: 314 IIGPAILSIIDTMK 327
           +I P +  ++ ++ 
Sbjct: 280 VISPILSQLLASLA 293


>gi|87308908|ref|ZP_01091046.1| bacterial type II secretion system protein [Blastopirellula marina
           DSM 3645]
 gi|87288251|gb|EAQ80147.1| bacterial type II secretion system protein [Blastopirellula marina
           DSM 3645]
          Length = 321

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/307 (19%), Positives = 122/307 (39%), Gaps = 14/307 (4%)

Query: 21  AVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSL 80
           A+ I    + V +    +G L             L         +        +     L
Sbjct: 5   ALLIVGAFFGVTMLIYLAGRL-------------LLSSDRNKPSEMLHPGAKGSIGLGGL 51

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
                 +  K+    E +   +  AG+    + +  L VR    + ++      +     
Sbjct: 52  TRAFAGILPKSKQSYETLQKDMVKAGYYHRDAADEFLAVRNAALVAWVFFVGATLIALAD 111

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
             E   QL +   + +  + F  P V IS+    R S I+ A PDALD++ +   +G+ +
Sbjct: 112 ANETTTQLILIVSVAVLILIFAIPRVIISSQAAARVSRIQHALPDALDMITMTTTAGLPL 171

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
            ++++RV++++      L+ E+++   +     +   A +NF  R ++  V      + Q
Sbjct: 172 QKSIKRVSDEMVRSHEDLACELMILDRQAETG-SLGQAIQNFAKRLEVPEVNALASLVTQ 230

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
           + R G S+  + R      R  R   AE++      KL +P+I    P + ++++GP++L
Sbjct: 231 AQRIGGSVAGAFRDFADSIRRSRRQLAEERGNQNSIKLLIPVIFLLAPPVYILLLGPSVL 290

Query: 321 SIIDTMK 327
            + D M 
Sbjct: 291 RLQDFMG 297


>gi|110632960|ref|YP_673168.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283944|gb|ABG62003.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 338

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/315 (15%), Positives = 113/315 (35%), Gaps = 23/315 (7%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           L V     +S+  +  A+  P        +R          L +++ ++   D    R +
Sbjct: 14  LMVFAFATLSVGGVAAALFYPQFAKASPFRRRFQ---GLAALGEEEESTAPADEDRDRRK 70

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           + +        K+           +  +LR AG    ++         V   +   + ++
Sbjct: 71  SVEKTLRELEEKQKAKTRKAGKPTLSGRLRQAGL--SWNRRAYFTACAVCGALTFPVALL 128

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
              G            + +V      G   P  ++++  ++R       + +A+D+++  
Sbjct: 129 LGAG-----------SLVSVGFALAGGLLLPHFYVASRRKRRFKQFTNEFSNAVDVIVRG 177

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ++SG+ +   LR +A        P+  E +  + + +   +   A +  + R  +     
Sbjct: 178 LKSGLPVGDCLRIIA---AEAQEPVKSEFVAIVQDQTLGISLDEAVQRLWERVPLAEANF 234

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI-- 311
               +    R G S+ ++L  L    R  + M A+ +A S   K +   II  LP  +  
Sbjct: 235 FAIVVGLQSRTGGSLAEALGNLSKVLRERKKMSAKIRAMSSEAKSSAG-IIGALPFFVSA 293

Query: 312 -LVIIGPAILSIIDT 325
            + +  P  +S++ +
Sbjct: 294 AIYLTSPDYMSLLFS 308


>gi|172060499|ref|YP_001808151.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171993016|gb|ACB63935.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 330

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/314 (19%), Positives = 123/314 (39%), Gaps = 8/314 (2%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              V++     A       +  L++RM ++   R     +   S + D+   +   R   
Sbjct: 21  FGMVALLRASAASRAERALADALDRRMAALEAARVPKTAEDGASAKPDTRGRQRIERMLD 80

Query: 79  SLRNFVKKL---NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            L     +         +V E     L   G+    +  + L  R+   I   +L  I+ 
Sbjct: 81  RLSAAGMRWLDTGFGKHIVAEEDRRILEQCGYVDTRTRGLFLSARIACGIALPLLFAIFA 140

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
            G+ K   +     +        +GF  P + +      R+ S+    P  +D+L +   
Sbjct: 141 SGHLKGRHW-----MIGTFAAFALGFMLPKLVLRRRAAARRQSVVDELPLFVDMLRLLQG 195

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
            G+S+DQ+L+ V  D  G    LS E+ +   + +    R  + +   +    + +R   
Sbjct: 196 VGLSLDQSLQVVTNDFRGMMPVLSSEVGIAQRQFAAGRTRDQSMQRLSSGFDNEDLRAIA 255

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           + ++Q D++G ++ + L+      R  R     ++   L  K+T  M++  LP L++V  
Sbjct: 256 RLVVQVDKHGGAVQEPLKQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTA 315

Query: 316 GPAILSIIDTMKDH 329
           GP  L+++  +  H
Sbjct: 316 GPGFLAVMHALSAH 329


>gi|59713408|ref|YP_206183.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
 gi|59481656|gb|AAW87295.1| bipartite nuclear localization signal containing protein [Vibrio
           fischeri ES114]
          Length = 303

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 59/318 (18%), Positives = 130/318 (40%), Gaps = 30/318 (9%)

Query: 8   LFDATELAV--AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQK 65
           + ++  +     ++  + I   ++ +V   L    L K +                    
Sbjct: 10  IMNSQTILFIELVSVFIGISLFLWLLVQILLQRKLLGKYLAK------------------ 51

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
                +   +D        + L   A    ++I  K  +AG       ++ + V+ +   
Sbjct: 52  ----HKEFNKDDNVFDKVERFLPSVASNDADSIERKFYSAGLYESKYAHLYMPVKYLTAA 107

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
           I   +  + +     +      + +  V+ I       P   +S+  +  +  +    P 
Sbjct: 108 IGSGIIYLLLGKDSSMTTQVALMCIWLVVCIS-----IPDAILSSRKKALEEKLSGQLPY 162

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
            LDLL +CV +G++I+ +L  +A+++ G    L+  +  T    +     + A +  Y R
Sbjct: 163 LLDLLAMCVHTGMTIESSLSYLAKEMQGFDKDLAHMIARTNDRANI-VGLEPALDELYVR 221

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
              + +R+    L QS  YG+SI + L  L ++ RS RL+  E+K   L  K++VP+I+F
Sbjct: 222 VPTNEMRSFVMTLKQSLHYGSSIYEILNTLAADIRSVRLLSLEEKVGKLAAKMSVPLILF 281

Query: 306 FLPVLILVIIGPAILSII 323
            +  ++++I  P ++ ++
Sbjct: 282 IMIPVVILIAAPGVMRMM 299


>gi|323493498|ref|ZP_08098620.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
 gi|323312321|gb|EGA65463.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
          Length = 284

 Score =  123 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 55/261 (21%), Positives = 117/261 (44%), Gaps = 6/261 (2%)

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           +  +     ++       +  +     +     KL   G+ S  + +I + +RLV  +  
Sbjct: 29  SVRKRLDSVARFGAVQASRGGILRWPSNPQRARKLTMLGYHSPQAESIFMTLRLVSMVCG 88

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            +    +             + V  +  I           +   V+     I +  PDAL
Sbjct: 89  GVAWFFYQQLSLDATGIAEIIAVAVITGIAI------DRAVDWRVKAVIHDIAKNIPDAL 142

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+++CV SG S++     V E++   S  LS E L T  E++ L + Q A  N   R +
Sbjct: 143 DLMVVCVSSGQSLETTFNTVGEEMKTISQSLSREWLQTANEIAVLDSPQKALFNLDERLK 202

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V N    + Q+ ++GT + ++L+++ S+ R  +++E E+    +  K++ P+++F +
Sbjct: 203 LPEVNNMIVTMAQALKFGTPMAEALKLIASDNRQYQMLELEEWVGKIPAKMSFPLVVFIM 262

Query: 308 PVLILVIIGPAILSIIDTMKD 328
             ++++I+ P +LS+  T+  
Sbjct: 263 MPVVVIIVAPMVLSLFQTIGQ 283


>gi|197106493|ref|YP_002131870.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
 gi|196479913|gb|ACG79441.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
          Length = 300

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 69/301 (22%), Positives = 138/301 (45%), Gaps = 1/301 (0%)

Query: 27  LIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKK 86
           ++   V      G  E R++++   R             D  +  L  +   ++R   ++
Sbjct: 1   MVGGAVAGLAFLGVSELRLRALRRHRFASAVAAAGGPVADKGAGLLPEQVVSTVRRLGQQ 60

Query: 87  LNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPF 146
             ++       + ++L  AGF S  +  I L ++  + I    +G++         +   
Sbjct: 61  SAVRDPAKVSLLRSRLMQAGFFSREAPVIFLGIKAAL-IAAATVGVLMTLPVMIGAKGGN 119

Query: 147 QLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRR 206
            + +   + +       P   + +    R+      +PD LDLL+  VE+G+S+D A+ R
Sbjct: 120 MMGLAMAVGLSLAALYGPDQVLKSRKATREREYADGFPDLLDLLVASVEAGLSLDAAVTR 179

Query: 207 VAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGT 266
           V +++  +   L+  +   + EL     R+ A+  F +R  ++  R     L Q++  GT
Sbjct: 180 VTDELERRYPNLTVHLRFLVLELRAGRARKDAWSAFADRLAIEDARALATMLRQAEEMGT 239

Query: 267 SIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           S+GD+L+V   + R +R++ AE+KA +L  KLTVP+I+F  P L+  ++ PA + +I  +
Sbjct: 240 SLGDTLQVFSQDMRQKRMLRAEEKALALSAKLTVPLILFIFPSLLTALMLPAAVRMIKVL 299

Query: 327 K 327
            
Sbjct: 300 G 300


>gi|167620118|ref|ZP_02388749.1| Bacterial type II secretion system protein F domain [Burkholderia
           thailandensis Bt4]
          Length = 254

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 133/255 (52%), Gaps = 1/255 (0%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV     +  ++
Sbjct: 1   RRVAQRVASLGERVPVVDATQRMKLAARLASAGFRERRAVSVMAGLKLVVGACAGLAALV 60

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                 ++ +Y F LRV  +     +G   P   +   V +RQ +I    PDALDLL+IC
Sbjct: 61  VGAHVPRVGDY-FVLRVLMMAGAFVIGMMLPEHALGFAVARRQKTIAAYLPDALDLLVIC 119

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
             +G S+  A+RRVA ++G    PL++E  +   EL    +   A      R  +  +R 
Sbjct: 120 TNAGNSLAVAIRRVASELGTICPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRA 179

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+
Sbjct: 180 LVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALI 239

Query: 314 IIGPAILSIIDTMKD 328
             GPA++ +I     
Sbjct: 240 AAGPAVIRLIAVFHK 254


>gi|239833233|ref|ZP_04681562.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825500|gb|EEQ97068.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
          Length = 336

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 109/316 (34%), Gaps = 21/316 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   +   ++  +L YA+    LG  +   R           R    +   +++   + R
Sbjct: 8   VMFVVLAVIACAALFYALFYEKLGKKDHAARRFETVRNSGSERAITRSERDRNADIQKRR 67

Query: 74  TRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
            +   ++++   +   +        +   L  AG     +L    +           + +
Sbjct: 68  KQLQDNIKDLEARQKQREKNQKYPPLRILLTQAGL--TLTLQKFYLYSGAAAFFATFVAL 125

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           ++      L             +     F  P  ++ +  ++R       +P+ALD+++ 
Sbjct: 126 LFGAPLLFLPG-----------IAIAGFFGLPRWFVLHRRKQRLKKFLEEFPNALDVIVR 174

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
              +G+ ++  LR +A        P+  E    +       +   A     +        
Sbjct: 175 ATRAGLPLNDGLRLIAS---EAVEPVKSEFKKVVEAQQIGLSIPEAVGKMPDSMPCPETN 231

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
                +    + G ++ ++L  L    R  + M+A+  A S+  K +   II  LP +++
Sbjct: 232 FFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVNALSMEAKASAA-IIGALPFIVM 290

Query: 313 VII---GPAILSIIDT 325
           V++    P  ++++ T
Sbjct: 291 VLVYLTSPLYMTLLFT 306


>gi|118589707|ref|ZP_01547112.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
 gi|118437793|gb|EAV44429.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
          Length = 340

 Score =  122 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 55/318 (17%), Positives = 121/318 (38%), Gaps = 26/318 (8%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           T LAVA+   +++  +IY++  P+L      ++R+ +VA      R Q     +      
Sbjct: 13  TGLAVALLVMLAVGGIIYSLFQPALSGSKRRDQRVNAVAA-----RPQSENQRKALRDVD 67

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           R +      L+ F ++   K     +  +  K+  AG    +  +          +IF I
Sbjct: 68  RRKRSIQDQLKEFEERQKAKQDKQQKVPLKVKIEQAGL--TWETHHF--------VIFSI 117

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +  +       ++              G +GF  P  ++++  ++R ++     P+ +D+
Sbjct: 118 VAGVVFLILGLIIGGGNLYIAAGFGFAGSLGF--PRWYVASKRKRRFNAFLEELPNGVDI 175

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  V++G+ +   ++ VA +      P++ E            +   A      R  + 
Sbjct: 176 IVRGVKAGLPLSDCIKVVAREARD---PVATEFRKITETQIMGISLADAVGKLPERVPLP 232

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
                   +    + G  + ++L  L    R  + M+ + KA S   K +   II  LP 
Sbjct: 233 EANFFAIVVAIQQKAGGGLAEALNNLSKVLRGRKAMKRKIKALSAEAKSSAG-IIGSLPF 291

Query: 310 L---ILVIIGPAILSIID 324
               I+ +I P  + ++ 
Sbjct: 292 FVGGIMYLISPKYIMVLF 309


>gi|187926431|ref|YP_001892776.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|241665918|ref|YP_002984277.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|187728185|gb|ACD29349.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|240867945|gb|ACS65605.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 329

 Score =  122 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/333 (15%), Positives = 122/333 (36%), Gaps = 21/333 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS------ 62
            D T + +++T A +   +   + + +  +     R    A+           +      
Sbjct: 1   MDDTLITLSLTAAAAGVLVFGGLALRATLTRHRSARKLDTALSDMRATAANPAAPAASPV 60

Query: 63  -------LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
                      S  ++   +    +        L   +V E     L   G+  E++  +
Sbjct: 61  VPPAARPRPHGSREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDRKLLEECGYYGEHARTV 120

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
               R+++P +  + G +                     +   +G+ AP   +    + R
Sbjct: 121 FGGTRILLPPLLAVFGAL--------HASSALFVFVFGFVGFALGYLAPKWLLGRRKESR 172

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           +  +    P  +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +   +R
Sbjct: 173 RRRMDDELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRANQQFASGRSR 232

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           +            + ++     L Q DR+G ++ + LR      +  R    +++   L 
Sbjct: 233 EQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRRARLKERVGKLT 292

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            ++T+ M++  LP L+++  GP  + ++ +++ 
Sbjct: 293 VQMTMIMVMTLLPALLIITAGPGFMGVMRSLQQ 325


>gi|187927683|ref|YP_001898170.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|187724573|gb|ACD25738.1| type II secretion system protein [Ralstonia pickettii 12J]
          Length = 325

 Score =  122 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 58/321 (18%), Positives = 119/321 (37%), Gaps = 30/321 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKDS 67
            +    A AI    ++   I  V        G   KR+ +       +R           
Sbjct: 1   MNEIFYAFAILLFAAVVLCIEGVYQWWNNYHGPEAKRVDA------RIRALSAGGHIGTE 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R       F +   L ++     I   L  +G  S +S+  LL   ++     
Sbjct: 55  QLSILKKRLLSESPQFQRW--LMSLPRVSTIDRWLEQSG--SAWSVAQLLGYTILTGAGV 110

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L +G +              +  G V     +    P + I++  +KR   ++   PDA+
Sbjct: 111 LAVGALL------------PVPFGIVTACALLMSALPVLHIASQRRKRLKKLEAQLPDAV 158

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++   + +G S   AL  V ++I     P+  E   T  E+++  +   A  N   R  
Sbjct: 159 DMIARALRAGHSFASALGMVGQEIKE---PMGPEFHTTFEEINYGVSLDEALTNLAKRVP 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           ++ +R    A++     G ++ + L  + +  R    +  + +  S   +L+   I+  L
Sbjct: 216 VNDLRYFVIAVLIQRESGGNLAEILDTIGNLVRERLKLYDKIRVLSAEGRLSA-WILGLL 274

Query: 308 PV---LILVIIGPAILSIIDT 325
           P     +++++ P  + ++ T
Sbjct: 275 PFCTAGMILLVNPDFMKVLWT 295


>gi|15963898|ref|NP_384251.1| hypothetical protein SMc02821 [Sinorhizobium meliloti 1021]
 gi|307315795|ref|ZP_07595309.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|15073073|emb|CAC41532.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898563|gb|EFN29236.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 336

 Score =  122 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 52/290 (17%), Positives = 113/290 (38%), Gaps = 21/290 (7%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENI 98
            + E R++ V+   E  R +   +  + +  S+ R     SL+   KK   K+     ++
Sbjct: 35  KKAEGRLRRVSA-SETDRTKIKAARDRVNEMSKRRKSVQDSLKELEKKQQEKSANTAPSM 93

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
             +L  AG     SL    +   +  +   ++ ++   G            + A  +   
Sbjct: 94  KKRLLQAGL--SISLAQFYLFSALFGLFAFLVVLLAGAGL-----------LIAAGVALI 140

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
                P   + ++V++R       +P++LD+++  ++SG+ ++ ALR +A        P+
Sbjct: 141 GAAGLPRWIVGSMVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIAS---DGQEPV 197

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E    +       N   A     +   +  V      +    + G ++ ++L  L   
Sbjct: 198 RTEFRRVVESQQVGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKV 257

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
            R  R M+A+  A S+  K +   II  LP ++  ++    P  + ++ T
Sbjct: 258 LRERRKMKAKVSALSMEAKASA-CIIGALPFIVATLVYLTSPDYMMVLFT 306


>gi|209545602|ref|YP_002277831.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533279|gb|ACI53216.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 313

 Score =  122 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 142/312 (45%), Gaps = 8/312 (2%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK----QQITSLQKDSASSRLRTR 75
           T + I +L+  +         L  RM+        LR+        +    +   R+  R
Sbjct: 5   TMIMIAALLMTIGGIFSACYLLFSRMEQEGRRTLRLRQLHELSVGEANAVRTIDGRIWFR 64

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
             + +  F  +  L +      +   L +  F     L + +  + V  ++ +++G +  
Sbjct: 65  FLERIGVFFARSGLLSAKTLGELQQTLSSVSFLGTRFLPVFIGAKAVTLVVGIVVGWL-- 122

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
               +       L +   +    VG  AP   +  +      ++ +  PDALD+L+IC E
Sbjct: 123 --IHEETRSDGMLYLVLSLGAPMVGLLAPDFIVKRMQAHYLRNVDQGIPDALDMLVICAE 180

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G+ I+ A+ RV  ++   +  ++ E  LT  E+    +R+  F +F  RT +  +R   
Sbjct: 181 AGLPIEAAIGRVGREMTAVNRSVANEFRLTAQEMGVASDRRDVFLHFGERTNLSSMRRIG 240

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
            AL Q+ + G+S+  +LRVL  E R + L E E +AA L   LT+PMI+F LPV+ LV+ 
Sbjct: 241 SALNQTLQAGSSVTQALRVLSVEMRKDALTEYEARAARLPVLLTLPMILFILPVVFLVVG 300

Query: 316 GPAILSIIDTMK 327
           GPA ++++  + 
Sbjct: 301 GPAAVTVMHALG 312


>gi|149927029|ref|ZP_01915287.1| putative tight adherence tadc related transmembrane protein
           [Limnobacter sp. MED105]
 gi|149824250|gb|EDM83470.1| putative tight adherence tadc related transmembrane protein
           [Limnobacter sp. MED105]
          Length = 317

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 59/317 (18%), Positives = 129/317 (40%), Gaps = 5/317 (1%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
                 +AI   +     +         +   EK +  +    E+ RK Q ++  ++   
Sbjct: 1   MDMNTLLAIGIFLLGLGFVGLAWSLLSQTSRKEKALARIDEYTELRRKVQSSANMRNQVP 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           + + T   + L     K       V+E     L  AGF  E  L+  +++R+ + ++ L+
Sbjct: 61  TSVLTGRIERLGQQFSKTKAFTYFVEEEDKKLLGRAGFGREEDLSRFVLIRIALGLLGLL 120

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
                I  +         + +  VI +  +GF AP  ++  + + R+++ +R     +D+
Sbjct: 121 -----IGLFLNWDAGFGAIPMIQVIAVTGIGFMAPKWYLKTVGEGREAAFERELVAVVDV 175

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + +    G+S+DQ++  +   +          +  + A++       V  +   +    D
Sbjct: 176 MRLLQGVGLSVDQSIEVMTSQLYDLVPITGRMLRRSRAQVKSGVPWIVMLKRMSSMYSSD 235

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
             ++  Q L Q +++G ++ + L+        +    A++    L  KLT  M+I  LP 
Sbjct: 236 EFKSFVQVLEQIEKFGGAVQEPLKQFSDRLVEKERANAKETMGKLTVKLTGVMVITMLPA 295

Query: 310 LILVIIGPAILSIIDTM 326
           L+++  GP I+SII   
Sbjct: 296 LLIMTGGPGIISIIRAF 312


>gi|307943149|ref|ZP_07658494.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773945|gb|EFO33161.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 340

 Score =  122 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 124/320 (38%), Gaps = 24/320 (7%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D T LAV     +SI  +++A++ P++ S    KR        + +  +      ++  +
Sbjct: 11  DMTALAVMGLVMLSIGGVLFALLQPAMSSD---KRRSQRISTIKGVDGKTPGLAIRNRDA 67

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVD-ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            + R      L    ++   K  + D  ++  ++  AG    + +   + + +V  ++  
Sbjct: 68  DKRRKSVKDQLDQLEQRTQQKNAMRDKPSLRLRIEQAGL--SWDVKRFIQISIVTGVLAT 125

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++   +               + A++      F  P  +I+   +KR ++     P+ +D
Sbjct: 126 VIFYFFSGNV-----------LIALLGGFAGAFGLPRFYINRRRKKRFTAFMEELPNGVD 174

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  V++G+ +   +R V+ +      P+S E    +       +   AF     R  +
Sbjct: 175 IIVRGVKAGLPLGDCVRVVSTEAKD---PVSTEFAKILETQKMGVSLAEAFMKLPERVPL 231

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +      G  + ++L  L    R  + ++ +  A S   K +   II  +P
Sbjct: 232 PEANFFAIVVAIQQSSGGGLSEALNNLSRVLRGRKALKRKIVALSSEAKSSAG-IIGAMP 290

Query: 309 VLI---LVIIGPAILSIIDT 325
           VLI   L  I P  ++I+ T
Sbjct: 291 VLISLALFFIAPDYINILLT 310


>gi|315497461|ref|YP_004086265.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415473|gb|ADU12114.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/314 (16%), Positives = 125/314 (39%), Gaps = 23/314 (7%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +A  + V + S+ + +      S    KR +++ +      K++      +      R
Sbjct: 4   ILIAFLSFVILASVGFVLTSG-GASEVAAKRAQAIGMGATTAAKRKSQRTAANRTPEERR 62

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            +    L+   ++     +    ++  +L+ AG     ++    +  + + I   ++ ++
Sbjct: 63  KQILLQLKESEQRERKARL----SLTARLQHAGL--TPNVKTFWIWSVALGIAAAVIVLV 116

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                        ++ + A+      G+ AP  W+S L ++R +     + DA+D+L+  
Sbjct: 117 V-----------SRIPLAALGAGFAFGYGAPRWWLSFLAKRRTTKFTANFADAIDILVRG 165

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ++SG+ +   L+ +A+++     PL  E       +S      ++ E    R     +R 
Sbjct: 166 IKSGLPVHDGLKIIAKEL---PAPLGPEFQRLNENISIGMGLDMSLEKMCERMPTPELRF 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP--VLI 311
            T  +    + G ++ ++L  L    RS R+M  + KA S     +  +I    P   ++
Sbjct: 223 FTIVIAIQQKTGGNLAEALGNLSHVLRSRRMMREKIKALSSEAIASASIIGVLPPGVGIM 282

Query: 312 LVIIGPAILSIIDT 325
           + I  P  +  + T
Sbjct: 283 IYITNPGYMGPLLT 296


>gi|319795783|ref|YP_004157423.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598246|gb|ADU39312.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 316

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 64/320 (20%), Positives = 128/320 (40%), Gaps = 9/320 (2%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
              + +LAVA    +++   I A  + +       +R +S       +R+   T ++  S
Sbjct: 2   TLTSAQLAVASLVLLALGLTIAAGALIATE----LRRARSGHAIGRAIRRGVETQIEPAS 57

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            +     R    L        +   LV +     +   G  S+ +  I LV R+ + ++ 
Sbjct: 58  TAEPEVPRSDIELPFHWLDTRMGRALVADEDRQLIDQCGLPSQRAQLIFLVTRIALAVLL 117

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            +L             +  +  +  +++    GF  P   +      R+  + +  P  +
Sbjct: 118 PLLVYALW-----STGHSQRTVIAVLVVAFVFGFMVPKWVLGQFAAARRERVAQELPLFI 172

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL +    G+S+DQ+L+ +A D       L  E+     + S    R+ + +      +
Sbjct: 173 DLLRLLQGVGLSLDQSLQIMANDFSHVLRVLGYELAFANRQYSQGRTREHSLQRLATLHK 232

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +      L+Q DR+G +I + LR+     R  R  E + +   +  K+T  M+   L
Sbjct: 233 NENLGGLVSLLVQVDRHGGAIQEPLRIFSDRLREHRRSEMKDRIGKITVKMTGVMVTTLL 292

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P LI+V  GP  ++II ++ 
Sbjct: 293 PALIIVTAGPGFIAIIRSLG 312


>gi|325291655|ref|YP_004277519.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059508|gb|ADY63199.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 334

 Score =  122 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 60/326 (18%), Positives = 125/326 (38%), Gaps = 22/326 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T L +A   A+S  +L YA +   +   +            E        +  +   
Sbjct: 1   MDPTILLLAALVAISAGALAYAFLFQQIEVEKKTTSRVKRVKAAETDHANIKAARDRVQE 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             + R     SLR   KK + K     +  +  KL  AG   + S+    ++        
Sbjct: 61  LGKRRKSMQDSLREMEKKQSEKAKKAKNVGLREKLVQAGL--QLSVRQFHLLSAGAAAFS 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           +++ +++               + A+++   V    P   +  ++++RQ      +P+AL
Sbjct: 119 VVIALLYGLSL-----------LIALLIGAVVALGLPRWVLGFILKRRQKKFLEEFPNAL 167

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++   ++SG+ ++ A+R +A        P+  E    +             E       
Sbjct: 168 DVMCRSIKSGLPLNDAVRLIAS---DGQEPVKTEFQRVVDAQQVGIGIPQGIERMMLTVP 224

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V   +  +    + G ++ ++L  L    R  R M A+  A S+  K +  +II  L
Sbjct: 225 LFEVSFFSTVINIQAQAGGNLSEALSNLSKVLRERRKMRAKVNALSMEAKASA-VIIGAL 283

Query: 308 PVLILVII---GPAILSIIDT-MKDH 329
           P ++++++    P  LS++ T M+ H
Sbjct: 284 PFIVMLLVHFTSPDYLSVLFTDMRGH 309


>gi|302391032|ref|YP_003826852.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203109|gb|ADL11787.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 327

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/316 (15%), Positives = 122/316 (38%), Gaps = 23/316 (7%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            E+ +     + + + +              K         E  R  Q T+L ++     
Sbjct: 1   MEIIILPAVFLVVTTAVVVSYKLLTAREAKVKERLDKYSAIEEGRIGQNTALDREEDVGE 60

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
            ++   + L  F +   L +  +  ++  +L+      +  ++  +++ LV  +I  ++G
Sbjct: 61  RKSLKKRLLEKFNQF--LTSFSLVASLEAELQKTDLPLK--VSEFIIINLVSCVILGLIG 116

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           I+        +       +             P  ++    +KR         D+L ++ 
Sbjct: 117 ILVSNNLLVPVLLLSLGLI------------IPYFYLKYSQKKRLDKFNEQINDSLTIIS 164

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
             +++G S  QAL  VA+++     P+SEE+   + E++   + Q A     +R + D +
Sbjct: 165 NSLKAGYSFFQALEMVAKEM---PPPISEEITRVLKEMNLGASPQDALTALTDRVESDDL 221

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV-- 309
                A++   + G ++ + L  +    R    ++ E +  +   +++  +II  LPV  
Sbjct: 222 ELVVTAVLIQRQVGGNLSEILDNISDTIRERIKIKGEIQTLTAQGRMSG-LIIGLLPVGL 280

Query: 310 -LILVIIGPAILSIID 324
             +L +I P  ++ + 
Sbjct: 281 GGMLFLISPDYMAPLF 296


>gi|307320430|ref|ZP_07599847.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306893996|gb|EFN24765.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 336

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/290 (17%), Positives = 113/290 (38%), Gaps = 21/290 (7%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENI 98
            + E R++ V+   E  R +   +  + +  S+ R     SL+   KK   K+     ++
Sbjct: 35  KKAEGRLRRVSA-SETDRTKIKAARDRVNEMSKRRKSVQDSLKELEKKQQEKSANTAPSM 93

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
             +L  AG     SL    +   +  +   ++ ++   G            + A  +   
Sbjct: 94  KKRLLQAGL--SISLAQFYLFSALFGLFAFLVVLLAGAGL-----------LIAAGVALI 140

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
                P   + ++V++R       +P++LD+++  ++SG+ ++ ALR +A        P+
Sbjct: 141 GAAGLPRWIVGSMVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIAS---DGQEPV 197

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E    +       N   A     +   +  V      +    + G ++ ++L  L   
Sbjct: 198 RTEFRRVVESQQVGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKV 257

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
            R  R M+A+  A S+  K +   II  LP ++  ++    P  + ++ T
Sbjct: 258 LRERRKMKAKVGALSMEAKASA-CIIGALPFIVATLVYLTSPDYMMVLFT 306


>gi|53719426|ref|YP_108412.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76810064|ref|YP_333441.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|121598751|ref|YP_993001.1| type II secretion system protein F [Burkholderia mallei SAVP1]
 gi|124385777|ref|YP_001026333.1| type II secretion system protein F [Burkholderia mallei NCTC 10229]
 gi|126450336|ref|YP_001080393.1| type II secretion system protein F [Burkholderia mallei NCTC 10247]
 gi|134282407|ref|ZP_01769112.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 305]
 gi|217421557|ref|ZP_03453061.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 576]
 gi|226196355|ref|ZP_03791937.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237812170|ref|YP_002896621.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|254177530|ref|ZP_04884185.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|254188724|ref|ZP_04895235.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254259567|ref|ZP_04950621.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1710a]
 gi|254297711|ref|ZP_04965164.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 406e]
 gi|254358538|ref|ZP_04974811.1| type II secretion system protein [Burkholderia mallei 2002721280]
 gi|52209840|emb|CAH35812.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76579517|gb|ABA48992.1| putative fimbriae-related membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|121227561|gb|ABM50079.1| bacterial type II secretion system protein F domain [Burkholderia
           mallei SAVP1]
 gi|126243206|gb|ABO06299.1| bacterial type II secretion system F domain protein [Burkholderia
           mallei NCTC 10247]
 gi|134246445|gb|EBA46534.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 305]
 gi|148027665|gb|EDK85686.1| type II secretion system protein [Burkholderia mallei 2002721280]
 gi|157807239|gb|EDO84409.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 406e]
 gi|157936403|gb|EDO92073.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698569|gb|EDP88539.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|217395299|gb|EEC35317.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 576]
 gi|225931572|gb|EEH27577.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237503370|gb|ACQ95688.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|254218256|gb|EET07640.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1710a]
          Length = 314

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 134/263 (50%), Gaps = 1/263 (0%)

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV  
Sbjct: 53  DDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGA 112

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
              +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PD
Sbjct: 113 CAGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPD 171

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A      R
Sbjct: 172 ALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAAR 231

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F
Sbjct: 232 IGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLF 291

Query: 306 FLPVLILVIIGPAILSIIDTMKD 328
            +P + L+  GPA++ +I     
Sbjct: 292 VMPTVALIAAGPAVIRLIAVFHK 314


>gi|84386792|ref|ZP_00989817.1| putative type IV pilus protein [Vibrio splendidus 12B01]
 gi|84378320|gb|EAP95178.1| putative type IV pilus protein [Vibrio splendidus 12B01]
          Length = 283

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/263 (22%), Positives = 119/263 (45%), Gaps = 6/263 (2%)

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
           K    +   TR S     +    +       +    KL   G+ +  +    L +RL+  
Sbjct: 25  KRDVVAERLTRVSSYSSKYTTASSKWRFQGAKPRRQKLILIGWLNPNAEIYFLGLRLLTM 84

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           +   I   +       +      + +  V+             +   V + +  I R  P
Sbjct: 85  VTGSIAWYVTRIQVLNMNSVSECIAIAIVVG------ILFDRILDWRVNQVRMQISRVIP 138

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DA+DL+++CV SG++++   R V E++   S  LS E LLT  E+S L + Q A  N   
Sbjct: 139 DAVDLMVVCVASGLTLEAVFRCVGEEMRAISPALSREWLLTATEISVLDSPQTALSNLDK 198

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R Q+  + N    + Q+ +YGT + ++L+++ S++R    +E E+    +  K++ P+++
Sbjct: 199 RVQLPDINNIVTTMNQALQYGTPLAEALKLIASDSRQYHFLELEEWVGKIPAKMSFPLVV 258

Query: 305 FFLPVLILVIIGPAILSIIDTMK 327
           F +  ++ +I+ P +LS+  T+ 
Sbjct: 259 FIMLPVVGIIVVPIMLSLKQTLG 281


>gi|161524901|ref|YP_001579913.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189350349|ref|YP_001945977.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342330|gb|ABX15416.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189334371|dbj|BAG43441.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 330

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/292 (18%), Positives = 116/292 (39%), Gaps = 8/292 (2%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL---NLKAILVD 95
             L++RM ++   +         + + +    +   R  + L     +     L   +V 
Sbjct: 41  DALDRRMATLEAAKARSAPDGDAAAKSEVPGRQSVKRLLERLSATGMRWLDTGLGKHIVA 100

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           +     L   G+    S  + L  R+   I+   L  ++  G  K   +     V  + +
Sbjct: 101 DEDRRLLEQCGYVDARSRGLFLSARMACGIVLPFLFAVFASGRMKGGYW-----VIGMCV 155

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
              +G   P +++      R+  +    P  +D+L +    G+S+DQ+L+ V  D  G  
Sbjct: 156 AFALGLMLPKLYVQRRAAARRQCVDDELPLFVDMLRLLQGVGLSLDQSLQVVTNDFRGMM 215

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             LS E+ +   +      R+ + +        + +R   + ++Q D++G ++ + L+  
Sbjct: 216 PVLSSEVGVAQRQFVAGRTREQSMQRLSGGFDNEDLRAIVRLMVQVDKHGGAVQEPLKQF 275

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
               R  R     ++   L  K+T  M++  LP L++V  GP  L+++  + 
Sbjct: 276 GDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGFLAVMHALS 327


>gi|85707699|ref|ZP_01038765.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
 gi|85689233|gb|EAQ29236.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
          Length = 323

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 116/316 (36%), Gaps = 30/316 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +  +  +      S     Y ++         ++R++++          ++ S  K + 
Sbjct: 1   MEIIQTLLITVVIFSALVAGYILLTGPAAGKAQKRRLEALRYRHSESTDAKVESQFKKAI 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           ++R       +           +    E +  +L   G    ++++  L V L + ++  
Sbjct: 61  AARKPKAHKVA----------GSGSRTEALEVRLDRTG--KGWTVSQYLYVTLGIILVVG 108

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L  I                  ++    +VG   P + +S  ++KR +     + D ++
Sbjct: 109 VLLYI-----------QTGAPFLSLAAGAFVGLGLPHLVVSFFIKKRTNDFNAKFADGIE 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL+  + SG+ + + L  VA+++ G   P+  E    +  +      + + +   +R  +
Sbjct: 158 LLVRGLRSGLPVTETLAVVAQEVPG---PVGLEFKGIVERIKIGKTMEDSLQETADRLGI 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                 T  L      G ++ ++L  L    R    M+ + KA S   K +   I+  LP
Sbjct: 215 PEFNFFTITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIKAMSSESKASA-YIVGSLP 273

Query: 309 VLILVII---GPAILS 321
            ++  +I    P+ + 
Sbjct: 274 FIVFGLIYSVNPSYIG 289


>gi|167911026|ref|ZP_02498117.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 112]
          Length = 264

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 134/263 (50%), Gaps = 1/263 (0%)

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV  
Sbjct: 3   DDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGA 62

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
              +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PD
Sbjct: 63  CAGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPD 121

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A      R
Sbjct: 122 ALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAAR 181

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F
Sbjct: 182 IGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLF 241

Query: 306 FLPVLILVIIGPAILSIIDTMKD 328
            +P + L+  GPA++ +I     
Sbjct: 242 VMPTVALIAAGPAVIRLIAVFHK 264


>gi|121607251|ref|YP_995058.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121551891|gb|ABM56040.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 313

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/281 (20%), Positives = 113/281 (40%), Gaps = 14/281 (4%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           R +  +       + RL     + +   +    L        +  KLR AG         
Sbjct: 34  RPEDRSYKDPPPLAMRLLWWPIQWIGQHLGP-RLGTGKSVRTLQLKLRQAGLDYTLDPAQ 92

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG-----------AVILIGYVGFCAP 164
            +  R+V   +   L    +  +D L      +              A+ +   +G+  P
Sbjct: 93  FIASRIVSAFVATALLWWAVSSFDGLPIGAGGVDAARRYIATGTYLQAMAIGALLGWFYP 152

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           ++W+ + +  R+  + R  P  LD++ +CVE+G+++  A+ +      G    + EE   
Sbjct: 153 AIWLKDRIALRRRELLRMMPFFLDIITLCVEAGLNMHGAIAQAVA--KGPQGTVREEFQR 210

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
            + ++     R  +  +   R     V     A+IQ++R G ++G  LR    + RSER 
Sbjct: 211 VLRDVRAGKARTESLRDMAERLNEPGVTQFVMAVIQAERMGMNLGPVLRAQADQQRSERF 270

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           + AEK A     K+ +P+I F  P   +V++ P  +  I+T
Sbjct: 271 LRAEKLAMEAPVKMLLPLIAFIFPCTFIVLLFPIAMKFINT 311


>gi|126454623|ref|YP_001066155.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242317969|ref|ZP_04816985.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106b]
 gi|126228265|gb|ABN91805.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106a]
 gi|242141208|gb|EES27610.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 1106b]
          Length = 314

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 134/263 (50%), Gaps = 1/263 (0%)

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV  
Sbjct: 53  DDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGA 112

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
              +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PD
Sbjct: 113 CAGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPD 171

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A      R
Sbjct: 172 ALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAAR 231

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F
Sbjct: 232 IGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLF 291

Query: 306 FLPVLILVIIGPAILSIIDTMKD 328
            +P + L+  GPA++ +I     
Sbjct: 292 VMPTVALIAAGPAVIRLIAVFHK 314


>gi|319943385|ref|ZP_08017667.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
 gi|319743200|gb|EFV95605.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
          Length = 298

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 121/308 (39%), Gaps = 20/308 (6%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           ++   V++ +L+  + +  L                E+ ++Q+            L    
Sbjct: 7   SVLPFVAVGALVLCIWLFMLAGSRAAA---------EVPKQQKNEYQDDPPRYWALLGWL 57

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
             +   +V  L    +     +  +LR  G     +    +  +++         ++ + 
Sbjct: 58  GHATTFWVTPLVSPTMRR--RLHEQLRRGGLEFALTPEQFVAGQVLGA-------LLALA 108

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                        +   +L   VG   P  W+ +L  +R   I +A P  LD++ + +E+
Sbjct: 109 LLVLAWLPHGLPSLPWCVLALVVGAFLPVSWLRDLGARRTRQIAKALPFYLDIITLAIEA 168

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G ++  AL+   +       P+SEE+   + ++     R  +      R ++  + N   
Sbjct: 169 GSNMTGALQHAVDKGPT--GPMSEELRRVLRDIRAGRTRAESLRALAERLRIPAISNWVA 226

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           A++ +++ G+S+G  LR    + R+ER M+AE  A     K+  P++I   P   +++  
Sbjct: 227 AILTAEKQGSSLGPILRAQADQRRNERFMQAEAMALKAPVKMLFPLMICIFPCTFIIVFF 286

Query: 317 PAILSIID 324
           P  + I++
Sbjct: 287 PIAIRIME 294


>gi|328545275|ref|YP_004305384.1| Bacterial type II secretion system protein F domain [polymorphum
           gilvum SL003B-26A1]
 gi|326415017|gb|ADZ72080.1| Bacterial type II secretion system protein F domain [Polymorphum
           gilvum SL003B-26A1]
          Length = 339

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 61/318 (19%), Positives = 130/318 (40%), Gaps = 25/318 (7%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASS 70
           T +AVA+  A SI  +IYA+  P L      E+R+  +A      R Q  +  +    + 
Sbjct: 13  TTIAVALLAAFSIGGVIYALFEPVLSGSKRREQRLGQIAA-----RPQAASDRRPVRDAE 67

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDE-NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           + R      L+ F +K   +    +   + N+L  AG   ++     ++  +V  ++FLI
Sbjct: 68  KRRKSVQDQLKEFEEKQKARQKRANSLTLTNRLEQAGL--DWERKHFIIFSIVSGLVFLI 125

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           LG +             +  +  + +    G   P  +++   +KR  +     P+A+D+
Sbjct: 126 LGFLL-----------TRSPILTLAIAFVGGLGFPRWYLARRRRKRFDAFLNELPNAVDI 174

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  V++G+ +   ++ VA +      P++ E    +           A     +R  + 
Sbjct: 175 IVRGVKAGLPLGDCIKIVASEARD---PVAGEFRKIVEAQVMGLTLTEAVGRLPDRVPLA 231

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFL 307
                   +    + G  + ++L  L    R  + ++ + +A S   K +  +I  + F+
Sbjct: 232 EANFFAIVVAIQQQAGGGLSEALGNLGKVLRGRKTLKGKIRALSSEAKSSAAIIGSLPFI 291

Query: 308 PVLILVIIGPAILSIIDT 325
             LIL +I P  + ++ T
Sbjct: 292 VSLILYLIAPDYIMLLFT 309


>gi|261820219|ref|YP_003258325.1| type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
 gi|261604232|gb|ACX86718.1| Type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
          Length = 319

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 75/291 (25%), Positives = 145/291 (49%), Gaps = 5/291 (1%)

Query: 39  GELEKRMK-SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDEN 97
            +LE RM+  +         Q+     + +A S L  +  + L    ++L+  +     N
Sbjct: 33  KQLEIRMRGHLPTASIEAASQENILRGQGTALSPLLEKLLQPLAIQGERLS-GSDRDRRN 91

Query: 98  IVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIG 157
           +   L  AG R   ++  L++ +     +  I     ++G+    +      V A ++  
Sbjct: 92  LRRLLDLAGLRRNEAVGWLVMGKFAAGALLAIAL---VWGWLPPADRAGLTGVAAGLIGF 148

Query: 158 YVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVP 217
           +VG   P  W+      R   + RA PDALDL+++C E+G+ I + L+ V++++G  S  
Sbjct: 149 FVGSMVPEWWLKWRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPE 208

Query: 218 LSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVS 277
           +++E+  T AEL  L +R +A  +   RT++  + +    LIQ++RYGT +  +LR +  
Sbjct: 209 MADELHYTAAELQILSDRTLAMRHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIAD 268

Query: 278 ETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           E+R   ++  E+KA  L  +L+VP++   LP +I ++  PA++ +I  +  
Sbjct: 269 ESRKTLILGLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVIRLLAQ 319


>gi|254473793|ref|ZP_05087188.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957179|gb|EEA92384.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 339

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 118/313 (37%), Gaps = 23/313 (7%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
             +     +S+  + + ++ P     +L KR +S+    +        S +K   ++R +
Sbjct: 15  YLITALIMISVVGVTFTLLAPLFSKDKLGKRKESLV---QKDISGLKGSNKKLDITARRK 71

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +   +       +   K         + +  AG    ++        ++  ++  ++ ++
Sbjct: 72  SVQDQLNAMEAAQAAKKKNADKPIFADWIGQAGL--NWTKPRYYAYSVICGVLLFLVSML 129

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                        Q    ++ L+    F  P  ++S   +KR +     +P+A+D+++  
Sbjct: 130 -----------SGQSIWISLALLFVGIFGLPRFYVSRARKKRFNRFLEEFPNAVDIIVRG 178

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ++SG+ +   +   A +      P+  E  L + ++        A ++   R  +     
Sbjct: 179 IKSGMPLGDCMHIAASEAKD---PVGTEFSLVLDKMQMGMPLAEAIQSLPKRVPLQETNF 235

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI-- 311
               +    + G S+ ++L  L    R  + M+ + +A S   K +   II  LP ++  
Sbjct: 236 LAIVVTIQAQAGGSLSEALGNLSKTLRQRKEMKGKIRAVSQEAKSSAA-IIGSLPFIVTA 294

Query: 312 -LVIIGPAILSII 323
            L ++ P  + ++
Sbjct: 295 LLFVLSPDYIKLL 307


>gi|323137429|ref|ZP_08072507.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
 gi|322397416|gb|EFX99939.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
          Length = 326

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/304 (16%), Positives = 113/304 (37%), Gaps = 28/304 (9%)

Query: 26  SLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFV 84
            ++YA V P L    + +KR  ++   R              +   ++     K + N  
Sbjct: 17  GVMYAFVYPYLSGEIKAQKRTAALTSGRSERGAVAGRGTVDPAKRRKMIAESLKEVENQN 76

Query: 85  KKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEY 144
           KK  L        +  ++  AG    ++  + L+  +   ++     ++           
Sbjct: 77  KKKKL-------TLEQRIMQAGL--TWTPQVFLIGSVAFGLLVAFFLLVVNGDI------ 121

Query: 145 PFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQAL 204
                +  +       F  P+  +S L ++R S     +P ++D+++  V++G+ +    
Sbjct: 122 -----MVVIGGAAVGIFGLPNWLLSFLRKRRISKFIEEFPGSIDVIIRGVKAGLPVADCF 176

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRY 264
           R +A +      P+  E    I   +   +   A E F  R  +      +  +    + 
Sbjct: 177 RVIASEGQE---PVRGEFRRIIESQAIGLSVGEAVERFAERVPVPEASFFSIVINIQQKS 233

Query: 265 GTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI---LVIIGPAILS 321
           G ++ ++L  L    R  + M+ + KA S   K +   II  LP L+   + +  P+ + 
Sbjct: 234 GGNLSEALGNLSRVLRDRKKMKGKVKAMSSEAKASAG-IIGSLPFLVGGAVYLTTPSYMM 292

Query: 322 IIDT 325
           ++ T
Sbjct: 293 VLFT 296


>gi|254252516|ref|ZP_04945834.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
 gi|124895125|gb|EAY69005.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
          Length = 333

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/297 (19%), Positives = 119/297 (40%), Gaps = 11/297 (3%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVK------KLNLKAI 92
             L++RM ++   +           Q D+  +R   R ++ L                  
Sbjct: 41  DALDRRMAALDAAKARQAPNDAAPAQFDAQRTRGGQRVARFLERLSAAGMRWLDTGFGQY 100

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           +V +     L   G+    +  + L  R+V  I   +L  I   G  K   +     +  
Sbjct: 101 VVAQEDRRLLEQCGYIDARTRGLFLSARIVCGIALPLLFAIVASGRMKGSLW-----LIG 155

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           +     +GF  P  ++      R+ S+    P  +D+L +    G+S+DQ+L+ V  D  
Sbjct: 156 LFAAFGLGFMLPKFYVKRRAAARRQSVVDELPLLVDMLRLLQGVGLSLDQSLQVVTNDFR 215

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
           G    LS E+ +   + +    R+ + +        + +R   + +IQ D++G ++ + L
Sbjct: 216 GMLPVLSSEVGIAQRQFAAGRTREQSLQRLSGGFDNEDLRAVVRLMIQVDKHGGAVQEPL 275

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           +      R  R     ++   L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 276 KQFGDRLRETRRAMLRERIGRLTVKMTGVMVLTLLPALLIVTAGPGMLAVMHALSAH 332


>gi|187919328|ref|YP_001888359.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717766|gb|ACD18989.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 325

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 56/317 (17%), Positives = 117/317 (36%), Gaps = 28/317 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            + + +  A+   +++   I AV +            K V    E +R            
Sbjct: 1   MNTSFIGFAVLAFLAVVLAIEAVYLFWSSHHG-----KDVKRMDERIRALSAGGNVSSQQ 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R      +      L  I     +  +L+ +G   ++S+   +   L+  ++  
Sbjct: 56  LSILKQRMLS--ESPFVTQLLLRIPRVHALDRQLQQSGL--KWSVARFVTYTLLCAVLGA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           + G + +     +             +   V    P++ +     KR   ++R  PDA D
Sbjct: 112 LGGFVLLLPAPVMG------------VFAVVASLLPTLILCRKRTKRVLQLERQLPDAAD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+   + +G S   AL  V E++     PL  E  L   E+++  +   A  N  NR  +
Sbjct: 160 LIARALRAGHSFPAALGMVGEELPN---PLGGEFALVFDEINYGVSMSDALLNMVNRVPV 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +R    A++     G ++ + L  +    R    +  + +  S   +L+   ++  LP
Sbjct: 217 EDLRYFVIAVLIQREAGGNLAEILGSIAGIIRERLKLLGKVRVLSAEGRLSA-WVLGVLP 275

Query: 309 VLILVI---IGPAILSI 322
             IL +   + P  +S+
Sbjct: 276 FAILGLLSVLNPGYISV 292


>gi|198284409|ref|YP_002220730.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665047|ref|YP_002427077.1| tight adherence protein TadC [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248930|gb|ACH84523.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517260|gb|ACK77846.1| tight adherence protein TadC [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 312

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/312 (18%), Positives = 123/312 (39%), Gaps = 7/312 (2%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
           A+ TA+++ S+  AV++          R+  +A  R  + +           S      +
Sbjct: 6   ALLTALAVASIALAVLLGVFFW---AYRLVMIARARSAMDRVAPKLEAGSEPSEVAAQME 62

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
              L N   + +L            L  AG+R   + +I   +R ++P++ +++  +   
Sbjct: 63  RGPLANV--RWDLLDRWRSGEDARLLLRAGYRRPAAPSIFNTIRFLLPVVLVVVTGMTEH 120

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                +         +++ +  VG+  P   + +  + R  ++    P  +D+L +    
Sbjct: 121 LLAPHMLK--LTFWMSLLAVAIVGYLLPKFILESKAKSRGDAVNAEIPFFVDMLALLQGV 178

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+S++Q+L  +A+        L+ EM      ++    R  A +    +           
Sbjct: 179 GLSLEQSLASLAQTSEAGIPLLAGEMREMGKHIAIGRPRVEAMQKLAEQLGDPDFEELVN 238

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L Q +R+G  +   LR      + +R M   ++   L  K+T  M +  LP L+L+  G
Sbjct: 239 MLRQIERFGGDVAQPLRDFAGRLQEKRQMALRERVGKLNVKMTAVMTLTMLPALLLITAG 298

Query: 317 PAILSIIDTMKD 328
           PA+L+++     
Sbjct: 299 PAVLALLRFFDK 310


>gi|115361041|ref|YP_778178.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115286369|gb|ABI91844.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 323

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 77/319 (24%), Positives = 144/319 (45%), Gaps = 6/319 (1%)

Query: 9   FDATELA-VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
                +    +   + IF     +V   L +    +R    A               + S
Sbjct: 1   MQNLSVIHTVMLAGLFIFVAGGVLVAMLLFAPRNIERRIQQASGASAGIGGGADGDGQTS 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                    S+ +         +    +  +  +L  AG+R+  +  +    + V+ ++ 
Sbjct: 61  RWIAKLVELSQPISRLS---VPQEGWENSPLRIRLMNAGWRNPNAGALYFAAKTVLALVL 117

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
               ++ +       +      +   +    +G+  P+V +S  +  RQ  I   +PDAL
Sbjct: 118 PGAALLALATTRLAEQRMLLSFILVAL--AGIGYYVPNVILSRRIATRQRVIFEDFPDAL 175

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLL +CVE+G+ +D AL RV+E++  +S  ++ E+ L + E+     ++ A  NF  RT 
Sbjct: 176 DLLTVCVEAGLGLDAALMRVSEELRFRSEVVAGELDLLLLEMRSGFTKETALRNFALRTG 235

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           ++ + +    LIQ+DR+GTSI +SLRVL    R+ R M AE++AA +  KL  P+I    
Sbjct: 236 VEDIESFCAMLIQADRFGTSIAESLRVLSDMLRTRRRMRAEERAAKIALKLLFPLIFNIF 295

Query: 308 PVLILVIIGPAILSIIDTM 326
           P L+ V++GPA++ +   +
Sbjct: 296 PALMCVLLGPAMIHVYRVL 314


>gi|317122043|ref|YP_004102046.1| type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
 gi|315592023|gb|ADU51319.1| Type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
          Length = 331

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 69/288 (23%), Positives = 130/288 (45%), Gaps = 8/288 (2%)

Query: 41  LEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVN 100
             KR++ +        + +   L +  +   LR      +    +        V      
Sbjct: 52  ARKRLRELGRRGAPPDQAEAEELAQPFSRRVLRPWWEALVAAAERW---TPQGVAARWER 108

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
            L+ AG      L  L+ ++     +   LG++        L      R   ++L+G +G
Sbjct: 109 LLQTAG--RPLGLGALVCLKAAGAAVGGGLGLLSAGWLPDPLGGSPAGRAAGLVLLGLLG 166

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
           +  P   + +   +R+  + RA PD +DLL + VE+G+  D A+++V+E       P+S 
Sbjct: 167 WGLPDAVLRDRAARRRRQMARALPDVMDLLSVSVEAGLGFDGAIQKVSEKF---PAPVST 223

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E    + EL     R+ A  +  +R ++  +R+   A+IQ+DR G S+   LRV   + R
Sbjct: 224 EFRQYLKELRLGVEREEALRSLADRCELPELRSFAAAVIQADRLGVSLARVLRVQAEQLR 283

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            +R   AE++A     K+ +P+++F  P L +V++GPA++ I+    D
Sbjct: 284 FQRKQRAEEQAMKTPIKMLLPLVLFIFPTLFIVLLGPALIQILAAFND 331


>gi|119962497|ref|YP_948623.1| type II secretion system protein F [Arthrobacter aurescens TC1]
 gi|119949356|gb|ABM08267.1| putative bacterial type II secretion system protein F domain
           [Arthrobacter aurescens TC1]
          Length = 296

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 62/268 (23%), Positives = 122/268 (45%), Gaps = 9/268 (3%)

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            T+L + +  +        +         L        +   L   G  +   L  LL++
Sbjct: 35  RTNLSRSAGMATDLGAQPSAFNLHRLGAKLTPKGYTIWLDKLLAKLGRPAGMPLGRLLIL 94

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +  + +   ++G+++          P        +    + +  P + I     +RQ +I
Sbjct: 95  KPALALAAGLVGLLFFL------RAPSGQGFLLYLAAVLLVYFIPDLIIHGRAAERQKAI 148

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +   P+ LD +LI VE+G+  + A+ R  ++    S PL+ EML T+ ++    +R+ A+
Sbjct: 149 QTELPNTLDQMLISVEAGLGFEGAMARAGQN---GSGPLAMEMLRTLQDMQAGRSRKEAY 205

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
                R  +  +R    A++Q+D YG +I + LR    + R +R   AE++A  L  K+ 
Sbjct: 206 VALAERVDVHDLRAFVGAIVQADTYGIAIANVLRTQAKQMRIKRRQRAEEQAMKLPVKVL 265

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMK 327
            P++   LPVL +VI+GPA+L+++  + 
Sbjct: 266 FPLMFCILPVLFIVIMGPAVLNVMTNLA 293


>gi|194335918|ref|YP_002017712.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308395|gb|ACF43095.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 332

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/313 (13%), Positives = 111/313 (35%), Gaps = 19/313 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
             ++    +++  ++  +        +L  + K   ++      +Q      +  + R  
Sbjct: 4   FLISFFAFLAVMLIMLLLYGVWFHFFDLRNQAKKKHLQAIYNAVRQSGQSLGNEQTPRQE 63

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           +      R+  +            +   L+ A            + RL+V ++      +
Sbjct: 64  SAIETWFRSRSRTFETWLRSRSGTLETLLQRA-------HTPFTIGRLIVLML-----AL 111

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +       L    Q     ++++       P +W+    ++R+       P+ALD +   
Sbjct: 112 FTLVVVLGLLLLPQTNPLHLLMLAVAIASMPVLWLLRQAKQRRKVFGDKLPEALDYISRA 171

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           + +G S+  A+  V +++     P+  E      E+SF    + A  +  +R Q + +  
Sbjct: 172 MRAGHSLTSAIGMVGKELPD---PIGYEFKTVFDEISFGIPFKDAIGHLADRIQSNDLNF 228

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI-- 311
              +L      G ++ + L  L    R    +  + +  S   + +   I+  +P +   
Sbjct: 229 FVISLKIQHETGGNLAELLHGLAKTIRERVKLRGKVRTLSSEGRASA-WILGTMPFVFAG 287

Query: 312 -LVIIGPAILSII 323
            L++I P  +S++
Sbjct: 288 ILMLINPGYISVL 300


>gi|126440858|ref|YP_001058913.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|254198255|ref|ZP_04904677.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei S13]
 gi|126220351|gb|ABN83857.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei 668]
 gi|169654996|gb|EDS87689.1| bacterial type II secretion system protein [Burkholderia
           pseudomallei S13]
          Length = 314

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 72/263 (27%), Positives = 134/263 (50%), Gaps = 1/263 (0%)

Query: 66  DSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPI 125
           D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV  
Sbjct: 53  DDGARSMPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGA 112

Query: 126 IFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPD 185
              +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PD
Sbjct: 113 CAGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPD 171

Query: 186 ALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNR 245
           ALDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A      R
Sbjct: 172 ALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAAR 231

Query: 246 TQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F
Sbjct: 232 IGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLF 291

Query: 306 FLPVLILVIIGPAILSIIDTMKD 328
            +P + L+  GPA++ +I     
Sbjct: 292 VMPTVALIAAGPAVIRLIAVFHK 314


>gi|257791502|ref|YP_003182108.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257475399|gb|ACV55719.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 295

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 66/317 (20%), Positives = 140/317 (44%), Gaps = 27/317 (8%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            E+ VA+    S    +Y +    L     +                       DS+   
Sbjct: 1   MEMMVALLIGCSAGFAVYLLFASRLFPSYRK------------------IEKPPDSSVDA 42

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
             +    +  +FV  +   +   + N+ N++ AAG   +   +    + +++ ++ +I  
Sbjct: 43  NVSDRMAAAASFVSNMLPLSRAQERNLRNQIAAAGLNMK--PSTFYGLSVILSLLGMIAL 100

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           +++             L    V+  G +G   P  ++     +RQ +I R     +DLL 
Sbjct: 101 LVFSPYIVGSDTTSLLLFNAVVVAAGILG---PRGFLILKRNERQEAINRELASVIDLLS 157

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF-LPNRQVAFENFYNRTQMDC 250
           I VE+G+++++A+R V+E + G    L +E+ L   +++    +R+ A     +R Q + 
Sbjct: 158 ISVEAGLTMERAMRHVSERLDGT---LCKEIALCERDINLLGYSREDALRRLADRCQTEG 214

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           V     ++I S + G+SI   L++  S  R+ +    E+K   L  K+  PM +F +P L
Sbjct: 215 VSMFVSSVIVSAKSGSSISRVLKMQASVARNRQFTALEEKVEKLPTKMIFPMSMFIMPSL 274

Query: 311 ILVIIGPAILSIIDTMK 327
           +L+++ PA+L+++++  
Sbjct: 275 MLIVMAPAVLTLVESFS 291


>gi|15887569|ref|NP_353250.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155106|gb|AAK86035.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 334

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 61/321 (19%), Positives = 123/321 (38%), Gaps = 21/321 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T + +A+  A+S  +L YA +   +   +            E        +  +   
Sbjct: 1   MDPTIVLLAVLVAISAGALAYAFLFQQIEVEKKTTSRFKRVQAAETDHTNIKAARDRVQE 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            S+ R     SLR+  KK N K     + ++ +KL  AG     S+    ++        
Sbjct: 61  LSKRRKSMQDSLRDMEKKQNEKAKKAKNVSLRDKLVQAGL--TISVRQFHLLSAGAAACA 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + +I+               + A+ +        P   ++ L+++RQ      +P+AL
Sbjct: 119 AFISLIYGLSL-----------LTALPIAVVAALGLPRWVLAFLLKRRQKKFLEEFPNAL 167

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++   ++SG+ ++ A+R +A        P+  E    +             E       
Sbjct: 168 DVMCRSIKSGLPLNDAVRLIAS---DGQEPVKTEFQRVVDAQQVGIGIPQGIERMMLTMP 224

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  V   +  +    + G ++ ++L  L    R  R M A+  A S+  K +  +II  L
Sbjct: 225 LFEVSFFSIVINIQAQAGGNLSEALSNLSRVLRDRRKMRAKVNALSMEAKASA-VIIGAL 283

Query: 308 PVLILVII---GPAILSIIDT 325
           P ++++++    P  LSI+ T
Sbjct: 284 PFIVMLLVHFTSPDYLSILFT 304


>gi|16263304|ref|NP_436097.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304377|ref|ZP_07584128.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|14523983|gb|AAK65509.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306902579|gb|EFN33173.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 333

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 54/319 (16%), Positives = 114/319 (35%), Gaps = 19/319 (5%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            AT L   +   +   + I  +++ +      +        ER   R +   S   ++  
Sbjct: 1   MATSLLFPVFVFLLASTSIGGMMVAAFYPRVSKASAYRQRFERISARAEDKRSEPAETDG 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
              R    K+LR   +K    A      +  +LR +G                    FL+
Sbjct: 61  RDRRRSVEKTLREIEEKRQANARKGKVTLSARLRQSGLHWSRKAY------------FLV 108

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
                +  +  +L       + +V      G   P ++++     R +     +P+A+D+
Sbjct: 109 CAGATLATWVVMLLLLGLGPLVSVGFAIAGGLLLPHLYVNMKRNARFTRFAAEFPNAVDV 168

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  +++G+ +   LR +A        P+  E L  + + +       A +    R  + 
Sbjct: 169 IVRGLKAGLPMPDCLRVIA---MEAQEPVKGEFLAIVQDQTLGIPVDEAVKRMSERMPLA 225

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
                   +    R G S+ ++L  L    R  + M+ + KA S   K +   II  LP 
Sbjct: 226 EANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIKAMSSEAKSSAG-IIGALPF 284

Query: 310 LI---LVIIGPAILSIIDT 325
           L+   +  + P  ++++ T
Sbjct: 285 LVAGAVYFMSPDYMALLFT 303


>gi|218708112|ref|YP_002415733.1| putative bacterial type II secretion system protein [Vibrio
           splendidus LGP32]
 gi|218321131|emb|CAV17081.1| putative bacterial type II secretion system protein, TadC-like
           protein [Vibrio splendidus LGP32]
          Length = 301

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/307 (17%), Positives = 128/307 (41%), Gaps = 20/307 (6%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
                  +   +  +    +   + + R+ ++A    +  + +   ++            
Sbjct: 12  LFFAWAGVAFGLLLIFYWLVVCTQKKHRIAALAKHHRLADQSKEAEIK------------ 59

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
              L  ++  ++   +  + +I  +   AG          + ++       L +G + + 
Sbjct: 60  ---LNRWLTPMSTIFVTSESDIAVRFANAGVSDIRWAQWFMPLKYS----ALFIGQVVVA 112

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G     E   +  +        V    P + +S++ + RQ  I R  P  +DL+ ICV++
Sbjct: 113 GVCWFFEVSSESWIAIAAGWAMVVIVMPDLVLSSMAKNRQRRISRQMPYLIDLMAICVQT 172

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G++I+ +++ ++ ++      LS  + +T          + A E  Y +     VR+   
Sbjct: 173 GMTIEASMKYLSIEMKSFDKELSSLLEVTNQRARL-VGMENALEELYRKVPSPEVRSFVM 231

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L QS ++G+SI + L  L  + R  +++E E++   L  K+++P+I+F L  ++ VI  
Sbjct: 232 TLTQSIQHGSSIYNVLTTLAGDIREVQMLELEEEIGKLAAKMSIPLIVFILIPIVFVIAA 291

Query: 317 PAILSII 323
           P ++ ++
Sbjct: 292 PGVMRMM 298


>gi|86144313|ref|ZP_01062645.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
 gi|85837212|gb|EAQ55324.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
          Length = 288

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/313 (17%), Positives = 128/313 (40%), Gaps = 29/313 (9%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            T +  ++   +S+    Y +        ++E R    +   E  R              
Sbjct: 4   ETVIIWSVIFIISMVLATYCLRFWDNTRADIETRKIIGSTREEKKRA------------- 50

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                     +  + +++            KL AAGF S++  ++  ++++V   + L L
Sbjct: 51  -------DLFKAILSRISFNK----HETKRKLVAAGFYSDFLADVYYLLKIVPFCVCLAL 99

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
                +      +      +  ++    +    P  ++S   +     I    P  LDL+
Sbjct: 100 IGFDFY----SGDTKTVFALLYLMGALLIFIIGPDSYVSARGKSNIKHISSRLPFLLDLM 155

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +CV +G++I+ +L  +A+++      L+  + +T+         + A E FY       
Sbjct: 156 NVCVHTGMTIESSLEYLAKELHSVDSNLAHVVRVTVERSRL-VGLEKALEEFYELVPTSE 214

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
            ++    ++QS ++G+S+G  L  L S+ R   +M+ E++   +G K+++P+I F +  +
Sbjct: 215 SQSFVMTMVQSLQFGSSVGPVLVTLASDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPI 274

Query: 311 ILVIIGPAILSII 323
           I++I  P I+  +
Sbjct: 275 IILIAAPGIMRAL 287


>gi|167902780|ref|ZP_02489985.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei NCTC 13177]
          Length = 270

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 72/266 (27%), Positives = 134/266 (50%), Gaps = 1/266 (0%)

Query: 63  LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLV 122
              D  +  +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LV
Sbjct: 6   APVDDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLV 65

Query: 123 VPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRA 182
           V     +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I   
Sbjct: 66  VGACAGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAY 124

Query: 183 WPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENF 242
            PDALDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A    
Sbjct: 125 LPDALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAM 184

Query: 243 YNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPM 302
             R  +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM
Sbjct: 185 AARIGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPM 244

Query: 303 IIFFLPVLILVIIGPAILSIIDTMKD 328
           ++F +P + L+  GPA++ +I     
Sbjct: 245 MLFVMPTVALIAAGPAVIRLIAVFHK 270


>gi|284991838|ref|YP_003410392.1| Type II secretion system F domain-containing protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284065083|gb|ADB76021.1| Type II secretion system F domain protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 295

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 69/281 (24%), Positives = 124/281 (44%), Gaps = 9/281 (3%)

Query: 47  SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAG 106
           ++    +    +   +L +            +S         L        +     AAG
Sbjct: 23  ALLARPQDAAARTRANLTRGLDLPGAAPARPRSRLLPGLVRALTPAGTVARLNRLAGAAG 82

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
              E+ +  L+  +LV+  +          G   +   P  L V   + +  V +  P +
Sbjct: 83  RPGEWPVPRLVAAKLVLAAVAA------ALGGLVVTAGPGPLTVLMAVGVTGVAYVVPEL 136

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
            + +  Q+RQ +I     D LD + I VE+G+  + A+ R   +  G   PL+EE++ T+
Sbjct: 137 LLYSRGQERQQAIALELADTLDQMTIAVEAGLGFEAAMARAGRNGRG---PLAEELVRTL 193

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            +++    R+ A+     RT +  +R   +A++Q+D YG SI D LR   +E R +R   
Sbjct: 194 QDIAVGQPRREAYLALAERTAVPDLRRFIRAVVQADAYGVSIADVLRTQAAEMRLKRRQR 253

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           AE+KA  +  K+  P+I+  LP L +V++GPA+L I     
Sbjct: 254 AEEKAMQIPVKVIFPLILCILPTLFIVLLGPAVLDIAAAFG 294


>gi|307318084|ref|ZP_07597520.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306896125|gb|EFN26875.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 333

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 54/319 (16%), Positives = 114/319 (35%), Gaps = 19/319 (5%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            AT L   +   +   + I  +++ +      +        ER   R +   S   ++  
Sbjct: 1   MATSLLFPVFVFLLASTSIGGMMVAAFYPRVSKASAYRQRFERISARAEDKRSEPAETDG 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
              R    K+LR   +K    A      +  +LR +G                    FL+
Sbjct: 61  RDRRRSVEKTLREIEEKRQANARKGKVTLSARLRQSGLHWSRKAY------------FLV 108

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
                +  +  +L       + +V      G   P ++++     R +     +P+A+D+
Sbjct: 109 CAGAALATWVVMLLLLGLGPLVSVGFAIAGGLLLPHLYVNMKRNARFTRFAAEFPNAVDV 168

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  +++G+ +   LR +A        P+  E L  + + +       A +    R  + 
Sbjct: 169 IVRGLKAGLPMPDCLRVIA---MEAQEPVKGEFLAIVQDQTLGIPVDEAVKRMSERMPLA 225

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
                   +    R G S+ ++L  L    R  + M+ + KA S   K +   II  LP 
Sbjct: 226 EANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIKAMSSEAKSSAG-IIGALPF 284

Query: 310 LI---LVIIGPAILSIIDT 325
           L+   +  + P  ++++ T
Sbjct: 285 LVAGAVYFMSPDYMALLFT 303


>gi|86147189|ref|ZP_01065505.1| bipartite nuclear localization signal containing protein, TadC-like
           protein [Vibrio sp. MED222]
 gi|85835073|gb|EAQ53215.1| bipartite nuclear localization signal containing protein, TadC-like
           protein [Vibrio sp. MED222]
          Length = 301

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/307 (16%), Positives = 126/307 (41%), Gaps = 20/307 (6%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
                  +   +  +    +   + + R+ ++A    +  + +   ++            
Sbjct: 12  LFFAWAGVAFGLLLIFYWLVVCTQKKHRIAALAKHHRLADQSKEAEIK------------ 59

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
              L  ++  ++   +  + +I  +   AG          + ++     I  ++     +
Sbjct: 60  ---LNRWLTPMSTIFVTSESDITVRFANAGVSDIRWAQWFMPLKYSALFIGQVVVAGVCW 116

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
                 E   +  +        V    P + +S++ + RQ  I R  P  +DL+ ICV++
Sbjct: 117 FI----EVSSESWIAIAAGWAMVVIVMPDLVLSSMAKNRQRRISRQMPYLIDLMAICVQT 172

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G++I+ +++ ++ ++      LS  + +T          + A E  Y +     VR+   
Sbjct: 173 GMTIEASMKYLSIEMKSFDKELSSLLEVTNQRARL-VGMENALEELYRKVPSPEVRSFVM 231

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
            L QS ++G+SI + L  L  + R  +++E E++   L  K+++P+I+F L  ++ VI  
Sbjct: 232 TLTQSIQHGSSIYNVLTTLAGDIREVQMLELEEEIGKLAAKMSIPLIVFILIPIVFVIAA 291

Query: 317 PAILSII 323
           P ++ ++
Sbjct: 292 PGVMRMM 298


>gi|92116009|ref|YP_575738.1| type II secretion system protein [Nitrobacter hamburgensis X14]
 gi|91798903|gb|ABE61278.1| type II secretion system protein [Nitrobacter hamburgensis X14]
          Length = 324

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/319 (17%), Positives = 122/319 (38%), Gaps = 27/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   LA+A   A ++  + +  + P+L      +        R    +      Q D A
Sbjct: 1   MNLQTLAMAFMAATAVGGVAWVFLYPALSGEAKAE------KRRSAFARTAPAVRQVDRA 54

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   SLR   ++    + +    + +++  AG    +S    L+V  +   +  
Sbjct: 55  QRSRREQIEGSLREIEQRQKRDSKI---TLNDRIAQAGL--SWSKEKFLIVSGIFGAVCF 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            + +                 + AV L    GF  P   +  L  +R+ +  RA PDA+D
Sbjct: 110 AVPMF-----------SGAGPIAAVGLAFAAGFGLPRWLLGFLKTRREKAFLRALPDAVD 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  +++G+ + ++++ VA        PL  E    I   +       A    Y R  +
Sbjct: 159 VIVRGIKAGLPLFESIKVVA---ADSPEPLKSEFAAIIETQAIGMPLGEACARLYERMPV 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M  + +A S+  K +  +I    P
Sbjct: 216 PEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAAIIGSLPP 275

Query: 309 VLILV--IIGPAILSIIDT 325
           V++++  +  P  ++++ T
Sbjct: 276 VVMMLVYLTTPDYIAMLWT 294


>gi|127511576|ref|YP_001092773.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636871|gb|ABO22514.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 287

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 63/231 (27%), Positives = 111/231 (48%), Gaps = 9/231 (3%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E +  KL+ +G     +      +R++  +  L L +I     D  +          ++L
Sbjct: 66  ERVSKKLQVSGLSYIMTAEQYFAIRILSTLFSLGLTLICSAMLDAYVPQ-------YLLL 118

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               G+  P + +++L +KRQ  I ++ P  LD L + +E+G+++  AL +  E   G +
Sbjct: 119 AAVFGYFLPVMTLNDLRKKRQGLIVKSLPVYLDYLTMSIEAGLNMTGALSQAVE--RGPA 176

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            PL  E    I ++    +R  AF N  +R Q+  V +   AL Q++R G S+G +LR+ 
Sbjct: 177 GPLRIEFEKVIRDMRAGMSRAQAFRNMADRVQVTEVNSLVSALAQAERTGASLGQTLRIQ 236

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             + R ER   AEKKA     KL  P+I+F  PV  +++  P  +  +  +
Sbjct: 237 SDQRRIERFQRAEKKALEAPVKLVFPLIVFIFPVTFMILAFPIAMKFMYEL 287


>gi|269105136|ref|ZP_06157830.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268160586|gb|EEZ39085.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 293

 Score =  119 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 109/247 (44%), Gaps = 6/247 (2%)

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
           SL    K L        + I  K  +AGF       + + ++ ++ +I           +
Sbjct: 52  SLEELKKYLPSALSADVKEIDKKFYSAGFYDFKYAYLYMPIKYLLVLIGSG-----SIYW 106

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                +     +  + +   +    P + ++   +  +  I    P  LDLL +CV++G+
Sbjct: 107 FSKGIFDNPTMMAIICVWVVLCISMPDIVLAQKSKTLRHKISGQLPYLLDLLAMCVQTGM 166

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           +I+ ++  ++ ++ G    LS  +  T          + A +  Y R   + +R+    +
Sbjct: 167 TIESSMSYLSREMKGFDRDLSHLLTRTNDRARI-IGLEQALDELYIRVPTNEMRSFVMTI 225

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
            QS +YG+SI + L  L ++ R  R++  E+K   L  K+++P+I+F L  ++++I  P 
Sbjct: 226 KQSLQYGSSIYNILTTLAADIRDMRMLTLEEKIGKLAAKMSIPLILFILIPIVILIAAPG 285

Query: 319 ILSIIDT 325
           +L ++  
Sbjct: 286 VLRMLQN 292


>gi|319795559|ref|YP_004157199.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598022|gb|ADU39088.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 295

 Score =  119 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 63/316 (19%), Positives = 129/316 (40%), Gaps = 23/316 (7%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
             + + +AI    +   +I  + + SL                   +  + T +      
Sbjct: 1   MRSLILLAIIFLCATVGVILLLYMISLIRKA---------------KPSERTHMDPLPRM 45

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
            RL       L+  V ++   ++LV      +L+ AG          + V++V  ++   
Sbjct: 46  LRLVWPVVNILQFHVSEIAPTSMLVKR--KRQLQLAGLEFVLKAEEFIAVQVVSLVVVAA 103

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           LG+        +       +V   ++   +G+  P +W+ +  +KR+ +I R  P  LD+
Sbjct: 104 LGLWTAGLLGAMAG----TKVWVTLMSCAMGWYYPVMWMRDRRKKREKNILRTLPGYLDM 159

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + +C ++G+S+  A+ +  +   G    L  E    + E+    +R  A      R    
Sbjct: 160 ITLCCQAGLSLTGAIAQAVQKGPG--GALGIEFDRMMREMRTGVSRMDALNAMAERLDNK 217

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +++    L Q++  G S+ D+L  +  + R+ER   AEK A     K+  P++IF  PV
Sbjct: 218 HIKSLVSNLTQAESLGASLADTLSAISDQRRTERFQHAEKLAMEAPVKMIGPLVIFIFPV 277

Query: 310 LILVIIGPAILSIIDT 325
             ++I  P ++  + T
Sbjct: 278 TFIIIFFPLVMQFLQT 293


>gi|258515694|ref|YP_003191916.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779399|gb|ACV63293.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 294

 Score =  119 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 63/282 (22%), Positives = 118/282 (41%), Gaps = 14/282 (4%)

Query: 48  VAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN--LKAILVDENIVNKLRAA 105
           V    E  R ++   + ++++   L     K     +K     L ++   E +   LR A
Sbjct: 24  VKRREEKKRLEEYLQISEENSEENLSLSLQKIKAGVIKLFRPLLPSVTTLEKMEFNLRRA 83

Query: 106 GFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPS 165
               + +   +  +RL + +   +L  I+ F             +      G + F  P+
Sbjct: 84  N--CKITAEEIYTLRLTLSVGAAVLTGIFYFP-------AIDKILLYGGATGGLFFLLPT 134

Query: 166 VWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLT 225
            +I+  ++ RQ   +    D +DLL   +++G+ +  ++ RV + + G    L+EE    
Sbjct: 135 KYINMKIRARQKRAQLEILDFIDLLTNGIDAGLDLSTSIDRVTKHMPGI---LAEEFQYA 191

Query: 226 IAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLM 285
             E+     R  A +N   R  +  V     A+IQ++R G  I   L+   +  + +   
Sbjct: 192 FVEIELGRRRSEALKNMAQRLDIKDVNLLVDAIIQAERTGVPIAKVLKDQANRIKQDFRT 251

Query: 286 EAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            A K A +   K+  PMI+F LP L +V++GP  + I   MK
Sbjct: 252 NALKMAQAASIKMLAPMILFILPALFIVVLGPPFIGIGQLMK 293


>gi|39936744|ref|NP_949020.1| type II secretion system protein [Rhodopseudomonas palustris
           CGA009]
 gi|39650600|emb|CAE29123.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 324

 Score =  119 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 59/321 (18%), Positives = 122/321 (38%), Gaps = 31/321 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDS 67
            +   LA+    A+++  + +  V P L     +E+R+  VA     +R+   T      
Sbjct: 1   MEMQTLALGFFAAIAVGGVAWVFVYPLLSGEKTVEQRLTFVARSTPTVRQADRTQR---- 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R +   S++    +   +    +  +  KL  AG   +++     VV   + I  
Sbjct: 57  ---SRREQIEGSIKEIETRNEKQK---NVPLTAKLSQAGL--DWTPGKFGVVSASLGIFM 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L + II            F    G            P   +  L ++R+     A PDA+
Sbjct: 109 LGIAIILGASLPAAAGLGFAAGFGL-----------PRWTLGYLKRRREKKFLAALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ +  +++ VA        PL  E    I   +       A    Y R  
Sbjct: 158 DIIVRGIKAGLPLFDSIKMVA---ADSPEPLRSEFNAIIETQAIGMPIGEACARLYERMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + +A S+  K +   II  L
Sbjct: 215 IPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAA-IIGSL 273

Query: 308 PVLILVIIG---PAILSIIDT 325
           P+++++++    P  +S++ T
Sbjct: 274 PIIVMMLVYVTTPDYISLLWT 294


>gi|149186258|ref|ZP_01864572.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
 gi|148830289|gb|EDL48726.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
          Length = 323

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 51/320 (15%), Positives = 115/320 (35%), Gaps = 30/320 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +  +L +     + + +L  +           ++R++ V          ++ S  K + 
Sbjct: 1   MNMIQLVLVAGGLLVLATLGVSAFAGPSAGKASQRRLQQVRYRHSESTDAKVESQLKKAI 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +SR   +  ++           +    E +  +L   G    +SL+      L V +   
Sbjct: 61  ASRKPKQFKQA----------GSGSRLEALAVRLDRTG--KGWSLSQYAYASLGVGMAVA 108

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++  +                  ++ L  + G   P   +   ++KR +     + DA++
Sbjct: 109 VILFLRSGSLP-----------LSLALGTFAGAGIPHFVVGRAIKKRTNQFNVKFADAIE 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL+  + SG+ + + L  V+++I G   P+ EE    +  +      + + +   +R  +
Sbjct: 158 LLVRGLRSGLPVTETLNVVSQEIPG---PVGEEFKSIVERIKIGRTMEESLQETADRLGI 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    L      G ++ ++L  L    R    M+ + KA S   K +   I+  LP
Sbjct: 215 PEFNFFCITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIKAMSSESKASA-YIVGSLP 273

Query: 309 VLI---LVIIGPAILSIIDT 325
            ++   +  I P  L    T
Sbjct: 274 FIVFGLIFWINPEYLGGFFT 293


>gi|121534350|ref|ZP_01666174.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307120|gb|EAX48038.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 308

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 69/318 (21%), Positives = 135/318 (42%), Gaps = 12/318 (3%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDSASS 70
             + + + + V++F L+Y ++  +  + G +  R+K++        +  I          
Sbjct: 1   MLMLIVVLSFVTVFLLVYLLLAANALAQGNIAMRLKALNT--MTAGRSDIDQELARPFKE 58

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
           R+ +         + +   +A+     +  K+ AAG     + +  L++      +F + 
Sbjct: 59  RVLSPLRSDFAAALSRFTPRALRR--AVEEKMAAAGGFGSLTPDEFLLLSG----LFAVA 112

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
                     L        VG   +        P   ++  +  R+ SI++  PD LDLL
Sbjct: 113 APAVAATLAALTGAAAHQIVGLSFMAFASALLLPFFLLNRKIAMRKRSIQKDLPDVLDLL 172

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            + VE+G+  D AL +++E + G    L +E    + E+     R+ A      R  +  
Sbjct: 173 TVSVEAGLGFDGALAKLSEKMKGA---LVDEFTRALQEMRMGVPRREALRAMGLRCDVPD 229

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +   T +LIQ+D+ G SIG  LRV  +  R +R    ++ A     K+ +P++ F  P +
Sbjct: 230 LSLFTTSLIQADQLGVSIGQVLRVQSASMREKRRQRTQELAMKAPVKMLLPLVFFIFPAI 289

Query: 311 ILVIIGPAILSIIDTMKD 328
            +V++GPAI+ I  T   
Sbjct: 290 FVVVLGPAIIQIFLTFSQ 307


>gi|312621086|ref|YP_003993814.1| type ii/iv secretion system protein tadc,associated with flp pilus
           assembly [Photobacterium damselae subsp. damselae]
 gi|311872807|emb|CBX86898.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Photobacterium damselae subsp. damselae]
          Length = 303

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/246 (20%), Positives = 109/246 (44%), Gaps = 6/246 (2%)

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
           SL    K L        + I  K  +AGF       + + ++ ++ +I           +
Sbjct: 62  SLEELKKYLPSALSADVKEIDKKFYSAGFYDFKYAYLYMPIKYLLVLIGSG-----SIYW 116

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                +     +  + +   +    P + ++   +  +  I    P  LDLL +CV++G+
Sbjct: 117 FSKGIFDNPTMMAIICVWVVLCISMPDIVLAQKSKTLRHKISGQLPYLLDLLAMCVQTGM 176

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           +I+ ++  ++ ++ G    LS  +  T          + A +  Y R   + +R+    +
Sbjct: 177 TIESSMSYLSREMKGFDRDLSHLLTRTNDRARI-IGLEQALDELYIRVPTNEMRSFVMTI 235

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
            QS +YG+SI + L  L ++ R  R++  E+K   L  K+++P+I+F L  ++++I  P 
Sbjct: 236 KQSLQYGSSIYNILTTLAADIRDMRMLTLEEKIGKLAAKMSIPLILFILIPIVILIAAPG 295

Query: 319 ILSIID 324
           +L ++ 
Sbjct: 296 VLRMLQ 301


>gi|222147178|ref|YP_002548135.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734168|gb|ACM35131.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 334

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/300 (17%), Positives = 110/300 (36%), Gaps = 20/300 (6%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
             +        +   R+  V        K+Q+   +    S R ++          K+  
Sbjct: 22  VLLFSRVQADKKTATRLARVKNAEADTAKKQVARDRVQELSKRRKSVQDTLKEIERKQNE 81

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
               +  +++  +L   G   + SL    +    + ++F  L  +        L      
Sbjct: 82  KNKKISSQSLKQRLGQTGL--DVSLIQFSIASTTLGLVFFCLCFVLGMSLFVSLG----- 134

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
                 +    G   P   +S L+++RQ      +P+ALD+++  ++SG+ ++ ALR +A
Sbjct: 135 ------IAFTAGAGLPRWIVSFLIRRRQEKFLTEFPNALDVMVRSIKSGLPLNDALRMIA 188

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
                   P+  E    +           A    +N   +  V      +    + G ++
Sbjct: 189 ---VDAQEPVKTEFRRVVDAQQLGITVPEACGRMFNSMPLQEVSFFAIVIAIQSQAGGNL 245

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
            ++L  L    R  R M+A+  A S+  K +  +II  LP ++  ++    PA + ++ T
Sbjct: 246 SEALSNLSKVLRERRKMKAKVSALSMEAKASA-VIIGALPFIVAFLVYISSPAYIMVLFT 304


>gi|170725110|ref|YP_001759136.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810457|gb|ACA85041.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 287

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 63/231 (27%), Positives = 112/231 (48%), Gaps = 9/231 (3%)

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E I  KL+ +G     +      +R++  +  + L  I     D        + +  +IL
Sbjct: 66  ERISKKLQISGVSYMMTAEQYFAIRILSTLFAVGLATICGLLLDD-------ISIKYLIL 118

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
            G  G+  P + +++L +KRQ+ I ++ P  LD L + +E+G+++  A+ +  E   G S
Sbjct: 119 AGLFGYILPVITLNDLRKKRQALIVKSLPVYLDYLTMSIEAGLNMTGAISQAVE--RGPS 176

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
            PL  E    I ++    +R  +F N   R Q+  + +   AL Q+++ G S+G +LRV 
Sbjct: 177 GPLRIEFEKVIRDMRAGMSRAQSFRNMAERVQITEINSLVSALAQAEKTGASLGQTLRVQ 236

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
             + R ER   AEKKA     KL  P+I+F  PV  +++  P  +  +  +
Sbjct: 237 SDQRRIERFQRAEKKALEAPVKLVFPLIVFIFPVTFMILAFPIAMKFMYEL 287


>gi|264680614|ref|YP_003280524.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262211130|gb|ACY35228.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 317

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 69/315 (21%), Positives = 130/315 (41%), Gaps = 9/315 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
             +     +++ +LI A VI       E   ++   A+ R         +     A    
Sbjct: 7   YLMLSIALLAVAALIGAAVIAYTHQRRERSSQVVRDALSRSGAAAANEAATPARPADLLR 66

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                  L       +L   LV +     L   G+ S  +    L+ R ++ ++F +L  
Sbjct: 67  SLNGDGELPAHWLNTSLGKALVAQEDRILLSKCGWGSTRAQLQYLIARCLISVLFSLLAA 126

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
               G  +         +  +     +GF  P   + ++ ++R++ + R  P  +DLL +
Sbjct: 127 FVFLGSKQF--------LLYLFAAFTIGFLLPKWVLRSVARRRRACVARELPLFVDLLGL 178

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
              +G+S+DQ L+ +  D G     LS E+ L   + S    R+ +F       Q D + 
Sbjct: 179 LQGTGMSLDQTLQVIGSDFGNVMPVLSREIQLANQQYSRGSTRERSFGRMSEVYQNDNLA 238

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           N T  +IQ DRYG ++ + LR+     R +R  + ++    +  K+T  M++  LP LI+
Sbjct: 239 NLTSLMIQIDRYGGAVQEPLRIFGERLREQRKAKMKELIGKISVKMTAVMVVTLLPALII 298

Query: 313 VIIGPAILSIIDTMK 327
           +  GP  L++I  + 
Sbjct: 299 ITAGPGFLAVIRALG 313


>gi|160897511|ref|YP_001563093.1| type II secretion system protein [Delftia acidovorans SPH-1]
 gi|160363095|gb|ABX34708.1| type II secretion system protein [Delftia acidovorans SPH-1]
          Length = 334

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/335 (16%), Positives = 128/335 (38%), Gaps = 24/335 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYA--VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
               +L +A  +  ++  +++A  +V     S     ++  +   R+     +  +    
Sbjct: 1   MTPQQLWIASISLGALGLVLWACALVWKLWRSARASSQVARILQARDTASTPKAATKSAM 60

Query: 67  SASSRLRTRDSKSLRNFVK---------------KLNLKAILVDENIVNKLRAAGFRSEY 111
            A+                               +  +   L+ +     L  AG  +  
Sbjct: 61  QANDAQLLNPLSINVRSSDSPQAVAANLPPPAWLQWGVAKALLADEDRKLLDQAGVGTRN 120

Query: 112 SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNL 171
                +  R+V+ ++  +L +  +   +          +    L   +G   P  ++ + 
Sbjct: 121 GSMAYVASRMVLCVVLPLLALGVLRPGEN-------AALMYGFLGVSLGLMLPKWFLRSR 173

Query: 172 VQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSF 231
            + R+  +    P  +DLL +    G+S+DQ+L+ +A +       +S E+ L     + 
Sbjct: 174 AKGRREQVVEELPLFVDLLRLLQGVGLSVDQSLQILASEFKSVLRVISGELALANQLYNT 233

Query: 232 LPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKA 291
              R+ +F+   N +  D +      L+Q D++G ++ + LR      R +R    ++K 
Sbjct: 234 GRTREQSFQRMVNMSADDDMSAIVNLLVQVDKHGGAVQEPLREFSIRLREKRQASFKEKI 293

Query: 292 ASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            S+  K+T  M++  LP L+++  GP  L++I  +
Sbjct: 294 GSITVKMTGVMVLTLLPALLVITAGPGFLAVIRAL 328


>gi|258620798|ref|ZP_05715833.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|258624768|ref|ZP_05719699.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|262173889|ref|ZP_06041566.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
 gi|258582930|gb|EEW07748.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|258586996|gb|EEW11710.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|261891247|gb|EEY37234.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
          Length = 291

 Score =  119 bits (297), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 62/278 (22%), Positives = 118/278 (42%), Gaps = 5/278 (1%)

Query: 47  SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAG 106
           S+ +    LR    T     +      TR+ K+   FV  L        +    KL  AG
Sbjct: 17  SLVITHFALRSWDRTKATISTRKIIGSTREEKNRFEFVYSLLNMVSFNQDETKKKLVKAG 76

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
             +++      + +++ P        I  F   K  E    + +    ++  +G   P +
Sbjct: 77  IYNQFIARSYYLFKII-PFGLCAFFSILAFLSGKTDETMLVVSLAIGAIVFLLG---PDM 132

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           +I+   +K    I    P  LDL+ +CV +G++I+  L  +A ++      L+  +  T+
Sbjct: 133 YIAARGKKITKKISSRLPFLLDLMNVCVHTGMTIEACLEYLAFELRTVDHHLAYVVKKTV 192

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
                    + A   FY+       ++    + QS +YG+SIG  L  L S+ R   +M+
Sbjct: 193 ERSKL-VGLEKALNEFYDLVPTAEAQSFVMTMTQSLKYGSSIGPVLATLASDIREMNMMD 251

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            E+K   +G K+++P+I F +  +I++I  P I+ +  
Sbjct: 252 LEEKIGKMGAKMSIPLIAFIMVPIIILIAAPGIMRMFS 289


>gi|227823975|ref|YP_002827948.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|227342977|gb|ACP27195.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 336

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 54/299 (18%), Positives = 110/299 (36%), Gaps = 21/299 (7%)

Query: 30  AVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNL 89
            +        + E R++ V+   E  R +   +  + +  S+ R     SL+   KK   
Sbjct: 26  VLYSRIENDKKAEGRLRRVSAA-ETDRAKIKAARDRVNEMSKRRKSLQDSLKELEKKQQE 84

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           K+     ++  +L  A      S     V  ++  +  LI+ +I   G            
Sbjct: 85  KSANAAPSMKKRLVQANL--SISPAQFYVFSVIFGLFALIVVLIAGAGLWIAGGVALITA 142

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
            G            P   +  +V++R       +P+ALD+++  ++SG+ ++ ALR +A 
Sbjct: 143 AG-----------LPRWLVGAMVKRRCKKFLDEFPNALDVMVRSIKSGLPLNDALRLIAS 191

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
                  P+  E    +       N   A         +  V      +    + G ++ 
Sbjct: 192 ---DGQEPVKTEFRRVVESQQVGLNVPDACARMIQSIPLPEVNFFAIVIAIQAQAGGNLS 248

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           ++L  L    R  + M+A+  A S+  K +   II  LP ++  ++    P  + ++ T
Sbjct: 249 EALGNLSKVLRERKKMKAKVGALSMEAKASA-CIIGALPFIVATLVYLTSPEYMMVLFT 306


>gi|13475422|ref|NP_106986.1| hypothetical protein mlr6486 [Mesorhizobium loti MAFF303099]
 gi|14026174|dbj|BAB52772.1| mlr6486 [Mesorhizobium loti MAFF303099]
          Length = 305

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 53/253 (20%), Positives = 107/253 (42%), Gaps = 2/253 (0%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
           L +         +     R    + +  + + L  +       +  KL  AGF    +  
Sbjct: 35  LAEGITNRRSLHAQQELNRISAQRPVDAYFRGLEKERG-EPNALEAKLFRAGFYQTSAPV 93

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           I  + RL    I  +     +       + P  +      LIG      PS+ +     +
Sbjct: 94  IYTLSRLGAVCIGFLACYAVLSRVLP-PQLPGFVAFAGSALIGLGCLVIPSIALDRFESR 152

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           ++   +R +PD +D+++ C ++G+S++ A+ RV  ++ G    L  ++ +   +L     
Sbjct: 153 QKQVYRRGFPDFMDMMITCADAGMSLEAAVERVGAELAGTHKWLGIQLSIVTLQLRAGKP 212

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
            + A     +R  +D  R       QS+  GTS+ D+LR+   E R++R+M AE++A +L
Sbjct: 213 LREALRELADRIGLDEARALAVLFRQSEELGTSLTDALRIYSDEMRTQRIMNAEERANAL 272

Query: 295 GPKLTVPMIIFFL 307
             K+ +P+ +   
Sbjct: 273 PVKMMIPLGLCIF 285


>gi|84494453|ref|ZP_00993572.1| hypothetical protein JNB_06644 [Janibacter sp. HTCC2649]
 gi|84383946|gb|EAP99826.1| hypothetical protein JNB_06644 [Janibacter sp. HTCC2649]
          Length = 310

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 53/319 (16%), Positives = 109/319 (34%), Gaps = 10/319 (3%)

Query: 9   FDATELAVAITTAV-SIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            +    + AI   +  +  L+    +P      L  R+     +          + Q   
Sbjct: 1   MNDLARSGAILGFLTGVGLLLAWFGLPRHRQAGLADRVLPYLRDTPRPSNLLAANAQTRG 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           A   L       L   V+++    +    ++  +L  AG   +  ++     +++  +  
Sbjct: 61  AIGTLFAPIVGELSGHVERV----MGGTASVRRRLLRAGLAPD--VDKFRAQQVIWGVGG 114

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            +  +               L V    +    G  A  V++S    +R+  +   +P   
Sbjct: 115 GLGMLAVGTLSAVTRGSSPVLVVLLTAIGIASGVVAADVFLSRRANQREERMLAEFPTVA 174

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           +LL + V +G     AL RV     G    LS+E+   + +     +  VA     +RT 
Sbjct: 175 ELLALAVGAGEGAVGALERVCRLSRG---ELSDELRRCLGDARAGASLPVALHGLADRTG 231

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +      ++ +   GT + D LR    + R E      +        + +P++   L
Sbjct: 232 LMSLTRFVDGIVIAVERGTPLADVLRAQAQDVREEGRRAIMEAGGKKEIAMMIPVVFLVL 291

Query: 308 PVLILVIIGPAILSIIDTM 326
           P+ +L  I P    +  TM
Sbjct: 292 PITVLFAIFPGFSFLNFTM 310


>gi|91775991|ref|YP_545747.1| type II secretion system protein [Methylobacillus flagellatus KT]
 gi|91709978|gb|ABE49906.1| type II secretion system protein [Methylobacillus flagellatus KT]
          Length = 300

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 50/310 (16%), Positives = 124/310 (40%), Gaps = 15/310 (4%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
             +S+  L+   V+  +       R  + A   EI  +++  +L             ++ 
Sbjct: 5   VVISVLGLLAGSVLLLVAEFSKSIRYDAHARFDEIFGRKRRLNLP----------SPARG 54

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
           + + +++L++     D  I+  L  AG++ +  +    V+R     I  +L  +     +
Sbjct: 55  IEHVIERLSILPSSKDPEILKLLVQAGYKGKARVVFNAVIR-----IGPVLTAVGTLLVN 109

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
            +        + + +    + +      +  L  +R+  I +     L +L++  +SG+S
Sbjct: 110 LVQGQDLFHCLASALFGFALFYVGIRYLLRWLAARRRKMISKEITTFLYMLVMLFDSGLS 169

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           ++ +LR + E        L++E+   +A +    ++  A  +      +  +  A   L 
Sbjct: 170 LEHSLRIMVEQASDIMPHLAQELERVLARIRAGQDQGKALMSMSQMLDIPELSEAVAMLK 229

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAI 319
           Q  + G ++ DS+    +     +     ++ + L  K+T+ M+IF  P L++ I GP  
Sbjct: 230 QVAQQGGNVRDSIMRYAALIEERQFSHLRERVSKLSAKMTIVMMIFMFPALMIFIAGPGF 289

Query: 320 LSIIDTMKDH 329
           + +   +   
Sbjct: 290 IGLGKALSGQ 299


>gi|309792339|ref|ZP_07686809.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225654|gb|EFO79412.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 309

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 71/316 (22%), Positives = 141/316 (44%), Gaps = 14/316 (4%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             + +     +++  ++  +V+      E+ +R+ +       L + ++     D     
Sbjct: 7   PTMLILGVVGIAVIGVVIFLVLRMRKPDEISERLNTFTERELTLEELELQQPIMDRIFIP 66

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                  +L  +  K +       E +   L+ AG     +  + + +R+ + ++  +  
Sbjct: 67  AAKAMLATLGKYGAKQS------AERLRTNLQQAGNPGGITPTMFVGLRVGLALVLGL-- 118

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
              +     L        +   ++   +G+  P  W+   ++KR+ SI +A PDALDLL 
Sbjct: 119 ---LITVITLRSMELSQALLYSMIGFVLGYMLPVTWLGQQIKKRKKSITKALPDALDLLC 175

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           I VE+G++ D AL+RV +        LS E    ++++     R+ A ++   RT +D V
Sbjct: 176 ISVEAGLAFDLALQRVTQKWDD---ELSREFKKVLSDIRLGRTRREALKDLGVRTGVDDV 232

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  T A+IQ+D+ G S+   LR+   + R  R   AE+ A     K+  PM+    P L 
Sbjct: 233 QTFTAAVIQADQLGVSMSKILRLQSDQMRQRRRQRAEEAAQQAPIKMLFPMVFLIFPALF 292

Query: 312 LVIIGPAILSIIDTMK 327
           +VI+GPA+  I+++  
Sbjct: 293 VVILGPAVPRIMESFG 308


>gi|192292570|ref|YP_001993175.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
 gi|192286319|gb|ACF02700.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
          Length = 324

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 60/321 (18%), Positives = 122/321 (38%), Gaps = 31/321 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDS 67
            +   LA+    A+++  + +  V P L     +E+R+  VA     +R+   T      
Sbjct: 1   MEMQTLALGFFAAIAVGGVAWVFVYPLLSGEKTVEQRLTFVARSTPTVRQADRTQR---- 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R +   SL+    +   +    +  +  KL  AG   +++     VV   + I  
Sbjct: 57  ---SRREQIEGSLKEIETRNEKQK---NVPLTAKLSQAGL--DWTPGKFGVVSASLGIFM 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L + II            F    G            P   +  L ++R+     A PDA+
Sbjct: 109 LGIAIILGASLPAAAGLGFAAGFGL-----------PRWTLGYLKRRREKRFLAALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ +  +++ VA        PL  E    I   +       A    Y R  
Sbjct: 158 DIIVRGIKAGLPLFDSIKMVA---ADSPEPLRSEFNAIIETQAIGMPIGEACARLYERMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + +A S+  K +   II  L
Sbjct: 215 IPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAA-IIGSL 273

Query: 308 PVLILVIIG---PAILSIIDT 325
           P+++++++    P  +S++ T
Sbjct: 274 PIIVMMLVYVTTPDYISLLWT 294


>gi|227818620|ref|YP_002822591.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|36958876|gb|AAQ87301.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Sinorhizobium fredii NGR234]
 gi|227337619|gb|ACP21838.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 332

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 52/314 (16%), Positives = 106/314 (33%), Gaps = 20/314 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
              +       S +  +++ +     ++        ER     Q   +   D +  R R+
Sbjct: 6   LFPVLIFFLASSFVGGLMLAAFYPRTVKASAYRQRFERVAGHTQINRTGSADESRDRRRS 65

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
            +        ++           +  +LR AG    +S     V      +   +L  + 
Sbjct: 66  VEKTLRDIEEQQKAHVRKGRKPKLEARLRQAGL--GWSTRAYWVACAGTGLAIYVLVALL 123

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
             G              A+      G   P   ++    +R       +P+A+D+++  +
Sbjct: 124 GLG-----------AFAALGFATAGGLYLPHFHVNTTRNRRLKRFTAEFPNAVDVIVRGL 172

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G+ +   LR +A        P+  E L    + +       A E    R  +   R  
Sbjct: 173 KAGLPMTDCLRVIA---AEAQEPVKGEFLTIAHDQTLGLPVDEAVERLCERMPLPEARFF 229

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI--- 311
              +    R G S+ ++L  L    R  + M+A+ KA S   K +   II  LP  +   
Sbjct: 230 AIVITIQSRTGGSLSEALGNLSKVLRERKKMKAKIKAMSAEAKSSAG-IIGALPFFVAGA 288

Query: 312 LVIIGPAILSIIDT 325
           + +  P  +S++ T
Sbjct: 289 VYLTSPDYMSLLFT 302


>gi|86360589|ref|YP_472477.1| putative tadC pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284691|gb|ABC93750.1| putative tadC pilus assembly protein [Rhizobium etli CFN 42]
          Length = 314

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/303 (22%), Positives = 141/303 (46%), Gaps = 5/303 (1%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ-KDSASSRLRTRDSKSLRNF 83
             + +AV+I +  + EL  R + V+V             Q  D+  + L   +++ +R +
Sbjct: 9   LIVFFAVLIFTAAASELFFRQREVSVRVLKSSAAAREEFQLGDTTIADLGEAENRLIRRY 68

Query: 84  VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLE 143
            +    +      +  N+L  AG+ +  ++    VVR V+ I  L+  +  +      + 
Sbjct: 69  FE--ITRRDTNVNSTQNRLIRAGYFAAGAVTTFQVVRAVICIGMLVAAVWAVNRIAPAMS 126

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
                 +   +      F   +++I      ++   +R +PD +D+L++C+++G+SI+ A
Sbjct: 127 Q--MAALIIAMFAAGATFILVNIYIDRRGAAKEREYRRLFPDFMDMLIVCLDAGMSIEAA 184

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
             RVA +   +       + + + E+      + A  N   R ++D  R  +    QS+ 
Sbjct: 185 ANRVAREFVDKQQDFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARALSVLFRQSEE 244

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            GTS+  +LRV  +E R  R++ AE+KA +L  K+ +P+  F  PV +L+++ P I+ ++
Sbjct: 245 LGTSVTQTLRVYSNEMRDLRVVRAEEKANALPVKMLLPLGAFLFPVSLLIVLVPIIMRVV 304

Query: 324 DTM 326
             +
Sbjct: 305 SLL 307


>gi|309778765|ref|ZP_07673538.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308922473|gb|EFP68097.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 329

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/333 (15%), Positives = 121/333 (36%), Gaps = 21/333 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITS------ 62
            D T + +++T A +   +   + + +  +     R    A+           +      
Sbjct: 1   MDETLITLSLTAAAAAVLVFGGLALRATLTRHRSARKLDTALSDMRATAANPAAPAASPV 60

Query: 63  -------LQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
                      S  ++   +    +        L   +V E     L   G+  E++  +
Sbjct: 61  VPPAARPRPHGSREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDRKLLEECGYYGEHARTV 120

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
               R+++P +  + G +                     +   +G+ AP   +    + R
Sbjct: 121 FGGTRILLPPLLAVFGAL--------HASSVLFVFVFGFVGFALGYLAPKWLLGRRKESR 172

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
           +  +    P  +D+L +    G+SIDQ+L+ +A +  G    L+ E      + +    R
Sbjct: 173 RRRMDDELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRANQQFASGRPR 232

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           +            + ++     L Q DR+G ++ + LR      +  R    +++   L 
Sbjct: 233 EQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRRARLKERVGKLT 292

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            ++T+ M++  LP L+++  GP  + ++ +++ 
Sbjct: 293 VQMTMIMVMTLLPALLIITAGPGFMGVMRSLQQ 325


>gi|148976302|ref|ZP_01813026.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
 gi|145964396|gb|EDK29651.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
          Length = 283

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 113/237 (47%), Gaps = 6/237 (2%)

Query: 91  AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
                E+   KL   G  S  +    LV+R  +  I  ++       +   +       +
Sbjct: 51  GFQGQESRRRKLTLIGLGSPNAETYFLVIRFTLMTIGAMI------WHMTQISESDVYSI 104

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
              I I  V        +   V +    I R  PDA+DL++ICV SG++++   R V E+
Sbjct: 105 AECIAIAIVTGILIDRILDWWVNQVLMQISRVVPDAIDLMVICVASGLTLESVFRCVGEE 164

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +   S  LS E LLT  E+S L + Q A  N   R Q+  + N    + Q+ +YGT + D
Sbjct: 165 MRSISPALSREWLLTATEISVLDSPQTALNNLDKRVQLPDINNVVTTMNQALQYGTPLAD 224

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +L+++ S++R    +E E+    +  K++ P+++F +  ++ +II P +L+++ T+ 
Sbjct: 225 ALKLIASDSRQYYFLELEEWVGKIPAKMSFPLVVFIMLPVVAIIIAPIMLNLMQTLG 281


>gi|148655424|ref|YP_001275629.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567534|gb|ABQ89679.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 327

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/320 (11%), Positives = 109/320 (34%), Gaps = 32/320 (10%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D T+L   +   ++I ++   +   S  +   E+R+   A  R   +++           
Sbjct: 6   DPTQLIAPVGIFLAILAVFAFLASRSASNPSYEERLTQFAGRRADQQQRTA--------- 56

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
                   + +   V +               L  A    + ++    +++       L+
Sbjct: 57  ----KEQLREIDKVVAR-----GKRGSETARNLARADL--KLTVTEFYMIK-------LL 98

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
              +       +    ++ ++ + I+   +    P +++    ++R +       D +++
Sbjct: 99  AAGVGAVVGAFIGRASWEAQLLSGIVGFALFSFLPDLYVGYAAKQRVTKFNAQLGDTINM 158

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L   + SG S+ Q++  V+        P + E    + E+      + A +N   R   +
Sbjct: 159 LANSLRSGYSLLQSMELVSR---EAPEPTASEYRRVVQEVGLGLRTEDALDNLLKRVPSE 215

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFL 307
            +     A+      G ++   L  +    R    ++ E    +   +++  +I  +   
Sbjct: 216 DLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIAVLTAQGRISAYVITGLPIG 275

Query: 308 PVLILVIIGPAILSIIDTMK 327
             + + +I P  ++ + +  
Sbjct: 276 LAIFITVINPNYMAPMFSFG 295


>gi|116671481|ref|YP_832414.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611590|gb|ABK04314.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 294

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L        +   L  AG  + + L  +L  +  + ++   L I+           P  
Sbjct: 62  GLAPAAYVRKLDRLLSLAGRPAAWPLGRILAAKPALGLVGASLFILISM------SSPKP 115

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           +   A + + ++G+  P + + +   +RQ +++    + LD +LI VE+G+  + A+ R 
Sbjct: 116 IIKLAGLFLLFLGYFIPDLLLYSKGMERQKAMQLELANTLDQMLISVEAGLGFEGAMARA 175

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            E+  G   PL+EE++ T+ ++    +R+ ++     RT +  +R+  QA++Q+D YG +
Sbjct: 176 GENGKG---PLAEEIIRTLQDMQVGRSRRESYLALAERTNIPELRSFVQAIVQADTYGIA 232

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           I   LR+     R +R   AE+KA  L   +  P++ F  PVL + I+GPA+++ + T  
Sbjct: 233 ISRVLRIQAKVMRVKRRQRAEEKAMKLPVMILFPLLFFIFPVLFIAILGPAVINTVVTFS 292

Query: 328 DH 329
             
Sbjct: 293 GQ 294


>gi|220913395|ref|YP_002488704.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860273|gb|ACL40615.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 294

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 66/277 (23%), Positives = 125/277 (45%), Gaps = 9/277 (3%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           +   +  +T+L    A+   R  D K          L        +   L  AG  +   
Sbjct: 27  DRQGRAAVTNLLARGAAPTARATDYKPSVLEGVGRRLTPPTYVAFLDRLLALAGRPASMP 86

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           L  +L  +L + +  +        G          L   A + + ++G+  P + + +  
Sbjct: 87  LGKVLGTKLALGLAGV------GLGLHLTAIGSTPLMKLAGLFVLFLGYFIPDLLLYSKG 140

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           Q+RQ +++    + LD +LI VE+G+  + A+   A      + PL+EE++ T+ ++   
Sbjct: 141 QERQKTMQLELANTLDQMLISVEAGLGFEGAM---ARAGDNGNGPLAEELVRTLQDMQVG 197

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +R+ ++     RT +  +R+  QA++Q+D YG +I   LRV     R +R   AE+KA 
Sbjct: 198 RSRRESYTALAARTSIPELRSFVQAVVQADTYGIAISRVLRVQAKVMRVKRRQRAEEKAM 257

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
            L   +  P++ F  PVL + I+GPA+++ + T    
Sbjct: 258 KLPVMILFPLLFFIFPVLFIAILGPAVINTVVTFTGQ 294


>gi|220913151|ref|YP_002488460.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860029|gb|ACL40371.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 312

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 55/313 (17%), Positives = 112/313 (35%), Gaps = 10/313 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVERE-ILRKQQITSLQKDSASSRLR 73
            + ++ A ++   +  + +  +       R  ++A   E  L+ Q + S       +   
Sbjct: 1   MITVSPAAAVCGAVLGIGLWLVIFRSPIMRATTLAQRIEPQLKSQNLESRLLSGEHTLTP 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDE----NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
               + +     +  + A+            +L  AG     S+      +++       
Sbjct: 61  FGPLERILRPFIRDGIAALGKMSPAPGATARRLAQAGI--NKSVIDFRAEQVIWAAAGFA 118

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           L    +        +   L   A+I  G  GF     W+   V++R+  +   +P   +L
Sbjct: 119 LTSAIVAVGAAAGRFNALLAAVAIIGSGISGFIVRDYWLGVQVRRREERMMAEFPSLAEL 178

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + + V +G S   AL RV     G    LS+E    +AE         A + F  RT + 
Sbjct: 179 MALAVGAGESATGALDRVCRSARG---ELSKEFSTILAETRAGKPLVNALQEFSARTDLA 235

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +      ++ +   GT + D LR    + R     +  + A      + VP++   LP+
Sbjct: 236 PLVRFVDGIVVAVERGTPLADVLRAQAQDVRDTAKRDLMEAAGKKEIAMMVPLVFGVLPL 295

Query: 310 LILVIIGPAILSI 322
            ++  + P I +I
Sbjct: 296 TVVFAVFPGISAI 308


>gi|262164953|ref|ZP_06032691.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
 gi|262027333|gb|EEY46000.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
          Length = 291

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 61/278 (21%), Positives = 118/278 (42%), Gaps = 5/278 (1%)

Query: 47  SVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAG 106
           S+ +    LR    T     +      TR+ K+   FV  L        +    KL  +G
Sbjct: 17  SLVITHFALRSWDRTKATISTRKIIGSTREEKNRFEFVYSLLNMVSFNQDETKKKLVKSG 76

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
             +++      + +++ P        I  F   K  E    + +    ++  +G   P +
Sbjct: 77  IYNQFIARSYYLFKII-PFGLCAFFSILAFLSGKTDETMLVVSLAIGAIVFLLG---PDM 132

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           +I+   +K    I    P  LDL+ +CV +G++I+  L  +A ++      L+  +  T+
Sbjct: 133 YIAARGKKITKKISSRLPFLLDLMNVCVHTGMTIEACLEYLAFELRTVDHHLAYVVKKTV 192

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
                    + A   FY+       ++    + QS +YG+SIG  L  L S+ R   +M+
Sbjct: 193 ERSKL-VGLEKALNEFYDLVPTAEAQSFVMTMTQSLKYGSSIGPVLATLASDIREMNMMD 251

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
            E+K   +G K+++P+I F +  +I++I  P I+ +  
Sbjct: 252 LEEKIGKMGAKMSIPLIAFIMVPIIILIAAPGIMRMFS 289


>gi|134295599|ref|YP_001119334.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134138756|gb|ABO54499.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 330

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 62/294 (21%), Positives = 116/294 (39%), Gaps = 8/294 (2%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL---NLKAILVD 95
             LE+RM ++   R           Q+ +       R    L     +L        +V 
Sbjct: 41  DALERRMAALEAARTRTAPDDGAGTQQVARGRERIERMLSRLAAAGMRLLDTGFGKHIVA 100

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E     L   G+    +  + L  RLV  I   +L  I   G  K   +        +  
Sbjct: 101 EEDRRLLEQCGYVDARTRGLFLSARLVCGITVPLLFAILASGRMKGGYWT-----IGMFA 155

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
              VGF  P +++      R+ S+    P  +D+L +    G+S+DQ+L+ V  D  G  
Sbjct: 156 AFSVGFMLPKLYVQRRAAARRQSVIDELPLFVDMLRLLQGVGLSLDQSLQVVTNDFRGMM 215

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             LS E+ +   + +    R  + +   +    + +R   + ++Q D++G ++ + L+  
Sbjct: 216 PVLSSEVGIAQRQFAAGRTRDQSMQRLSSGFDNEDLRAIARLMVQVDKHGGAVQEPLKQF 275

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329
               R  R      +   L  K+T  M++  LP L++V  GP +L+++  +  H
Sbjct: 276 GDRLRETRRAMLRDRIGRLTVKMTGVMVVTLLPALLIVTAGPGLLAVMRALAVH 329


>gi|150398545|ref|YP_001329012.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150030060|gb|ABR62177.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 336

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/290 (17%), Positives = 109/290 (37%), Gaps = 21/290 (7%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENI 98
            + E R+  V+   E  R +   +  + +  S+ R     SL+   KK   K+     ++
Sbjct: 35  KKTEGRLLRVSAA-ETDRTKIKAARDRVNEMSKRRKSVQDSLKELEKKQQEKSANSAPSM 93

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
             +L  A      S+    +   +  +   ++  +   G             G       
Sbjct: 94  KKRLLQANL--SISVAQFYLFSALFGLFTFVVVFLAGAGALIAAGVGLTAAAG------- 144

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
                P   + + +++R       +P+ALD+++  ++SG+ ++ ALR +A        P+
Sbjct: 145 ----LPRWIVGSRIKRRCRKFLDEFPNALDVMVRSIKSGLPLNDALRLIAS---DGQEPV 197

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E    +       N   A     +   +  V      +    + G ++ ++L  L   
Sbjct: 198 RTEFRRVVESQQVGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKV 257

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
            R  R M+A+  A S+  K +   II  LP ++  ++    PA ++I+ T
Sbjct: 258 LRERRKMKAKVNALSMEAKASA-CIIGALPFIVATLVYLTSPAYMAILFT 306


>gi|117617658|ref|YP_855996.1| Flp pilus assembly protein TadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559065|gb|ABK36013.1| Flp pilus assembly protein TadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 294

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/283 (20%), Positives = 128/283 (45%), Gaps = 4/283 (1%)

Query: 45  MKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRA 104
           + + A      ++QQ  +  +     R     ++   ++  +           +   L  
Sbjct: 16  LAAFAGWHGYRQQQQWLAQSRRYGPPRQGREVARDWLSWCGRGYPVGAREQARLQQLLAQ 75

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG  S +  + L   +L+  +   +  ++W         +     +  V++   VG   P
Sbjct: 76  AGIFSRHGFDRLRAAKLLGGLGGAMAVLLWRLLAAPADGFT----LMWVLVAYVVGAGVP 131

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
             W+    +K +++ ++  PDA+DLL+I VE+G+++D+AL RV   +G     L+ + L 
Sbjct: 132 ERWLQWRARKVKAAQQKVVPDAIDLLVISVEAGLALDRALLRVGHYLGALEPGLARQFLR 191

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           T AE+    ++         RT +  +      L  + +YG+ + +++R +  E R  R 
Sbjct: 192 THAEIQMRGDQAGCLARLAWRTGLPELDRLANTLQMAQQYGSPLAETMRTISQEARQMRR 251

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +  E++A SL  K+T+  +   +  ++++II P +  +I++++
Sbjct: 252 LALEEQAGSLPGKITLIQMALIMLPMLVLIIAPTLNLLINSLR 294


>gi|153833197|ref|ZP_01985864.1| bipartite nuclear localization signal containing protein [Vibrio
           harveyi HY01]
 gi|156977404|ref|YP_001448310.1| hypothetical protein VIBHAR_06191 [Vibrio harveyi ATCC BAA-1116]
 gi|148870468|gb|EDL69383.1| bipartite nuclear localization signal containing protein [Vibrio
           harveyi HY01]
 gi|156528998|gb|ABU74083.1| hypothetical protein VIBHAR_06191 [Vibrio harveyi ATCC BAA-1116]
          Length = 280

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/263 (18%), Positives = 107/263 (40%), Gaps = 9/263 (3%)

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            T  ++   +  +     +S     +          + +  K+  AG+ +          
Sbjct: 23  RTEQRRKKIALYVGGNAHRSPSRVNRFFVRFGKEHRQELEQKMIEAGYYNTEWAKFYFPA 82

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +       L+LG++  F     +    QL V    LI  +    P   +    +      
Sbjct: 83  K------LLVLGLVSGFVLLSDMTQSNQLIVITFTLIAVI--VGPDSLLQMRRKILIRKT 134

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
               P  LD++ +CV++G++I+ AL  + +++      L  ++  T          + A 
Sbjct: 135 SAQLPYLLDMMSVCVQTGMTIEAALVYLGKELAEFDSDLCYQIKRTSDSAKI-HGLEKAL 193

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
            +   R     +R+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K++
Sbjct: 194 NDLSERIPTPPIRSFVLTIIQNLQYGTSVAQVLSDLAEDMRKVQILTVEEKVGKLSAKMS 253

Query: 300 VPMIIFFLPVLILVIIGPAILSI 322
           VP+I+F +  ++++I+ P I+ +
Sbjct: 254 VPLILFIMFPIVILILAPGIMQM 276


>gi|222084473|ref|YP_002543002.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721921|gb|ACM25077.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 335

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/319 (17%), Positives = 129/319 (40%), Gaps = 21/319 (6%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D   L + +  AVS  ++ Y V+   + + +      S     E  R +   +  +    
Sbjct: 5   DPVVLLIVVLAAVSAAAVCYGVLYSQIEAQKKTDSRVSRVKAAESDRTKVKVARDRVQEM 64

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
           S+ R     +L++ ++K  ++     +++  +L  AG     +     V  ++  +  ++
Sbjct: 65  SKRRKSVQDTLKD-LEKRQVENTKKKQSLKARLVQAGL--SLTPARFYVFSVLFGLFVMV 121

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +  ++      +   PF              F  P   +  L+++RQ+     +P+ALDL
Sbjct: 122 VAFLFGAPLAVIAGLPF-----------AAAFGLPRWVVGFLIKRRQNKFLEEFPNALDL 170

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +   + SG+ ++ A+R VA +      P+  E    +       +   A     N   + 
Sbjct: 171 ITRSIRSGLPLNDAVRLVASEARE---PVRTEFRRVVETQQVGLSMTDACARMNNHMPLQ 227

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            V   +  +    + G ++ ++L  L    R  + M+A+  A S+  K +  +II  LP 
Sbjct: 228 EVNFFSIVIAIQAQAGGNLSEALGNLAKVLRERKKMKAKVVALSMEAKASA-VIIGALPF 286

Query: 310 LILVII---GPAILSIIDT 325
           ++++++    P  + I+ T
Sbjct: 287 IVMLLVYLTSPQYMMILFT 305


>gi|116671217|ref|YP_832150.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611326|gb|ABK04050.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 313

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/290 (18%), Positives = 108/290 (37%), Gaps = 6/290 (2%)

Query: 33  IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAI 92
           +P +      +R++     + +  K  + S    +    L       L+  +  L  +  
Sbjct: 26  LPFMRPMSFAERIEPQLKSQNLESKLLLASTDNLTPFGPLELILRPMLKEGLSVLA-RFN 84

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
           L    +  +L  AG R   S+      +L+  ++  +L    I       ++     V A
Sbjct: 85  LGSSALSRRLAQAGVR--KSVVDFRAEQLLWAVLGFVLATGLILVGAASGQFNPFFAVVA 142

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+     GF      + + +++R+  +   +P   +L+ + V +G S   AL RV     
Sbjct: 143 VLGSALGGFLFRDYCLGSQIKRREKLMMAEFPSLAELMALAVSAGESATGALDRVCR--- 199

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                L+ E  L + E         A + F  RT +  +      +I +   GT + D L
Sbjct: 200 SSHGELAREFELVLGETRAGKPLVEALQRFSARTDLGPLVRFVDGIIVAVERGTPLADVL 259

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
           R    + R     +  + A      + VP++   LP+ ++  + P + +I
Sbjct: 260 RAQAQDVRDTAKRDLMESAGKKEIAMMVPLVFGVLPLTVIFAVFPGLAAI 309


>gi|167738668|ref|ZP_02411442.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 14]
          Length = 253

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 131/254 (51%), Gaps = 1/254 (0%)

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
           R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV     +  +  
Sbjct: 1   RVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALAL 60

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PDALDLL+IC 
Sbjct: 61  GAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICT 119

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G S+  A+RRVA ++     PL++E  +   EL    +   A      R  +  +R  
Sbjct: 120 NAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRAL 179

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+ 
Sbjct: 180 VTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIA 239

Query: 315 IGPAILSIIDTMKD 328
            GPA++ +I     
Sbjct: 240 AGPAVIRLIAVFHK 253


>gi|170692559|ref|ZP_02883721.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170142215|gb|EDT10381.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 318

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 81/298 (27%), Positives = 146/298 (48%), Gaps = 8/298 (2%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
              ++  L   ++++R+       E      ++   + SA S    R +   R   +   
Sbjct: 23  VVALMWWLMPRDMQRRI-------EQAGGVSLSPEARPSAVSGWAERIADISRPISQLSI 75

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
            K    D  +  +L  AG+RS  +  +    +  + ++  +LG+     +   +   + +
Sbjct: 76  PKEGWEDSPLRLRLMNAGWRSSTAAGLYFAAKTALALLLPLLGL-VALTHMPSINTDYTV 134

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
               + L+   G+  P+  ++    +RQ  I  ++PDALDLL +CVE+G+ +D AL RVA
Sbjct: 135 IALILALLAAFGYYVPNAVLARCRARRQRRIVESFPDALDLLTVCVEAGLGMDAALMRVA 194

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
           +++   S  ++ E+ L + EL     ++ A  NF  RT  + +      L+Q++R+GTSI
Sbjct: 195 DEMTLASPEVANELQLMLLELRSGFTKEKALRNFALRTGAEDIDTFASMLVQAERFGTSI 254

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           G SLRV+    R+ R M AE++AA +  KL  P+I    P L+ V+IGPA + I   +
Sbjct: 255 GASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIFCIFPALMTVLIGPAFIHIYRVL 312


>gi|319940445|ref|ZP_08014790.1| hypothetical protein HMPREF9464_00009 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806071|gb|EFW02820.1| hypothetical protein HMPREF9464_00009 [Sutterella wadsworthensis
           3_1_45B]
          Length = 303

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 61/309 (19%), Positives = 144/309 (46%), Gaps = 8/309 (2%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           + T + +F+L    ++  + +   ++  +++         ++  +    +          
Sbjct: 1   MITWIIVFALALLSIVVFVFALRSQQDAEALEDRLAGTIDEEAAAHPHQAGGIEPLPEWI 60

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           + +  F  KL        E     L  AGF    SL + L+++ ++ +            
Sbjct: 61  QPVARFGLKLAGNDKSR-ETTALLLAQAGFARPGSLGVFLLLKTLLGLGIAAALFF---- 115

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
                +      +  +    + G   P   + ++  +R ++++R+ PDALDL++IC E+G
Sbjct: 116 ---GTQERSIGTIALMGAGYFAGGILPEWVLKSMAARRYTALERSMPDALDLMVICAEAG 172

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           +   + ++ V+ ++   +  L+ E+ LT AEL  +P R  A  N   RT++  +      
Sbjct: 173 LPFTRIVKVVSRELELSAPVLAHELTLTNAELEIMPERSAALRNLAERTRVPSIEGMVST 232

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           LIQ++++GT +  +L  + +E+RS  ++  E++A  L  +L++P++   LP ++ ++  P
Sbjct: 233 LIQAEQFGTPLAQALHNIAAESRSTLILTLEERAGKLPARLSLPLMTLILPPVVAIVAAP 292

Query: 318 AILSIIDTM 326
           A++ +I ++
Sbjct: 293 ALMRVIRSL 301


>gi|323529408|ref|YP_004231560.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386410|gb|ADX58500.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 319

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 82/322 (25%), Positives = 150/322 (46%), Gaps = 9/322 (2%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
                D+  + +     ++ F+ + AV+               +    E      +    
Sbjct: 1   MMQTLDSANMLLLGGVFLAAFAAVVAVMWWMTPRD--------MQRRIEQAGGVSLAPEA 52

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
             + +S    + +   R   +    K    D  +  +L  AG+RS  +  +    + V+ 
Sbjct: 53  PSAVASGWAEKIADMSRPISQLSIPKEGWEDSPLRLRLMNAGWRSSTAAALYFAAKTVLA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           ++  +LG+  +     +    F +    + ++  +G+  P+  ++    +RQ +I   +P
Sbjct: 113 LLLPLLGLAALMQMPSVNGQ-FAVSALILAMLAAIGYYVPNAVLARCRARRQRAIVEGFP 171

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
           DALDLL +CVE+G+ +D AL RVA ++   S  ++ E+ L + EL     ++ A  NF  
Sbjct: 172 DALDLLTVCVEAGLGMDAALMRVAGEMQLASPEVASELQLMLLELRSGFTKEKALRNFAL 231

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           RT +D +      L+Q+DR+GTSIG SLRV+    R+ R M AE++AA +  KL  P+I 
Sbjct: 232 RTGVDDIDTFASMLVQADRFGTSIGASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIF 291

Query: 305 FFLPVLILVIIGPAILSIIDTM 326
              P L+ V++GPA + I   +
Sbjct: 292 CIFPALMTVLMGPAFIHIYRVL 313


>gi|54309665|ref|YP_130685.1| Flp pilus assembly protein TadC [Photobacterium profundum SS9]
 gi|46914103|emb|CAG20883.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum SS9]
          Length = 283

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 106/262 (40%), Gaps = 9/262 (3%)

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
              ++    S L  +    L    + +        +++  +   AGF +       +  +
Sbjct: 25  EQAKQAHVESYLSAKKDGRLTRLNRFITHLGKNHQQDLEQQFVDAGFYNTQFTKYYVPAK 84

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           L +        +I+      + +  F  +     +        P + +S   +       
Sbjct: 85  LTL--------VIFTCVVVLMSDLSFTNQAAIGAVAMIAILLVPEMVLSMRKKALILKTS 136

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           R  P  LD++ +CV++G++I+ AL  ++ ++      L   +  T          + A  
Sbjct: 137 RQLPYMLDMMSVCVQTGMTIEAALTYLSTELEAFDRDLCFHIKKTADSARV-KGLEKALI 195

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               R     VR+ T  LIQ+ +YGTSI + L  L  + R  +++  E+K   L  K++V
Sbjct: 196 ELSERIPTPDVRSFTLTLIQNLQYGTSIANVLSALAEDMRKMQVLTMEEKIGKLAAKMSV 255

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           P+I+  +  ++++I+ P ++ +
Sbjct: 256 PLILLIMFPIVILILAPGMMQM 277


>gi|167821658|ref|ZP_02453338.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 91]
          Length = 266

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 72/262 (27%), Positives = 133/262 (50%), Gaps = 1/262 (0%)

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
            A   +  R ++ + +  +++ +        +  +L +AGFR   +++++  ++LVV   
Sbjct: 6   RAGRSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGAC 65

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             +  +       ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PDA
Sbjct: 66  AGLAALALGAHVPRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPDA 124

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           LDLL+IC  +G S+  A+RRVA ++     PL++E  +   EL    +   A      R 
Sbjct: 125 LDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAARI 184

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
            +  +R     L+QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F 
Sbjct: 185 GLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFV 244

Query: 307 LPVLILVIIGPAILSIIDTMKD 328
           +P + L+  GPA++ +I     
Sbjct: 245 MPTVALIAAGPAVIRLIAVFHK 266


>gi|221070078|ref|ZP_03546183.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220715101|gb|EED70469.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 317

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 63/321 (19%), Positives = 128/321 (39%), Gaps = 10/321 (3%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            + + L + ++ A    + +   ++ +      E+  K V             +    S 
Sbjct: 1   METSRLLLMLSVAFLALAALIGAILIAYAHQRRERSSKVVQDALSRSGAAAANTTAVLSK 60

Query: 69  SSRLRTRDSKS--LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
            + L    +    L       +    LV +     L   G+ S  +    L+ R      
Sbjct: 61  PADLLRSLNGDGDLPAHWLNTSFGKALVAQEDRILLSKCGWGSTRAQLQYLLARC----- 115

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
              +  + +      +    +  +  +     +GF  P   + ++ ++R++S+ R  P  
Sbjct: 116 ---VVSVLLLLLAAFVFSGSKHFLLYLFAAFTIGFLLPKWVLRSVARRRRASVARELPLL 172

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +DLL +   +G+S+DQ L+ +  D G     LS E+ L   + S    R+ +F       
Sbjct: 173 VDLLGLLQGTGMSLDQTLQVIGSDFGNVMPVLSREIQLANQQYSRGGTRERSFARMSEVY 232

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
           Q D + N T  + Q DRYG ++ + LR+     R +R  + ++    +  K+T  M++  
Sbjct: 233 QSDNLANLTSLMTQIDRYGGAVQEPLRIFGERLREQRKAKMKEMIGKISVKMTGVMVLTL 292

Query: 307 LPVLILVIIGPAILSIIDTMK 327
           LP LI+V  GP  L+++  + 
Sbjct: 293 LPALIIVTAGPGFLAVMKALG 313


>gi|167719676|ref|ZP_02402912.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei DM98]
          Length = 249

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 70/250 (28%), Positives = 128/250 (51%), Gaps = 1/250 (0%)

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
            + +  +++ +        +  +L +AGFR   +++++  ++LVV     +  +      
Sbjct: 1   RVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHV 60

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
            ++ +Y   LRV  +     +G   P   +  ++ +RQ +I    PDALDLL+IC  +G 
Sbjct: 61  PRVGDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGN 119

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+  A+RRVA ++     PL++E  +   EL    +   A      R  +  +R     L
Sbjct: 120 SLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTL 179

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           +QS +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA
Sbjct: 180 VQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPA 239

Query: 319 ILSIIDTMKD 328
           ++ +I     
Sbjct: 240 VIRLIAVFHK 249


>gi|94497257|ref|ZP_01303829.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
 gi|94423362|gb|EAT08391.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
          Length = 332

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 61/298 (20%), Positives = 119/298 (39%), Gaps = 22/298 (7%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           I  AV + +++  V +   G    + R + VA  R    +     L+      R+R   S
Sbjct: 6   ILIAVLLAAMLGMVAMAFAGPSPEKARKRRVATIRGRHGESAEALLEA-----RMRRAIS 60

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
                   K+ +  +   +N+  +++  G   +++L+  +    ++ ++   L  +  F 
Sbjct: 61  NRPTGAEAKMLVSLVPNPDNLTKRIKMTG--KKWTLSQYMTACAIIFLLITALLALRGFP 118

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
           +             A+++    G   P  W+  L+ KR S     +PDAL+LL   + SG
Sbjct: 119 F-----------FFAMLVGAAAGLGLPHWWVGRLITKRVSQFNAKFPDALELLTRGLRSG 167

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           + I + L  V+ +I G   P+ EE  L    +      + A +   +R      +     
Sbjct: 168 LPIAETLGVVSNEIPG---PVGEEFKLITERIKIGRTMEQALQETADRLGTAEFQFFVIT 224

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           L      G ++ ++L  L +  R    M+ + +A S   K +   II  LP L+  +I
Sbjct: 225 LSIQRETGGNLAETLSNLATVLRQRSQMKLKIRAMSSESKASA-YIIGVLPFLVFGMI 281


>gi|84385679|ref|ZP_00988710.1| hypothetical Flp pilus assembly protein TadC [Vibrio splendidus
           12B01]
 gi|84379659|gb|EAP96511.1| hypothetical Flp pilus assembly protein TadC [Vibrio splendidus
           12B01]
          Length = 280

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/245 (18%), Positives = 100/245 (40%), Gaps = 9/245 (3%)

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           ++     +            +  K+  AG+ +          +        +L +  + G
Sbjct: 41  RAPSRVNRFFVRFGKEHRHELEQKMIEAGYYNTDWAKFYFPAK--------LLVLALVSG 92

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              L +     ++  VI         P   +    +   S      P  LD++ +CV++G
Sbjct: 93  LVLLGDMTSTNKLLVVIFSLIGVIVVPDTMLQMRRKMLISRTSAQLPYLLDMMSVCVQTG 152

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++I+ AL  + +++      L  ++  T          + A  +   R     VR+    
Sbjct: 153 MTIEAALVYLGKELAEFDSDLCYQIKRTSDSAKI-HGLEKALNDLSERIPTPPVRSFVLT 211

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K++VP+I+F +  ++++I+ P
Sbjct: 212 IIQNLQYGTSVASVLSDLAEDMRKVQILTVEEKVGKLSAKMSVPLILFIMFPIVILILAP 271

Query: 318 AILSI 322
           +I+ +
Sbjct: 272 SIMQM 276


>gi|299069494|emb|CBJ40763.1| Type II secretion system protein [Ralstonia solanacearum CMR15]
          Length = 324

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/327 (16%), Positives = 127/327 (38%), Gaps = 21/327 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVI--PSLGSGELEKRMKSVAVEREILRKQQITSLQKD 66
            D + L +++T A +   +   + +    +    + K   +++  R    +    +    
Sbjct: 1   MDDSLLTLSLTAATAGLLVFGGIAVHAVLMRYRSVRKLDTALSDVRAAGTQAAAPAGVPV 60

Query: 67  SASSRLRTRDSKSLRNFVKKLN-------LKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
              +      ++ L+  V K+        L   +V E     L   G+  E +  +    
Sbjct: 61  PVPAPKPRPQAQQLQQQVAKVGQRWIDTGLGHRIVTEEDRKLLEECGYYGEQARTVFGGT 120

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           R+++P    ++G+++           F+  +        +G+ AP   ++     R+  +
Sbjct: 121 RILLPPFLCVVGVLYA--------ASFREALLCGFAGFALGYLAPKWLLARRKASRRHRL 172

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
               P  +D+L +    G+SIDQ+L+ +A +  G    L++E      + +    R+   
Sbjct: 173 DDELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLADEFGRANQQFASGRPREQTL 232

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
                    + ++     L Q DR+G ++ + LR      +  R    +++   L  K+T
Sbjct: 233 LRISRLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGLRLQENRRSRLKERVGKLTVKMT 292

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTM 326
           V M++  L    ++  GP  +S+  ++
Sbjct: 293 VVMVLTLL----IITAGPGFMSVTRSL 315


>gi|28900581|ref|NP_800236.1| putative TadC protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365461|ref|ZP_05777998.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|260877526|ref|ZP_05889881.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|260897533|ref|ZP_05906029.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|260901735|ref|ZP_05910130.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|28808961|dbj|BAC62069.1| putative TadC [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087116|gb|EFO36811.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus Peru-466]
 gi|308090674|gb|EFO40369.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AN-5034]
 gi|308108821|gb|EFO46361.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ4037]
 gi|308114358|gb|EFO51898.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus K5030]
 gi|328470523|gb|EGF41434.1| putative TadC protein [Vibrio parahaemolyticus 10329]
          Length = 288

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 110/251 (43%), Gaps = 9/251 (3%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           +T     L   + +L+       E   N L  AG  SE+      +++++     L+  +
Sbjct: 46  KTPFVDKLSLHLSRLSFNK----EETKNNLVRAGIHSEFIAQAYYLLKIIP----LVFCL 97

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            +I       E  F     +  L   V   AP ++IS+        +    P  LDL+ +
Sbjct: 98  AFIGYSYIQGEMEFSSAFISFSLSMLVCLIAPDMYISSRGNANVRHVSSRLPFLLDLMNV 157

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CV +G++++ +L  ++ ++      L+  +  T            A   FY+       +
Sbjct: 158 CVHTGMTLEASLDYLSNELKTVDENLAYVVKKTSERAKI-VGLDRALTEFYDLVPTTEAQ 216

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    L QS +YG+S+G  L  L S+ R   ++E E+K   +G K+++PMI F +  +++
Sbjct: 217 SFVMTLTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSIPMIAFIMIPIVV 276

Query: 313 VIIGPAILSII 323
           +I  P I+ ++
Sbjct: 277 LIAAPGIMRML 287


>gi|167824262|ref|ZP_02455733.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 9]
 gi|167919042|ref|ZP_02506133.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei BCC215]
          Length = 246

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 127/247 (51%), Gaps = 1/247 (0%)

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
           +  +++ +        +  +L +AGFR   +++++  ++LVV     +  +       ++
Sbjct: 1   SLGERVPVVDATQRMKLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRV 60

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
            +Y   LRV  +     +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+ 
Sbjct: 61  GDY-VVLRVLMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLA 119

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            A+RRVA ++     PL++E  +   EL    +   A      R  +  +R     L+QS
Sbjct: 120 VAIRRVASELKTICPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQS 179

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            +YGT I  SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ 
Sbjct: 180 QQYGTPITQSLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIR 239

Query: 322 IIDTMKD 328
           +I     
Sbjct: 240 LIAVFHK 246


>gi|153836407|ref|ZP_01989074.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
 gi|149750309|gb|EDM61054.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus AQ3810]
          Length = 288

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 110/251 (43%), Gaps = 9/251 (3%)

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
           +T     L   + +L+       E   N L  AG  SE+      +++++     L+  +
Sbjct: 46  KTPFIDKLSLHLSRLSFNK----EETKNNLVRAGIHSEFIAQAYYLLKIIP----LVFCL 97

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
            +I       E  F     +  L   V   AP ++IS+        +    P  LDL+ +
Sbjct: 98  AFIGYSYIQGEMEFSSAFISFSLSMLVCLIAPDMYISSRGNANVRHVSSRLPFLLDLMNV 157

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CV +G++++ +L  ++ ++      L+  +  T            A   FY+       +
Sbjct: 158 CVHTGMTLEASLDYLSNELKTVDENLAYVVKKTSERAKI-VGLDRALTEFYDLVPTTEAQ 216

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    L QS +YG+S+G  L  L S+ R   ++E E+K   +G K+++PMI F +  +++
Sbjct: 217 SFVMTLTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSIPMIAFIMIPIVV 276

Query: 313 VIIGPAILSII 323
           +I  P I+ ++
Sbjct: 277 LIAAPGIMRML 287


>gi|27378607|ref|NP_770136.1| hypothetical protein blr3496 [Bradyrhizobium japonicum USDA 110]
 gi|27351755|dbj|BAC48761.1| blr3496 [Bradyrhizobium japonicum USDA 110]
          Length = 302

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 66/300 (22%), Positives = 139/300 (46%), Gaps = 7/300 (2%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
             +V  ++ +G     +    +    +  +   ++   +  +      +        +  
Sbjct: 5   LGLVALAVAAGSATSLLIIREIHIRTVDARVANAVMGGAGGATPFQDVTGWFSWLGTRYR 64

Query: 89  -LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
              A    + +   L+++GF    +L   + V+ V   +  I+         +L      
Sbjct: 65  RFYAEENLDQLRTILQSSGFNHRRALPTWIGVKAVAMFLCPIIAGCVA----QLFAKSMT 120

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             +   ++   VG   P + ++ L ++  ++I+   PD +DLL++C E+G+ ++  L RV
Sbjct: 121 DVLVFTLMGVMVGILGPRLILAVLKRRFDAAIRVGTPDMIDLLVVCSEAGMGLESGLARV 180

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A+++   + P++  +   + +L  LPNR  AF+     T  D +R     + QS +YGT 
Sbjct: 181 AQEMSETNPPMARVLHCLLDDLRILPNRSDAFDKLG--TTSDGLRRFGTMVAQSLQYGTP 238

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +G +LR +  + R ER+ + E++A  LG KLT+PM++F LP + +V+ G  IL ++ +  
Sbjct: 239 VGQALRNIAVDLRRERITKLEERAHKLGAKLTIPMVLFLLPAMFVVLGGSPILHLVRSFA 298


>gi|283778864|ref|YP_003369619.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437317|gb|ADB15759.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 361

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 65/333 (19%), Positives = 126/333 (37%), Gaps = 33/333 (9%)

Query: 5   FFDLFDATELAVAITTA----------VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREI 54
             DL    +L +    A          V++   + A+V+       + KR K VAVER  
Sbjct: 1   MQDLIQQVQLWLFTIGAPAWLQRPGSWVALGCGLLALVLVI---RMILKRTKQVAVER-- 55

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
                                   SL   +      +          LR AGF S  ++ 
Sbjct: 56  -------------GLEPEAGGVFGSLTPALAAQIPGSEKERTEFAAMLRQAGFYSRTAMA 102

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
            +   R ++ +  L+   +      +   +     +     I       P ++I    +K
Sbjct: 103 SVYAYRFLLLVFPLVCAGLIAIFSPRSQTFRI---LFVGAFIAIALSIIPRLYIFFRRRK 159

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R + I     D LD+L +C+  G+ +  +L  VA+++      L++E+L+   +     +
Sbjct: 160 RLTEINNGLADMLDMLGMCLSGGMPLSASLDHVAKNL-TNYPALADELLIMKRQAEV-SS 217

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
            + A  +F NR     VR     L + D+ G+SI  +L       R+ R   A  +A   
Sbjct: 218 LKHALADFANRLDTPEVRQVASLLSRGDQLGSSISRNLLDQADHFRTARRQMATMQANRT 277

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
              LT P++  F P ++++++ P+ + + + + 
Sbjct: 278 PVFLTFPLMFCFAPAVLILLMSPSFMQLSEFLS 310


>gi|296158799|ref|ZP_06841628.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891004|gb|EFG70793.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 336

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 60/278 (21%), Positives = 112/278 (40%), Gaps = 6/278 (2%)

Query: 50  VEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRS 109
            E      +      + +    L  R + +   ++        +V E     L   GF  
Sbjct: 61  GEGSQSGARAAARSVQPTGLKGLLERFAHTGIRWLD-TPFGRQIVAEEDRRLLEQCGFVD 119

Query: 110 EYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWIS 169
             +  + LV RLV  ++  +L      G  +   Y     V  VI+    GF  P   + 
Sbjct: 120 TRTRGLFLVARLVGALVLPVLAGTLTRGQLEGPRY-----VALVIIAAMAGFMLPKFALR 174

Query: 170 NLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAEL 229
               KR++ +    P  +DLL +    G+S+DQ+L+ V  D  G    L+ E+ +   + 
Sbjct: 175 RRAGKRRNGVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFRGMLPVLAGELEIAQRQF 234

Query: 230 SFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEK 289
           +    R+ +          + +R   + L+Q DR+G ++ + L+      R  R     +
Sbjct: 235 AAGRTREQSLNRLATSYDNEDLRAVMRLLVQVDRHGGAVQEPLKQFGDRLRETRRAMLRE 294

Query: 290 KAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +   L  K+T  MI+  LP L++V  GP +L++  ++ 
Sbjct: 295 RIGRLAVKMTGVMIVTLLPALMIVTAGPGVLAVQHSLG 332


>gi|209546474|ref|YP_002278392.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537718|gb|ACI57652.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 314

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 123/304 (40%), Gaps = 10/304 (3%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            ++E  + +    ++     A         E+  R+   +           T++     +
Sbjct: 1   MSSEYGIYLIVFFAVLIFTAAASELFFRQREVSVRVSKSSATAREEFHLGDTTIADLGEA 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
                R    +      +N        +  N+L  AG+ +  ++     VR    +   +
Sbjct: 61  ENRLIRRYFEITRRDTNVN--------STQNRLIRAGYFAAGAVTTFQAVRA--AVCIGV 110

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +  +       + +      + A +      F   +++I      ++   +R +PD +D+
Sbjct: 111 MVSMVWTLNWVVPDMSGVATLIAAMFAAGSTFILVNIYIDRRGAAKEREYRRLFPDFMDM 170

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L++C+++G+SI+ A  RVA +   +       + + + E+      + A  N   R ++D
Sbjct: 171 LIVCLDAGMSIEAAANRVAREFVDKRQDFGLHLSIMMLEVRGGRRLREALANLAIRLRID 230

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
             R  +    QS+  GTS+  +LRV   E R  R++ AE+KA +L  K+ +P+  F  PV
Sbjct: 231 EARALSVLFRQSEELGTSVTQTLRVYCKEMRDIRIVRAEEKANALPVKMLLPLGAFLFPV 290

Query: 310 LILV 313
            +++
Sbjct: 291 SLII 294


>gi|148655544|ref|YP_001275749.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567654|gb|ABQ89799.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 299

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 70/314 (22%), Positives = 136/314 (43%), Gaps = 23/314 (7%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             + +++   +++      +           +R+++   E +I +   +      S  +R
Sbjct: 1   MSVVISVMAIIAVELFFAGL-----------RRIRTPGYEAQIAQYGSLAHTGPRSRYAR 49

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                +  L + V    L+ +   E     L  AG  +  +++    V+L   +  L++G
Sbjct: 50  WVRPYALRLASNVT--ALRGLTDFEKTARMLDYAGNPAGMTVHEFHGVQLYGGLAGLLIG 107

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +W             L    ++++   GF  P +W+   V++RQ +I  A PD LD+L 
Sbjct: 108 GVW-------FALGLPLGAILLVILPLGGFFYPLLWLRGRVKQRQHAITVALPDLLDMLA 160

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CV +G+  D AL  + E       PL EEM   + EL     R+ AF N   R   D +
Sbjct: 161 VCVSAGMGFDIALTLLVE---RGEGPLYEEMGRMLHELQMGAPREQAFRNLAARNSSDAL 217

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           R    AL+Q++  G+ I  +L     + R+ R   A ++ A    K+T+ +++   P ++
Sbjct: 218 RGFIDALLQAEELGSPIATTLERQAEDIRTGRRYRAREEGAKAATKITLIVVVLVTPSVL 277

Query: 312 LVIIGPAILSIIDT 325
            +II    +SI+ +
Sbjct: 278 CLIIAALGMSIMRS 291


>gi|149188858|ref|ZP_01867148.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
 gi|148837278|gb|EDL54225.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
          Length = 282

 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 103/266 (38%), Gaps = 9/266 (3%)

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNIL 116
           +      ++      +  +   S     +            +  K   AG+ +       
Sbjct: 20  ESLRAEQRRKKVEDYIGGQTLNSSSRVNRFFVRFGKEHRHELEQKFIEAGYYNTEWARFY 79

Query: 117 LVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQ 176
              +L V  +        +     + +     ++  V++        P + +    +   
Sbjct: 80  FPAKLAVLAV--------LSVLVLMTDMTASNKLLTVLVSLVAVIVVPDMLLQLRRKVLI 131

Query: 177 SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQ 236
                  P  LD++ +CV++G++I+ AL  + +++      L  ++  T          +
Sbjct: 132 GKTSAQLPYLLDMMSVCVQTGMTIEAALIYLGKELAEFDSDLCYQVKRTSDSAKI-HGLE 190

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            A  +  +R     VR+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  
Sbjct: 191 KALNDLSDRIPTPAVRSFVLTIIQNLQYGTSVAQVLSDLAEDMRKVQILAVEEKVGKLSA 250

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSI 322
           K+++P+I+F +  ++++I+ P I+ +
Sbjct: 251 KMSIPLILFIMFPIVILILAPGIMQM 276


>gi|316933035|ref|YP_004108017.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
 gi|315600749|gb|ADU43284.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
          Length = 324

 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 60/321 (18%), Positives = 126/321 (39%), Gaps = 31/321 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGE-LEKRMKSVAVEREILRKQQITSLQKDS 67
            +   LA+    AV++  + +  + P L   + +EKR+ SVA     +R+   T      
Sbjct: 1   MEMQTLALGFFAAVAVGGVAWVFIYPLLSGEKNVEKRLTSVARTTPAVRQVDRTQR---- 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R +   SL+    +   +    +  +  +L  AG   +++     VV   + ++ 
Sbjct: 57  ---SRREQIEGSLKEIETRSQKQK---NVPLGMRLSQAGL--DWTPAKFGVVSAAIGVVV 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L + I+   G        F    G            P   +  L ++R+     A PDA+
Sbjct: 109 LGIAIMIGTGLVAAAGLGFAAGFGL-----------PRWTLGFLKRRREKKFLAALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ +  +++ VA        PL  E    I   +       A    Y R  
Sbjct: 158 DVIVRGIKAGLPLFDSIKVVA---ADAPEPLRSEFNAIIETQAIGMPLADACARLYERMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + +A S+  K +   II  L
Sbjct: 215 LPEANFFGIVIAIQQKSGGNLSEALSNLSKVLRDRKKMAEKIQAMSMEAKASA-TIIGAL 273

Query: 308 PVLILVIIG---PAILSIIDT 325
           P+++++++    P  +S++ T
Sbjct: 274 PLIVMLLVYLTTPDYISLLWT 294


>gi|255020083|ref|ZP_05292154.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970445|gb|EET27936.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 337

 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 94/221 (42%), Gaps = 9/221 (4%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVG 160
           +++ AG     +    + ++++  +  L   ++                    +L   + 
Sbjct: 119 RIQKAGLNYLITPRDFMALKILSALFALFFALLVYAAIGVFRWE-------FTLLGMVLT 171

Query: 161 FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSE 220
              P +W+    ++RQ  I +  P  LD + + VE G+++  A++   +   G   PL  
Sbjct: 172 SFYPDLWLVEQAKRRQKRILKDLPVYLDFITLMVEGGLNLTGAIQIAVD--KGPEGPLRN 229

Query: 221 EMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETR 280
           E  + + +L     R   F  F +R  M  +R+   A+IQ++  G S+   L+    + R
Sbjct: 230 EFRIILRDLRSGMPRVEVFRRFGDRVAMQELRSLVTAIIQAEERGGSLAPVLKAQAEQRR 289

Query: 281 SERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            ER + AEK A     KL  P+I+F  P++ +V+     + 
Sbjct: 290 EERFLRAEKAALEAPVKLLAPLIMFIFPIVFIVLTFVIYMK 330


>gi|119773848|ref|YP_926588.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
 gi|119766348|gb|ABL98918.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
          Length = 287

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 66/279 (23%), Positives = 120/279 (43%), Gaps = 9/279 (3%)

Query: 48  VAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGF 107
           V+  R   R  +      D  +  L+                 ++   E I  KL+ +G 
Sbjct: 18  VSCARIYRRVPEERREFMDPLTPGLKLIWPLVNVVAFYFSEKLSVDYLERIAKKLQVSGL 77

Query: 108 RSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
               +      +R++  +    +  +  +  D+L           ++L    G+  P + 
Sbjct: 78  SYLMTAEQYFAIRILSTLFATFIVWLGCWMLDELSAN-------YLLLAAIAGYFLPMLT 130

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +++L + RQ  I +  P  LD L + +E+G+++  A+ +  E   G   PL  E    I 
Sbjct: 131 LNDLRRTRQEQIVKVLPVYLDYLTMAIEAGLNMSAAIAQAVE--RGPDGPLKIEFEKVIR 188

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           ++    +R  AF N  +R Q+  + +   AL Q++R G S+G +LR+   + R ER   A
Sbjct: 189 DMRAGISRAQAFRNMADRVQISELNSLVSALAQAERTGASLGYTLRIQADQRRVERFQRA 248

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           EKKA     KL  P+I+F  PV  L+++ P +   +  M
Sbjct: 249 EKKAMEAPIKLMFPLIMFIFPVTFLILLFPILSKFLFEM 287


>gi|307726380|ref|YP_003909593.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307586905|gb|ADN60302.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 318

 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 80/316 (25%), Positives = 150/316 (47%), Gaps = 8/316 (2%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            ++  + +     +       ++  +   ++++R+       E      +      S SS
Sbjct: 5   DSQNVLLLGGVFMVVFAAVVAIMWWMTPKDMQRRI-------EQAGGVSLAPQAVPSGSS 57

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
               + +   R   +    K    D  +  +L  AG+RS  +  +    +  + ++   L
Sbjct: 58  GWAEKIADISRPISQLSIPKEGWEDSPLRLRLMNAGWRSATAAALYFAAKTALALLLPAL 117

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G++ +     +    F +    + ++  +G+  P+  ++    +RQ +I   +PDALDLL
Sbjct: 118 GLVALLQMPFINGQ-FAVSALILAMLAAIGYYLPNAVLARCRARRQRAIVEGFPDALDLL 176

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +CVE+G+ +D AL RVA +I   S  ++ E+ L + EL     ++ A  NF  RT ++ 
Sbjct: 177 TVCVEAGLGMDAALMRVAGEIELASPEVASELQLMLLELRSGFTKEKALRNFALRTGVED 236

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +      L+Q+DR+GTSIG SLRV+    R+ R M AE++AA +  KL  P+I    P L
Sbjct: 237 IDTFASMLVQADRFGTSIGASLRVMSDTLRTRRRMRAEERAAKIALKLLFPLIFCIFPAL 296

Query: 311 ILVIIGPAILSIIDTM 326
           + V++GPA + I   +
Sbjct: 297 MTVLMGPAFIHIYRVL 312


>gi|91977989|ref|YP_570648.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
 gi|91684445|gb|ABE40747.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
          Length = 324

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 57/320 (17%), Positives = 124/320 (38%), Gaps = 29/320 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDS 67
                L++    AV++  L +  + P L    + EKR  SVA     +R+ + T      
Sbjct: 1   MQMQALSLGFFAAVAVGGLAWVFLYPMLSGEKQAEKRRSSVARVTPAVRQVERTQR---- 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R +   SLR+   +   K    +  +  +L  AG   +++    + +  V+ +  
Sbjct: 57  ---SRREQVEGSLRDIEAR---KQKQKNVALSTRLTQAGL--DWTPKKFITISAVLGVFV 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + +++  G        F    G            P   +  L ++R+     A PDA+
Sbjct: 109 FAVTMLFGGGLTAAAGLAFAAGFGL-----------PRWMLGFLKKRREKRFLNALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ +  +++ VA        PL  E    I   +       A    Y+R  
Sbjct: 158 DVIVRGIKAGLPLFDSIKVVA---ADSPEPLKTEFNAIIETQTIGMPIGEACARLYDRMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + +A S+  K +  +I    
Sbjct: 215 VPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQAMSMEAKASAAIIGSLP 274

Query: 308 PVLILV--IIGPAILSIIDT 325
           P+++L+  +  P  ++++ T
Sbjct: 275 PIVMLLVYMSTPDYIALLWT 294


>gi|84498180|ref|ZP_00996977.1| putative membrane protein [Janibacter sp. HTCC2649]
 gi|84381680|gb|EAP97563.1| putative membrane protein [Janibacter sp. HTCC2649]
          Length = 654

 Score =  115 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 58/314 (18%), Positives = 116/314 (36%), Gaps = 26/314 (8%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            +A   A+ + +L   + +      +   R+  V  E   L +      + ++ +S +  
Sbjct: 334 LIAALIALFVGALTLVIAVLDPFRSKRHDRVAQV--EHYTLGEASRLPRKAEANASVVAQ 391

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +     +              +  ++ A            V+R+V  ++   L  + 
Sbjct: 392 SAVRMGERVMA-----GRETTSRTMALIQRADLPLR--AGEWFVLRVVAIVVGGALTPVV 444

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +                 V +   +G+  P+  +  L  +R    ++  PD L L+   +
Sbjct: 445 L----------AMPWWFTVPIGIALGYFLPAAVLRMLAGRRAKKFEQMLPDILMLVATTL 494

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SG S+ QAL  VA      + P  +E   T+AE     +   A EN   R   + +R  
Sbjct: 495 ASGFSLTQALDAVAR---DSAQPAGKEFSRTLAETRIGADVSDALENMSVRMDSEAMRWT 551

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
           T A+      G ++ D+LR      R    ++ +  + S   +L+   I+  LP+L+ V 
Sbjct: 552 TMAIRIQRDVGGNLADTLRTTAHTLRERESLKRQVNSLSAEGRLSA-YILLGLPILLFVY 610

Query: 315 I---GPAILSIIDT 325
           +    PA  S++ T
Sbjct: 611 MAWSNPAYTSLLWT 624


>gi|83859361|ref|ZP_00952882.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852808|gb|EAP90661.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 331

 Score =  115 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/298 (15%), Positives = 109/298 (36%), Gaps = 18/298 (6%)

Query: 30  AVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNL 89
            +    +GS   + R   +        +     +    A+++ R +  + L+        
Sbjct: 20  GLGWVFVGSSADKARKARLEGAVGGPVQSTRRRVGAVDAAAQKRRQIQEGLKELEDSQKA 79

Query: 90  KAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLR 149
           +       +  +L  AG                      I   I  F    ++       
Sbjct: 80  ER-KKSLTLRARLDQAGLFKTGPTQFW------------IFSAILGFVAAFMVVVTGLNI 126

Query: 150 VGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAE 209
           + AV      G   P   +  + + RQ      + DALD+++  V+SG+ +++ L+ +A+
Sbjct: 127 LFAVAAAIIAGLGLPRWVLGMMRKGRQKKFTENFADALDIIVRGVKSGLPLNETLKIIAQ 186

Query: 210 DIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIG 269
           +      P+ +E  L +  L+   + +      + R  +  +   T  L    + G ++ 
Sbjct: 187 EGE---APVKQEFQLLVEGLAVGVDVEEGMRRMHRRMPLPELSFFTTVLAIQQKTGGNLA 243

Query: 270 DSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP--VLILVIIGPAILSIIDT 325
           ++L  L +  R+ ++M  +  A S   K +  +I    P   +++ I+ P  ++ + T
Sbjct: 244 EALNNLSAVLRARKMMREKVSALSSEAKASAWIIGSLPPGVGVMVSIMSPDYMTPLLT 301


>gi|218676254|ref|YP_002395073.1| putative Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
 gi|218324522|emb|CAV26000.1| putative Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
          Length = 288

 Score =  115 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 59/313 (18%), Positives = 129/313 (41%), Gaps = 29/313 (9%)

Query: 11  ATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASS 70
            T L   +   +S+   IY +         +E R    +   E  R              
Sbjct: 4   ETVLIWGVIFIISMVLAIYCLRFWDNTRANIETRKIIGSTREEKKR-------------- 49

Query: 71  RLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                    L+  + +++   I        KL AAGF S++  +   +++++       +
Sbjct: 50  ------KDLLKAVLSQISFNKI----ETKRKLVAAGFYSDFLADAYYLLKIIP----FSV 95

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++ I       E      +  ++        AP  ++S   +     I    P  LDL+
Sbjct: 96  CLVLIGFDFYNGETEVIFALLYLLGALLAFIIAPDSYVSARGKANIKHISSRLPFLLDLM 155

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +CV +G++I+ +L  +A+++      L+  + +T+         + A E FY       
Sbjct: 156 NVCVHTGMTIESSLEYLAKELHSVDSNLAHVVRVTVERSRL-VGLEKALEEFYELVPTSE 214

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
            ++    ++QS ++G+S+G  L  L ++ R   +M+ E++   +G K+++P+I F +  +
Sbjct: 215 SQSFVMTMVQSLQFGSSVGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPI 274

Query: 311 ILVIIGPAILSII 323
           +++I  P IL ++
Sbjct: 275 VVLIAAPGILRML 287


>gi|148975967|ref|ZP_01812756.1| hypothetical Flp pilus assembly protein TadC [Vibrionales bacterium
           SWAT-3]
 gi|145964712|gb|EDK29965.1| hypothetical Flp pilus assembly protein TadC [Vibrionales bacterium
           SWAT-3]
          Length = 280

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/305 (17%), Positives = 120/305 (39%), Gaps = 29/305 (9%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +    S+  L ++++   + S   ++R K VA                    + +     
Sbjct: 1   MMILASLIVLFFSLLFLIIESVRADQRQKKVA--------------------AYIGGDAI 40

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
           K      +            +  KL  AG+ +          +++V  +        + G
Sbjct: 41  KPPSRMNRFFVRFGKEHRHELEQKLIEAGYYNTEWAKFYFPAKVLVLGL--------VSG 92

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              L +     ++  VI+        P   +    +   S      P  LD++ +CV++G
Sbjct: 93  LVLLGDMTSTNKLLVVIVSLIAVIVVPDTLLQMRRKMLISKTSAQLPYLLDMMSVCVQTG 152

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++I+ +L  + +++      L  ++  T          + A  +   R     +R+    
Sbjct: 153 MTIEASLVYLGKELAEFDSDLCYQIKRTSDSAKI-HGVEKALNDLTERIPTPAIRSFVLT 211

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           +IQ+ +YGTS+  +L  L  + R  +++  E+K   L  K++VP+I+F +  ++++I+ P
Sbjct: 212 IIQNLQYGTSVAQTLSDLAEDMRKVQILTVEEKVGKLSAKMSVPLILFIMFPIVILILAP 271

Query: 318 AILSI 322
           +I+ +
Sbjct: 272 SIMQM 276


>gi|319785604|ref|YP_004145080.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171492|gb|ADV15030.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 337

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/320 (16%), Positives = 112/320 (35%), Gaps = 21/320 (6%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D T LA  +    S  ++ YA +   + + +   +        E  R     S  + + 
Sbjct: 4   IDGTVLAFVVLAGFSAGAVAYAFLFTRISNEKQVGKRLETIRTAETDRSVVKASRDRVAE 63

Query: 69  SSRLRTRDSKSLRNFVKKLNLKA-ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           +++ R     SL     K   K   +    +  +LR AG   + ++    +   +  I+ 
Sbjct: 64  AAKRRKSVQDSLNELDAKQKTKDSRVKKPPLKAQLRQAGL--KTTIERFYIYSAICGIVL 121

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            +   +       L        +G               +++    +R  +    +P+AL
Sbjct: 122 TMAAFVAGAPLIALPGVLLAGGLGLP-----------RWFVTFRRARRVKAFLNEFPNAL 170

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  V+SG+ ++ A+R +A        P+  E    +       +   A         
Sbjct: 171 DIIVRAVKSGLPLNDAVRLIAN---ESPEPVKTEFRRIVDSQQMGLSIPDATLRMPETMP 227

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
                     +    + G ++ ++L  L    R  + M+A+  A S+  K +   II  L
Sbjct: 228 CTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVAALSMEAKASAA-IIGAL 286

Query: 308 PVLILVII---GPAILSIID 324
           P ++  ++    PA L  + 
Sbjct: 287 PFIVAFLVYLSSPAYLMPLF 306


>gi|239817416|ref|YP_002946326.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239803993|gb|ACS21060.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 319

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 65/321 (20%), Positives = 129/321 (40%), Gaps = 8/321 (2%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKD 66
            F   +LA      +++  +I A  + +         ++   A++R+   +  + +    
Sbjct: 2   TFSPNQLATISLALLALGLMIAAGALIAAELRRARSGQVIGRALQRDATGQVDLKTPVDA 61

Query: 67  SASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII 126
            ++S LR            K+      V +     +   GF S+ +  I LV RL++  +
Sbjct: 62  ESNSSLRADIELPFHWLDSKIG--RAFVADEDRRLIDQCGFASKQAQLIFLVTRLLLAFL 119

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
             I+  I             +  +  +     VGF  P   +  +   R+  I R  P  
Sbjct: 120 LPIISYIVW-----KSHLTERTVLVVLAAAFVVGFMTPKWALGRIAAGRRERIARELPLF 174

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           +DLL +    G+S+DQ+L+ +A+D       L  E+     + S    R+ +        
Sbjct: 175 VDLLKLLQGVGLSLDQSLQIMADDFSHVLHVLGHELTFANRQYSQGRTREHSLHRLATLH 234

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFF 306
             + +R     L+Q DR+G ++ + LR+     R  R  E +++   +  K+T  M+   
Sbjct: 235 GNEDLRGLVSLLVQVDRHGGAVQEPLRIFGERLRERRRSEMKERIGKITVKMTGVMVSTL 294

Query: 307 LPVLILVIIGPAILSIIDTMK 327
           LP L++V  GP  ++I  ++ 
Sbjct: 295 LPALVIVTAGPGFIAIFRSLG 315


>gi|148253057|ref|YP_001237642.1| hypothetical protein BBta_1517 [Bradyrhizobium sp. BTAi1]
 gi|146405230|gb|ABQ33736.1| putative membrane protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 320

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 79/315 (25%), Positives = 156/315 (49%), Gaps = 13/315 (4%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
            + +     ++    +       + +  L +R+         L +  +        +   
Sbjct: 15  LMGLFGIIVLAAGGAVLIASSILVHADALARRVN------LALPQAAMAEAAAPGEAHPT 68

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
             +   SL   V K  L+ I+   + +         ++ +++  +V R+V  + F  L  
Sbjct: 69  IVQQLPSLAVGVSKTELQQIIRLFSYLR------VPADRAMSYFVVARVVFALSFATLTA 122

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
                +       + L + A I+   VG+ +P  +I ++V+++  ++    PDAL+LL++
Sbjct: 123 AAAVHWA-FSGARWWLPIMAAIVAAIVGWISPIFYIDHVVRQQTKAVASGLPDALELLVV 181

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
           CVE+G+S+++ L RVA ++      L++E++LT AE++ LP+R  A  NF  R  +  VR
Sbjct: 182 CVEAGLSLEEGLHRVAHELREAQPALADELVLTWAEINVLPSRAQALTNFAARNDIPSVR 241

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLIL 312
           +    L QS + GT +  SLRV   E R++++M  E++A+ L   LT+P+++F +P + L
Sbjct: 242 SVVSMLSQSLQLGTPLAQSLRVGAVEMRNDQMMLLEERASRLPAMLTIPVMLFIMPTVFL 301

Query: 313 VIIGPAILSIIDTMK 327
           ++ GPA L +ID  +
Sbjct: 302 LVGGPAALRLIDMFQ 316


>gi|294012436|ref|YP_003545896.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675766|dbj|BAI97284.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 332

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/307 (19%), Positives = 123/307 (40%), Gaps = 26/307 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   + +A+  A  +  ++ A   PS    + ++RM+ +           + +  + + 
Sbjct: 1   MNGNIILMAVLLATMLGLVVMAFSGPSPEKAQ-KRRMELIRGRHSDSTDAILEARMRKAI 59

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           S+R    ++  L + V           EN+  ++R  G   +++++  +    V+ +   
Sbjct: 60  SNRPAGNEASMLVSLV--------PNPENLAKRIRMTG--KKWTVSQYMTACAVIFLALC 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L ++  F             + AV+L    G   P +W+S L++ R       +PDAL+
Sbjct: 110 ALLMLRGFP-----------PLFAVMLGLAAGLGLPHMWVSRLIKGRVLKFNAKFPDALE 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL   + SG+ I + L  V+ ++ G   P+ EE  L    +        A +   +R   
Sbjct: 159 LLTRGLRSGLPIAETLNVVSNEVPG---PVGEEFKLITERIKIGKTMDQALQETADRLGT 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
              +    +L      G ++ ++L  L +  R    M+ + +A S   K +   II  LP
Sbjct: 216 PEFQFFVISLAIQRETGGNLAETLSNLATVLRQRAQMKLKIRAMSSESKASA-YIIGVLP 274

Query: 309 VLILVII 315
             +  +I
Sbjct: 275 FTVFGLI 281


>gi|170701756|ref|ZP_02892692.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170133339|gb|EDT01731.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 337

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 107/274 (39%), Gaps = 5/274 (1%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLN 114
            ++          +                   ++  ++V E     L   GF    +  
Sbjct: 66  RKEPDARQAPGQPSRLAQMQARLSVFGMRWLDTSIGRLVVAEEDRLLLEQCGFVDTRTRG 125

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           + L  R+   I+  +      +                V +   VGF  P +++     K
Sbjct: 126 LFLSARIACSIVIPLA-----YIGVVGPHVSGTQWWLGVGISFIVGFMVPKLYLRRRAAK 180

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R+ ++    P  +D+L +    G+S+DQ+++ V  D  G    LS EM +   + +    
Sbjct: 181 RRQAVTDELPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMMPVLSSEMEIAQRQFAAGRT 240

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R+ + +   +  + + +R   + LIQ D++G ++ + L+      R  R     ++   L
Sbjct: 241 REQSLQRLSSGFENEDLRAIVRLLIQVDKHGGAVQEPLKQFGERLREARRAMLRERIGRL 300

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             K+T  MI+  LP L++V  GP ++S++  +  
Sbjct: 301 TVKMTGVMIVTLLPALLIVTAGPGMISVLRALNQ 334


>gi|325673436|ref|ZP_08153127.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
 gi|325555457|gb|EGD25128.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 67/311 (21%), Positives = 134/311 (43%), Gaps = 21/311 (6%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
            +  A         V++         +R  ++   +  L      S      S     + 
Sbjct: 5   LVLVAALSVGGALGVLVWLTAGARDPERGPALQNLQSQLALPIPVSGGAPPLSLGRFVKL 64

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
                       L        +      AG  + +      + ++V+           + 
Sbjct: 65  ------------LSPPGTMARLERLHILAGRPAAWVPERAAMAKIVLAAAAA------LL 106

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G   +   P   RV        + +  P + + +  Q+RQ++I+ A  D LD + I VE+
Sbjct: 107 GLLAVGASPGVGRVLFAAAAVALAYFVPELLLQSRGQERQAAIELALADTLDQMTIAVEA 166

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+  + A++R A++  G   PL+EE + T+ ++    +R++A+ +   RT+   +R   +
Sbjct: 167 GLGFEAAMQRAAKNGKG---PLAEEFIRTLQDIQMGQSRRIAYLDLAARTKAPNLRRFLR 223

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           A+IQ+D YG +I + LR   SE R +R   AE+KA  +  K+  P++   LP + +VI+G
Sbjct: 224 AVIQADEYGVAIAEVLRTQASEMRLKRRQSAEEKAMKVPVKVLFPLMTCILPTIFIVILG 283

Query: 317 PAILSIIDTMK 327
           PA++++++ + 
Sbjct: 284 PAVINMMEVLG 294


>gi|149188841|ref|ZP_01867131.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
 gi|148837261|gb|EDL54208.1| hypothetical Flp pilus assembly protein TadC [Vibrio shilonii AK1]
          Length = 283

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 102/232 (43%), Gaps = 9/232 (3%)

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             + +  KL  AG+ ++      L  +  V +   +  +         +     + +  +
Sbjct: 57  QRKELEQKLLDAGYYNKNLAKYYLPTKFAVAVCISLAILFLNIAVLYKVVAVVVVMITVI 116

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
           IL          + +    +     I R  P  LD++ +CV++G++I+ +   + +++  
Sbjct: 117 ILP--------DIILDIKKKLMVRKISRNLPYVLDIMSVCVQTGMTIEASFDYLHKELAA 168

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
               LS ++  T          + A  +  NR     V++    +IQ+ +YGTS+ + L 
Sbjct: 169 FDSDLSYQIKKTSDAGKI-HGIEKALNDLNNRLPAPEVQSFVLTIIQNLQYGTSVANILS 227

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
            L  + R  +L++ E+K   L  K++VP+I+  +  ++++I+ P ++ +  T
Sbjct: 228 DLAEDMRRIQLLKVEEKVGKLSAKMSVPLILLIMFPIVILILAPGVMQLDFT 279


>gi|304392380|ref|ZP_07374321.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295484|gb|EFL89843.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 332

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/285 (18%), Positives = 105/285 (36%), Gaps = 16/285 (5%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
                 S   +K+ K      ++ +K ++    +     + R     +L+N   + +   
Sbjct: 22  YALLYNSIASDKKSKERMQRLQMDKKTKMKVESRKMDEKQRRKSREAALKNVDDQKSKGK 81

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
               E     L  AGF    SL    VV  V+ I+F  + ++++     +      +   
Sbjct: 82  TAGKETFREILEQAGF--TISLGKFYVVSAVIGILFFFIALVFMGATLPIAGGVGFVMGF 139

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
                       P  W+    +KR ++  + +P+A+D+++  ++SG+ ++  LR +A   
Sbjct: 140 GA----------PRWWVKRKRKKRFAAFTKTFPNAIDVIVRGIKSGLPLNDCLRIIAT-- 187

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                P+  E    I           A E  Y           +  +      G ++ ++
Sbjct: 188 -DSDEPVRGEFRKLIEAAQMGIPVPEACERLYKSIPTSETNFFSIVIAIQSSAGGNLSEA 246

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           L  L    R  R M  + +A S   K T  MII  LP ++ +++ 
Sbjct: 247 LGNLSKVLRERRKMADKIQAFSSEAK-TSTMIIGALPFVVAIMVF 290


>gi|320158388|ref|YP_004190766.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
 gi|319933700|gb|ADV88563.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
          Length = 292

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/309 (19%), Positives = 129/309 (41%), Gaps = 27/309 (8%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           A+ I  A+ +  ++    +        E  ++ +    +  +K+                
Sbjct: 8   AIFILVALIVSVVVAIFALKMWDETRAEISVRKIIGSTKEQQKRD--------------- 52

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                  +F K+ +       +    KL AAG  S++      + ++V   + +  G++ 
Sbjct: 53  ---DLFLSFFKRFSFNK----DETKKKLVAAGIYSDFIAQTYYLFKIVPLFLTIGGGLLA 105

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +          F   +        +    P +++S+        +    P  LDL+ +CV
Sbjct: 106 V----SQEVIDFNEMILIGAFALIIFVAGPDLYLSSRTNTITRHVSSRLPFLLDLMNVCV 161

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G++I+  L  +A+++      L+  + +T+         + A E FY        ++ 
Sbjct: 162 HTGMTIEATLEYLAKELQTVDKYLAFTVNVTVQRSKV-IGIEKALEEFYEMVPSSEAQSF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L+QS ++G+S+G  L  L ++ R   +ME E+K   LG K+++PMI+F +  +I++I
Sbjct: 221 VMTLVQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIPMIVFIMVPIIILI 280

Query: 315 IGPAILSII 323
           I P I+ ++
Sbjct: 281 IAPGIMRML 289


>gi|251789651|ref|YP_003004372.1| type II secretion system protein [Dickeya zeae Ech1591]
 gi|247538272|gb|ACT06893.1| type II secretion system protein [Dickeya zeae Ech1591]
          Length = 318

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 70/292 (23%), Positives = 140/292 (47%), Gaps = 6/292 (2%)

Query: 39  GELEKRMKS--VAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDE 96
             L  R+ +     E   +         +  A      +  + +  +  +L   +    +
Sbjct: 31  RRLRDRLAAHVAMAETAAVGAPDSILRNQGKALPPRLEKILQPIAAWGVQLA-GSARDRQ 89

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
            +   L  AG R   +L  L+  +L   ++  +L    + G     +    + + A ++ 
Sbjct: 90  QLRRLLDLAGIRRTEALGWLMAGKLGGGLLLALLL---VGGALPPPDRTGLIGLAAALIG 146

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
            + G   P  W+      R   + RA PDALDL+++C E+G+SI + L+ V++++G  S 
Sbjct: 147 FFAGSLLPEAWLKMRAAGRGEKLARAVPDALDLMVVCAEAGLSIGRVLQVVSKELGLSSP 206

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            +++E+  T AEL  L +R  A ++   RT++  + +    L+Q++RYGT +  +LR + 
Sbjct: 207 EMADELRYTAAELQILADRNTALQHLAERTRVSEIESMVATLLQAERYGTPLSQALRTIA 266

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            E+R   L+  E+KA  L  +L+VP++   LP +I ++  PA+L ++  + +
Sbjct: 267 DESRKTLLLTLEEKAGKLPAQLSVPLMALILPPIIAIMASPALLRVVRLLGN 318


>gi|90425201|ref|YP_533571.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107215|gb|ABD89252.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
          Length = 324

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/319 (17%), Positives = 125/319 (39%), Gaps = 27/319 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                LA+A  +A+++  L +  + PSL   +  ++       R  L + +    Q D  
Sbjct: 1   MLIQTLAIAFLSAMAVGGLAWVFIYPSLSGQKTAEQ------RRASLARPEPVVRQIDRT 54

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               R +   SL+    +   +  +    +  +L  AG   +++    L+   V+ +   
Sbjct: 55  QRSRREQVEGSLKEVEARHRKEKKV---ALTTRLTQAGV--KWTPKGFLIGSAVLGVTMF 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            +  +   G    L   F    G            P   ++ L ++R+ +  +A PDA+D
Sbjct: 110 AITSLLGGGLLAALALGFAAGFGL-----------PRWALNFLKKRREKNFLKALPDAVD 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           +++  +++G+ +  +L+ VA        PL  E L  +   +       A    Y R  +
Sbjct: 159 VIVRGIKAGLPLFDSLKVVA---ADAPEPLKSEFLAILETQAIGMPLGEACARLYERMPL 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
                    +    + G ++ ++L  L    R  + M  + +A S+  K +  +I    P
Sbjct: 216 PEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQAMSMEAKASAGIIGSLPP 275

Query: 309 VLILV--IIGPAILSIIDT 325
           +++L+  +  P  +S++ T
Sbjct: 276 IVMLLVYLSTPDYISLLWT 294


>gi|312882149|ref|ZP_07741898.1| hypothetical protein VIBC2010_06159 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370195|gb|EFP97698.1| hypothetical protein VIBC2010_06159 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 280

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 110/267 (41%), Gaps = 9/267 (3%)

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
             + +    +  + T+ S++     +            +  KL  AG  +          
Sbjct: 23  RMTQRNKKVALLIGTQSSRTPSRVNRFFVRFGKEHRHELEKKLIDAGIYNRELAKFYFPA 82

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +L++        +I +     + +   Q ++   IL        P   +    +     I
Sbjct: 83  KLMI--------LIVVTSLILISDMTMQNQLMFGILNLIGVILLPDTLLHIKGKLLIGKI 134

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
               P  LD++ +C+++G++I+ +L  + E++      L  ++  T          + A 
Sbjct: 135 SAQLPYLLDMMAVCIQTGMTIEASLVYLGEELEEFDKDLCYQIQRTSDSAKI-HGLEKAL 193

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
            +F +R     VR+    +IQ+ +YGTS+   L  L  + R  +++  E+K   L  K++
Sbjct: 194 NDFADRVPTTAVRSFVLTIIQNLQYGTSVAQVLGDLSEDMRKVQILTVEEKVGKLSAKMS 253

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTM 326
           +P+I+  +  ++++I+ P I+ ++  M
Sbjct: 254 LPLILLIMFPIVVLILAPGIMQMMINM 280


>gi|146338119|ref|YP_001203167.1| putative pilus assembly protein membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146190925|emb|CAL74930.1| putative pilus assembly protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/304 (16%), Positives = 117/304 (38%), Gaps = 27/304 (8%)

Query: 24  IFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNF 83
           I  + +  + P L      ++       R  + K +    Q +      R +   SL++ 
Sbjct: 16  IGGIAWVFIYPMLSGERKAEQ------RRSSVAKAEPVVRQVERNQRSRREQVESSLKDL 69

Query: 84  VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLE 143
             K   ++ +    +  ++  AG   ++++               I+  +  F    +  
Sbjct: 70  EAKAQKQSKV---PLNIRISQAGL--DWTVQKFW-----------IISGVLGFVVCAVAF 113

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
           +     +GA+ L    G   P   +  L ++R+     A PDA+D+++  +++G+ + ++
Sbjct: 114 FAGGGPLGALGLGFAAGLGLPRWILGYLKKRREKKFLAALPDAVDVIVRGIKAGLPLFES 173

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ VA        PL  E L  I   +       A    Y R  +         +    +
Sbjct: 174 IKVVA---ADAPEPLRSEFLAIIETQAIGMPLGEACARLYERMPLPEANFFGIVIAIQQK 230

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV--IIGPAILS 321
            G ++ ++L  L    R  + M  + +A S+  K +  +I    P+++L+  +  P  +S
Sbjct: 231 SGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAGIIGSLPPIVMLLVYLSTPDYIS 290

Query: 322 IIDT 325
           ++ T
Sbjct: 291 LLWT 294


>gi|115351460|ref|YP_773299.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115281448|gb|ABI86965.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 337

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/274 (19%), Positives = 112/274 (40%), Gaps = 8/274 (2%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKL---NLKAILVDENIVNKLRAAGFRSEYSLN 114
           ++  + ++         +    L  F  +     +  ++V E     L   GF    +  
Sbjct: 66  RKEPAGRQAPGQPSRLAQMQARLSVFGMRWLDTGVGRLVVAEEDRLLLEQCGFVDTRTRG 125

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
           + L  R+   I+  +      +                V +   VGF  P +++     K
Sbjct: 126 LFLSARIACSIVIPLA-----YIGVVGPHVSGTQWWLGVGISFIVGFMVPKLYLRRRAAK 180

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R+ ++    P  +D+L +    G+S+DQ+++ V  D  G    LS EM +   + +    
Sbjct: 181 RRQAVTDELPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMMPVLSSEMEIAQRQFAAGRT 240

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R+ + +   +  + + +R   + LIQ D++G ++ + L+      R  R     ++   L
Sbjct: 241 REQSLQRLSSGFENEDLRAIVRLLIQVDKHGGAVQEPLKQFGERLREARRAMLRERIGRL 300

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             K+T  MI+  LP L++V  GP ++S++  +  
Sbjct: 301 TVKMTGVMIVTLLPALLIVTAGPGMISVLRALNQ 334


>gi|187923649|ref|YP_001895291.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187714843|gb|ACD16067.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 336

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/293 (19%), Positives = 115/293 (39%), Gaps = 15/293 (5%)

Query: 46  KSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN----------LKAILVD 95
           ++V          + T   +  A +  R+      +  +++                +V 
Sbjct: 46  RAVQSAALAAAAARGTEGAQAGAKAAARSVPPTGFKGLLERFAHTGIRWLDTPFGRQVVA 105

Query: 96  ENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVIL 155
           E     L   GF    +  + L+ RLV  ++  +L       +     Y        VI+
Sbjct: 106 EEDRRLLEQCGFVDTRTRGLFLLARLVGALVLPVLAGTLASTHLDGSRYG-----ALVIV 160

Query: 156 IGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQS 215
               GF  P + +     KR+ ++    P  +DLL +    G+S+DQ+L+ V  D  G  
Sbjct: 161 AVMAGFMLPKLVLRRRAGKRRHAVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFRGML 220

Query: 216 VPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVL 275
             L+ E+ +   + +    R+ +     +    + +R   + L+Q D +G ++ + L+  
Sbjct: 221 PVLAGELEIAQRQFAAGRTREQSLNRLASSYDNEDLRAVVRLLVQVDLHGGAVQEPLKQF 280

Query: 276 VSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
               R  R     ++   L  K+T  MI+  LP L++V  GP +L++  ++  
Sbjct: 281 GDRLREARRAMLRERIGRLAVKMTGVMIVTLLPALMIVTAGPGVLAVQHSLGK 333


>gi|187251609|ref|YP_001876091.1| TadC subunit [Elusimicrobium minutum Pei191]
 gi|186971769|gb|ACC98754.1| TadC subunit [Elusimicrobium minutum Pei191]
          Length = 296

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 70/326 (21%), Positives = 136/326 (41%), Gaps = 40/326 (12%)

Query: 5   FFDLFDATELAVAITTA-VSIFSLIYAVVIP----SLGSGELEKRMKSVAVEREILRKQQ 59
            FD      L +++     ++F L+  +  P       S    KRMK+            
Sbjct: 1   MFDQMKEVGLMISLGAGSFAVFMLVMRLFAPEDAPLSVSDIEAKRMKA---------TSS 51

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
            +S+++D+   +L                L+A  +++ +  +    G  +      +L  
Sbjct: 52  FSSIKQDTMWGKLCL------------YILEAFKLEKPLEEQHLLLGSPATPQPVTILYQ 99

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +++                   +     L+    ++   +GF  P+  +++ +QKRQ  +
Sbjct: 100 KILWA-------------ILLPILVLLVLKNFLFVIFIPLGFYIPTALVNSKIQKRQRDM 146

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
              +   +DL  + +ESG+    A  R+      ++  L EE+   + E+    +R+ A 
Sbjct: 147 LGNFSTTVDLAALIIESGLDYMTAFDRIIRIAKEKT-VLEEELDKMLNEVKLGYSRREAL 205

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
           E   NRT +  +R+    +IQSD  GTS+ D LR    + R  R+ +AEK AA    K+ 
Sbjct: 206 ERLANRTGVQEIRSFVGLIIQSDELGTSLVDLLRNFSIDLRFRRMNKAEKLAAQASTKML 265

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDT 325
           VP+ +F  P + ++I+ P +  II +
Sbjct: 266 VPLFLFIFPTVFILILAPMLKDIISS 291


>gi|330816719|ref|YP_004360424.1| Type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327369112|gb|AEA60468.1| Type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 329

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 122/308 (39%), Gaps = 6/308 (1%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL-RTRDSKSL 80
           ++I   +            L++R+++         +Q     ++  AS        ++ +
Sbjct: 24  MAILRSLLVQRSERTLLKALDQRVEAGRAAASRAGQQAQAKPRETPASGLAAWRTRAEQI 83

Query: 81  RNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDK 140
                   L   LV +     L   G+    +  + L  R++   +  +  ++       
Sbjct: 84  GMRWLDSGLGKQLVADEDRQFLEQCGYVEARARGLFLFSRVLCASVLPLAVLMISLVRGS 143

Query: 141 LLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISI 200
                    +  +     +GF  P ++I      R+ S+    P  +D+L +    G+S+
Sbjct: 144 GG-----KSLIYIAFAIAIGFMLPKLYIRRKAAARRESVAEEMPLFVDMLRLLQGVGLSL 198

Query: 201 DQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ 260
           DQ+++ ++ D       LS E+ +   + +    R+ +     +    + +R+  + LIQ
Sbjct: 199 DQSMQVISHDFTTMLPVLSWELGVAQRQFAAGRTREQSLARLTSSFDNEDLRSIVRLLIQ 258

Query: 261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAIL 320
            D++G ++ + LR+     R  R     ++   L  K+T  MI+  LP L++V  GP I+
Sbjct: 259 VDKHGGAVQEPLRMFGDRLRDGRRALLRERIGRLTVKMTGVMIVTLLPALLIVTAGPGIM 318

Query: 321 SIIDTMKD 328
           +++  +  
Sbjct: 319 TVVSALSQ 326


>gi|300856045|ref|YP_003781029.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
 gi|300436160|gb|ADK15927.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 306

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 62/284 (21%), Positives = 128/284 (45%), Gaps = 9/284 (3%)

Query: 45  MKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRA 104
           +K    E   L K +   ++  + S R+     ++    + ++     +V   +  KL  
Sbjct: 31  IKKRFTELNELDKLKEEEIENKTFSERMIMPFYENFSKVLLRITPHQKIVM--LNKKLER 88

Query: 105 AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAP 164
           AG     ++   ++ + ++ +IF  +  + +       ++     +   IL+        
Sbjct: 89  AGVLKNSTVQKWILKKSMIILIFSTILGVLVLMV----DFNIMKVIVFTILVVITINVFF 144

Query: 165 SVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLL 224
           + ++S  +Q R++ I +  P  LDL+ + VE+G+S D A+ RV  +I G    L +E   
Sbjct: 145 NFYLSRRIQNRKNKILKDLPYTLDLITVSVEAGLSFDGAIARVISNIRG---ELCDEFAK 201

Query: 225 TIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERL 284
           ++ E++    R+ A +N   R  +  +     +LIQ+D  G S+   LR+  +  R  R 
Sbjct: 202 SLKEITMGIERKAALKNMSERCDVKELSMFISSLIQADELGVSLSKVLRIESANLREHRR 261

Query: 285 MEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
             + +KA     K+  P+I F  P + ++I+GPA++ +I     
Sbjct: 262 QVSREKAMKAPIKMLFPLIFFIFPTIFIIILGPAVIRMITIFAK 305


>gi|209551763|ref|YP_002283680.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537519|gb|ACI57454.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 335

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/298 (15%), Positives = 113/298 (37%), Gaps = 21/298 (7%)

Query: 31  VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLK 90
           ++   + + +            E  R +   +  +    S+ R     +L++ ++K   +
Sbjct: 26  LMYSRIEADKKSASRIDRVKSAESDRVKVKAARDRVQEMSKRRKSVQDNLKD-LEKRQHE 84

Query: 91  AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
                  + ++L  AG     ++    ++  +   + L++  +                +
Sbjct: 85  KTKKTLTMKSRLVQAGL--TITVGKFYIISAIFACVLLLMAFLIGVSL-----------M 131

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
             + +    G   P   +  L+++RQ+      P+ALD++   ++SG+ ++ A+R +A  
Sbjct: 132 VIIGIAVVAGLGLPRWIVGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIAT- 190

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
               + P+  E    I       +   A         +  V      +    + G ++ +
Sbjct: 191 --EGTEPVKSEFRRVIEAQQVGLSIPDACARMTAHMPLQEVSFFAIVIAIQSQAGGNLSE 248

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           ++  L    R  R M+A+  A S+  K +  +II  LP ++  ++    P+ + I+ T
Sbjct: 249 AIGNLSKVIRERRKMKAKVSALSMEAKASA-VIIGALPFIVATLVYLTSPSYMMILFT 305


>gi|27376546|ref|NP_768075.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349687|dbj|BAC46700.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 340

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/304 (17%), Positives = 113/304 (37%), Gaps = 26/304 (8%)

Query: 24  IFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNF 83
           +  + +  + P L         K+      I R     + Q + +    R +   SL++ 
Sbjct: 31  VGGIAWVFLYPLLSGER-----KAENRRASIARADAPAAKQTEKSQRSRREQVETSLKDL 85

Query: 84  VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLE 143
             +   +       +  +L  AG   +++     +V  VV  +  +  +    G      
Sbjct: 86  EAR---RQQEKSVPLNIRLSQAGL--DWTPQKFWIVSAVVAGVLFVAAMFVGGGLLGGAG 140

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
             F    G            P   +S L ++R+S    A PDA+D+++  +++G+ + ++
Sbjct: 141 LAFAGGFGL-----------PRWALSFLKKRRESKFLAALPDAVDVIVRGIKAGLPLFES 189

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ VA        PL  E L  I   +       A    Y+R  +         +    +
Sbjct: 190 IKVVA---ADSPEPLRSEFLAIIETQAIGMPLGEACSRLYDRMPLPEANFFGIVISIQQK 246

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV--LILVIIGPAILS 321
            G ++ ++L  L    R  + M  + +A S+  K +  +I    P+   ++ +  P  +S
Sbjct: 247 SGGNLSEALGNLSKVLRDRKKMREKIQAMSMEAKASAAIIGSLPPIVMFLVYLTTPHYIS 306

Query: 322 IIDT 325
           ++ T
Sbjct: 307 LLWT 310


>gi|312883759|ref|ZP_07743478.1| Flp pilus assembly protein TadC [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368508|gb|EFP96041.1| Flp pilus assembly protein TadC [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 284

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 114/259 (44%), Gaps = 6/259 (2%)

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
                R ++       +  +     +     KL   G+ S  + +I +  R        I
Sbjct: 31  KIRLDRVARFSAEQASRGGVLRWATNPKRAQKLAMLGYVSSQADSIFMTARASAMTGVGI 90

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
               ++     +      + +   + I           +   V   +  I +  PDALDL
Sbjct: 91  AWFFFLQLSFDIGGVAQGVVIALSLGIAI------DRVLDWRVNVVRQEIAKHIPDALDL 144

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +++CV SG +++     V +++   S  LS E L+T  E++ L + QVA  N   R  + 
Sbjct: 145 MVVCVSSGQNLEATFNTVGQEMKSISPSLSREWLVTSTEMAVLDSPQVALTNLDARLALP 204

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            + N    + Q+ ++G  + ++L+++ S++R   ++E E+    +  K++ P+++F +  
Sbjct: 205 EINNMIATMSQALKFGAPMAEALKLIASDSRQYHMLELEEWVGKIPAKMSFPLVVFIMLP 264

Query: 310 LILVIIGPAILSIIDTMKD 328
           ++++I+ P +LSI  T+  
Sbjct: 265 VVVIIVAPMVLSIFQTIGQ 283


>gi|312139259|ref|YP_004006595.1| type ii secretion system integral membrane subunit [Rhodococcus
           equi 103S]
 gi|311888598|emb|CBH47910.1| putative type II secretion system integral membrane subunit
           [Rhodococcus equi 103S]
          Length = 296

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 67/311 (21%), Positives = 134/311 (43%), Gaps = 21/311 (6%)

Query: 17  AITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRD 76
            +  A         V++         +R  ++   +  L      S      S     + 
Sbjct: 5   LVLMAALSVGGALGVLVWLTVGARDPERGPALRNLQSQLALPIPESGGAPPLSLGRFVKL 64

Query: 77  SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIF 136
                       L        +      AG  + +      + ++V+           + 
Sbjct: 65  ------------LSPPGTMARLERLHILAGRPAAWVPERAAMAKIVLAAAAA------LL 106

Query: 137 GYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVES 196
           G   +   P   RV        + +  P + + +  Q+RQ++I+ A  D LD + I VE+
Sbjct: 107 GLLAVGASPGVGRVLFAAAAVALAYFVPELLLQSRGQERQAAIELALADTLDQMTIAVEA 166

Query: 197 GISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQ 256
           G+  + A++R A++  G   PL+EE + T+ ++    +R++A+ +   RT+   +R   +
Sbjct: 167 GLGFEAAMQRAAKNGKG---PLAEEFIRTLQDIQMGQSRRIAYLDLAARTKAPNLRRFLR 223

Query: 257 ALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG 316
           A+IQ+D YG +I + LR   SE R +R   AE+KA  +  K+  P++   LP + +VI+G
Sbjct: 224 AVIQADEYGVAIAEVLRTQASEMRLKRRQSAEEKAMKVPVKVLFPLMTCILPTIFIVILG 283

Query: 317 PAILSIIDTMK 327
           PA++++++ + 
Sbjct: 284 PAVINMMEVLG 294


>gi|237653361|ref|YP_002889675.1| type II secretion system protein [Thauera sp. MZ1T]
 gi|237624608|gb|ACR01298.1| type II secretion system protein [Thauera sp. MZ1T]
          Length = 301

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 67/294 (22%), Positives = 120/294 (40%), Gaps = 11/294 (3%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
            +  L        + ++A     +R +  T L       RL    ++ + + V  L    
Sbjct: 17  AVALLAGFGSAGIVAALARSVSAVRPEDRTWLDTPPRFLRLLWWPTRWIAHLVAPLLPAR 76

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
           +     +  +LR AG     S   LL  R+ V +  L  G+     +      P      
Sbjct: 77  L--QARLAVRLRLAGLDYTLSPAQLLAHRVAVGLCGLAAGLGCAHAWALPPALPALAGAT 134

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           A  LI          W+ + ++ R+  + +  P  LDL+ +CVE+G+++  AL++ A   
Sbjct: 135 AGTLIA-------WSWLDDRIRCRRRLMLKQLPFVLDLITLCVEAGLNLTGALQQAAA-- 185

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
            G + PL EE+   + ++    +R  A   F +R     + N    +IQ++  G S+G  
Sbjct: 186 KGPAGPLGEELHRVLRDVRAGKSRADALRGFADRIGEPAIANLVSTVIQAENMGMSLGPM 245

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           LR    + R+ER   AEK A     K+ +P+I    P   +V+  P  +  +  
Sbjct: 246 LRAQGEQRRAERFARAEKAAMEAPVKMLLPLIACIFPCTFIVLGFPIAVKFMTM 299


>gi|302381752|ref|YP_003817575.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192380|gb|ADK99951.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 326

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/313 (15%), Positives = 115/313 (36%), Gaps = 19/313 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I  AV  F  I  +    +G  +   +    A E       +    +     +    
Sbjct: 1   MLPILAAVLAFITIAGLGWVFVGGDDSSAQAIKRA-EGFTSGTVRTARAKAAKVEANTPE 59

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              K++   +K+   K       +  +L+ AG      +    ++   + ++  ++ +++
Sbjct: 60  ARRKAIELQLKEAERKERKARMTMKARLKHAGM--SMGIRTFWIISACLGVVAFLMPLVF 117

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                            A+ +   VG   P   +  + ++R       + +A+D+++  +
Sbjct: 118 GLNI-----------FVAIGIALVVGLGLPRWVVGFIGKRRLKKFSLEFANAVDVIVRGI 166

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           +SG+ +    + +A        P+  E    +  L        A E  Y R     +R  
Sbjct: 167 KSGLPVHDCFKIIAR---ESPAPVGPEFQTLVEGLGVGLTLGQALEKMYERIPTPELRFF 223

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI--L 312
           T  +    + G ++G++L  L +  R+ R+M  + KA S     +  +I    PV++  +
Sbjct: 224 TIVIAIQQKTGGNLGEALSNLTTVLRARRMMGEKIKALSSEATASAGIIGSLPPVVMTLV 283

Query: 313 VIIGPAILSIIDT 325
            +  PA + ++ T
Sbjct: 284 GLTTPAYMGLMFT 296


>gi|218516696|ref|ZP_03513536.1| probable pilus assembly protein [Rhizobium etli 8C-3]
          Length = 335

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 113/298 (37%), Gaps = 21/298 (7%)

Query: 31  VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLK 90
           ++     + +      +     E+ R +   +  +    S+ R     +L++ ++K   +
Sbjct: 26  LMFSRFEADKKSASRINRVKSAEVDRVKVKAARDRVQELSKRRKSVQDNLKD-LEKRQHE 84

Query: 91  AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
                 ++ ++L  AG     S+    ++  V   + L +  +    +           +
Sbjct: 85  KTRKTLSMKSRLLQAGLPI--SVGKFYLISAVFASVLLFVAFVVGASW-----------M 131

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
             + +    G   P   +  L+++RQ+      P+ALD++   ++SG+ ++ A+R +   
Sbjct: 132 VMIGIAVVAGLGLPRWVLGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGT- 190

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
               + P+  E    I       +   A         +  V      +    + G ++ +
Sbjct: 191 --EGTEPVKSEFRRVIEAQQVGLSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSE 248

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           ++  L    R  R M+A+  A S+  K +  +II  LP ++  ++    P  + I+ T
Sbjct: 249 AIGNLSKVLRERRKMKAKVSALSMEAKASA-VIIGALPFIVATLVYLTSPNYMMILFT 305


>gi|90412171|ref|ZP_01220177.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum 3TCK]
 gi|90326895|gb|EAS43280.1| hypothetical Flp pilus assembly protein TadC [Photobacterium
           profundum 3TCK]
          Length = 283

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 105/262 (40%), Gaps = 9/262 (3%)

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
              ++    S L  +    L    + +        +++  +   AGF +       +  +
Sbjct: 25  EQAKQAHVESYLSAKKDGRLTRLNRFITRLGRNHQQDLEQQFVDAGFYNTQFAKYYVPAK 84

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           L +        +I+      + +     +     +        P + +S   +       
Sbjct: 85  LTL--------VIFTCVVVIISDLSLMNKAAISAVAMITILLVPEMVLSMRKKALILKTS 136

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           R  P  LD++ +CV++G++I+ AL  ++ ++      L   +  T          + A  
Sbjct: 137 RQLPYMLDMMSVCVQTGMTIEAALTYLSIELEAFDKDLCFHIKKTADGARV-KGLEKALI 195

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
               R     VR+ T  LIQ+ +YGTSI + L  L  + R  +++  E+K   L  K++V
Sbjct: 196 ELSERIPTPDVRSFTLTLIQNLQYGTSIANVLSALAEDMRKMQVLTMEEKIGKLAAKMSV 255

Query: 301 PMIIFFLPVLILVIIGPAILSI 322
           P+I+  +  ++++I+ P ++ +
Sbjct: 256 PLILLIMFPIVILILAPGMMQM 277


>gi|308176986|ref|YP_003916392.1| type II secretion system protein F [Arthrobacter arilaitensis
           Re117]
 gi|307744449|emb|CBT75421.1| putative type II secretion system protein F [Arthrobacter
           arilaitensis Re117]
          Length = 313

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/286 (17%), Positives = 105/286 (36%), Gaps = 6/286 (2%)

Query: 33  IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAI 92
           +P         R+           +    S   +S  S L  + +  +   +K+L     
Sbjct: 26  LPGWRKMAFADRIAPHVRVGVRSSRMLEDSWHSESGYSAL-GQLAAPMLLQIKRLASLHS 84

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
              + +  +L AAG   + S+       +V  +  L+ G  ++            L V  
Sbjct: 85  PSADTLRKRLDAAGL--DMSVIDYRSQEIVYALTGLVAGSAFMAFAAIQYRVSLVLSVLV 142

Query: 153 VILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIG 212
           V+  G +G+     W+   + +R   I   +P   ++L + V +G S   A+ R++    
Sbjct: 143 VVGFGIIGYAMRGWWLGEQINRRARKILTQFPTVAEVLALTVGAGESTTGAIERISRIC- 201

Query: 213 GQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSL 272
                + +E   T+ ++        A ++  +R Q+  +     A++ +   GT +   L
Sbjct: 202 --HGVIGDEFTKTLNDIHAGTPMVQAMQHMSDRMQVGAMTRFVDAIVVATERGTPLAQVL 259

Query: 273 RVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           R    + R     E  + A      + VP++   LP+ I+  + P 
Sbjct: 260 RDQAQDVRDASKRELMEVAGKREISMLVPVVFGILPLTIVFAVFPG 305


>gi|254506088|ref|ZP_05118232.1| bipartite nuclear localization signal containing protein [Vibrio
           parahaemolyticus 16]
 gi|219550906|gb|EED27887.1| bipartite nuclear localization signal containing protein [Vibrio
           parahaemolyticus 16]
          Length = 248

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 56/230 (24%), Positives = 107/230 (46%), Gaps = 4/230 (1%)

Query: 95  DENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVI 154
           ++ I +K + AG  S+ S  + L + L    + L    I+I+     +  P  +   A  
Sbjct: 21  NQEINDKFKRAGISSK-SKWVALYMPLKYGALMLGCAAIYIYSIKSAISTPTLIAFMATW 79

Query: 155 LIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQ 214
           L   +    P   +    + R S +    P  LDLL +CV++G++I+ A+  +++++ G 
Sbjct: 80  L--IICIVVPDALLDGRGKARVSRVSGQLPYLLDLLAVCVQTGMTIESAMNYLSKEMVGF 137

Query: 215 SVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRV 274
              L+  +  T          Q A +  Y       +R+    L QS +YG+SI   L  
Sbjct: 138 DKELAGLLKKTNDRARL-VGMQKALDELYEDIPSSEMRSFVMTLKQSLQYGSSIYGVLTT 196

Query: 275 LVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           L  + R  +++  E+K   L  K++VP+I+F +  ++++I  P IL ++ 
Sbjct: 197 LAGDIRDVQMLTLEEKIGKLAAKMSVPLILFIMMPIVILIAAPGILRMMS 246


>gi|87199098|ref|YP_496355.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134779|gb|ABD25521.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 324

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/312 (18%), Positives = 118/312 (37%), Gaps = 30/312 (9%)

Query: 13  ELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +L +  T  +    L YA +     S E+ +R++SV          ++ +  + + ++R 
Sbjct: 6   QLLLMSTGLMVAMVLGYAALSGPSASKEVNRRLQSVRFRHSESTLDKVEAQYRKTLAARK 65

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGI 132
                 +           +    E +  +L   G    ++L+  L V   + I+  +L  
Sbjct: 66  PKTMRPA----------GSSSRLEALELRLHRTG--KGWTLSQYLYVSGGLAILIFLLVY 113

Query: 133 IWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLI 192
           +                + A+    ++G   P + +   + KR  +     PDALDLL+ 
Sbjct: 114 LRTGA-----------PLLALGSGIFIGGGLPHMLVGRAINKRIDNFVTRLPDALDLLVR 162

Query: 193 CVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVR 252
            + SG+ + + L  VA ++ G   P+ EE  L    +      + A ++  +R  +    
Sbjct: 163 GLRSGLPVTETLGVVAAELPG---PVGEEFKLVTDRIKVGRTMEEALQDTADRLNLPEFN 219

Query: 253 NATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI- 311
                L      G ++ ++L  L    R    M+ + KA S   K +   I+  LP ++ 
Sbjct: 220 FFCITLAIQRETGGNLAETLSNLSDVLRKRAQMKLKIKAMSSESKASA-YIVGALPFIVF 278

Query: 312 --LVIIGPAILS 321
             +  I P  L 
Sbjct: 279 ALIYWINPVYLG 290


>gi|148258239|ref|YP_001242824.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146410412|gb|ABQ38918.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 324

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/304 (17%), Positives = 119/304 (39%), Gaps = 27/304 (8%)

Query: 24  IFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNF 83
           I  + +  + P L      ++       R  + K +    Q +      R +   SL++ 
Sbjct: 16  IGGIAWVFLYPMLSGERKAEQ------RRSSVAKSEPVVRQAERNQRSRREQVESSLKDL 69

Query: 84  VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLE 143
             K   ++ +    +  ++  AG   ++++               I+  +  F    +  
Sbjct: 70  EAKAQKQSKV---PLNLRISQAGL--DWTVQKFW-----------IISGVLGFMAAAIAF 113

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
           +     +GA+ L    GF  P   ++ L ++R+     A PDA+D+++  +++G+ + ++
Sbjct: 114 FGGGGPLGALGLGFAAGFGLPRWILNFLKKRREKKFLAALPDAVDVIVRGIKAGLPLFES 173

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ VA        PL  E L  I   +       A    Y R  +         +    +
Sbjct: 174 IKVVA---ADAPEPLRSEFLAIIETQAIGMPLGEACARLYERMPLPEANFFGIVVAIQQK 230

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV--IIGPAILS 321
            G ++ ++L  L    R  + M  + +A S+  K +  +I    P+++L+  +  P  +S
Sbjct: 231 SGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAGIIGSLPPIVMLLVYLSTPDYIS 290

Query: 322 IIDT 325
           ++ T
Sbjct: 291 LLWT 294


>gi|149909167|ref|ZP_01897824.1| putative type IV pilus protein [Moritella sp. PE36]
 gi|149807691|gb|EDM67637.1| putative type IV pilus protein [Moritella sp. PE36]
          Length = 294

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 68/312 (21%), Positives = 145/312 (46%), Gaps = 22/312 (7%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +++  AV++      + +   G  +  + +        + + ++ T L +  ++S L 
Sbjct: 1   MTLSLWIAVALLITGAVIALMFNGQAQRRELLLQRLTLVSVEQSRRFTHLPQAESTSSLW 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                             + V  +I   L  AGF    +    L+ ++ V +I  +    
Sbjct: 61  ----------------PRLNVAPDISMLLVKAGFHGPRAGAYFLLSKISVMLISGLAWQW 104

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           ++           +  +   ++    G      W+    +     I  A PDALDL++IC
Sbjct: 105 YVDFDLD------KFVLAKTLVFAISGGLLAEHWLKWRARTVNYRIALALPDALDLMVIC 158

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           VESG++++   +RV  ++   S  LS E L+T AEL  L +R  A  N   RT +  V N
Sbjct: 159 VESGLTLEAVFQRVGHEMTAVSPELSREWLITEAELRLLDSRLTALNNLAKRTDLVEVEN 218

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
              AL Q+++YG+ I  ++R++ S++R  + +  E+K   +  K+++P+++  +  ++++
Sbjct: 219 MVIALSQAEKYGSKIAPTMRLIASDSRQYQYLRLEEKVGKIPAKMSLPVVVLIMLPVVVL 278

Query: 314 IIGPAILSIIDT 325
           I+ P I++++D+
Sbjct: 279 IVAPTIIALLDS 290


>gi|319791197|ref|YP_004152837.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315593660|gb|ADU34726.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 296

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 64/316 (20%), Positives = 128/316 (40%), Gaps = 23/316 (7%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
             + + +AI    +   +I  + + SL                   R  + T +      
Sbjct: 1   MRSLILLAIIFLCATTGVILLLYMISLIRKA---------------RPSERTHMDPLPRM 45

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
            RL       L+  V ++   ++LV      +L+ AG          + V+ V  +I   
Sbjct: 46  LRLVWPVVNILQFHVSEIAPTSMLVKR--KRQLQLAGLEFVLKAEEFIAVQCVSMLIVAA 103

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           LG+      D         ++   +     G+  P +W+ +  ++R+  I R  P  LD+
Sbjct: 104 LGLWTAGLLDATAG----TKIWVTLASCVTGWLYPVMWMRDRRKRREKDILRTLPGYLDM 159

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           + +C ++G+S+  A+ +  +   G    L +E    + E+    +R  A     +R    
Sbjct: 160 ITLCCQAGLSLTGAIAQAVQKGPG--GALGQEFDRMMREMRTGASRMDALNALADRLDNK 217

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +++    L Q++  G S+ D+L  +  + R+ER   AEK A     K+  P++IF  PV
Sbjct: 218 HIKSLVSNLTQAESLGASLADTLSAISDQRRTERFQMAEKLAMEAPVKMIGPLVIFIFPV 277

Query: 310 LILVIIGPAILSIIDT 325
             ++I  P ++  ++T
Sbjct: 278 TFIIIFFPLVMQFLET 293


>gi|296134294|ref|YP_003641541.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032872|gb|ADG83640.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 320

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 114/310 (36%), Gaps = 26/310 (8%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
              + IF  ++      L +    +RM    +E+   R  +  +  +    S    +  +
Sbjct: 4   LVLLLIFGTVFVFSYFVLMAVTARRRMLIARMEQYTKRIYEADNRARKPKESINLKKLFQ 63

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
                    +    +  E I   +   G          +++ ++  +   IL  I+   +
Sbjct: 64  KSSKIFAARSFAKTMEAELIKADIPLRG-------EEFVLINVLCVLGMGILAFIFTGNF 116

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                           +    GF  P   +    QKR +       DAL ++   + +G 
Sbjct: 117 ------------VLGWVGASAGFIVPKYVVKAAKQKRVARFNAQIGDALIIMANSLRAGF 164

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S  QA+  V++++     P+S E    + E++     + A +N  NR + + +     A+
Sbjct: 165 SFLQAMELVSKEM---PAPISVEFARALREMNLGTATEEALQNLCNRVESEDLDLVITAV 221

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV---LILVII 315
           +   + G ++   L  +    R    ++ E K  +   +++  MI+  LPV   LIL +I
Sbjct: 222 LIQRQVGGNLSQILEGISHTIRERVRIKGEIKTLTAQGRISG-MIVGALPVGMGLILAVI 280

Query: 316 GPAILSIIDT 325
            P  + I+ +
Sbjct: 281 NPGYIGILFS 290


>gi|323495642|ref|ZP_08100713.1| type II secretion system protein F [Vibrio sinaloensis DSM 21326]
 gi|323319277|gb|EGA72217.1| type II secretion system protein F [Vibrio sinaloensis DSM 21326]
          Length = 296

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 57/307 (18%), Positives = 117/307 (38%), Gaps = 19/307 (6%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDS 77
           +   + + S+   VV+  L    L KR             +   S     + S       
Sbjct: 7   LYVFLQLCSVFLGVVLFVLVMYRLVKR-------------KLFLSQLSLKSDSNRMAGFM 53

Query: 78  KSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFG 137
             +   V K        ++ I  K + AG  ++       +      ++   +       
Sbjct: 54  DFVSEKVAK--PAVESNNQEINEKFKRAGISTKSRWFSFYMPIKYGALLVGGVSFYIYAT 111

Query: 138 YDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESG 197
              +        +   +    +    P   + +  + R + I    P  LDLL +CV++G
Sbjct: 112 ASDMESASMIAGLATWL---ILCIILPDAILDSRGKARIARISAQLPYLLDLLAVCVQTG 168

Query: 198 ISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQA 257
           ++I+ A+  +++++ G    L+  +  T          Q A +  Y       +R+    
Sbjct: 169 MTIESAMNYLSKEMIGFDKELAGLLKKTNERSRL-VGMQKALDELYEDIPSSEMRSFVMT 227

Query: 258 LIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGP 317
           L QS +YG+SI   L  L  + R  +++  E+K   L  K++VP+I+F +  ++++I  P
Sbjct: 228 LKQSLQYGSSIYGVLTTLAGDIRDVQMLGLEEKIGKLAAKMSVPLILFIMIPIVILIAAP 287

Query: 318 AILSIID 324
            IL ++ 
Sbjct: 288 GILRMMS 294


>gi|327189775|gb|EGE56919.1| putative tadC pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 314

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 63/290 (21%), Positives = 126/290 (43%), Gaps = 5/290 (1%)

Query: 25  FSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ-KDSASSRLRTRDSKSLRNF 83
             + +AV+I S  + EL  R + V+V                D+  + L   +++ +R +
Sbjct: 9   LIVFFAVLIFSAAASELFFRQREVSVRVSKSSAAAGDEFHLGDTTIADLGEAENRLIRRY 68

Query: 84  VKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLE 143
            +    +      +  N+L  AG+ +  ++    VVR V  +   +L             
Sbjct: 69  FE--ITRRDTNANSTQNRLIRAGYFAAGAVTTFQVVRAV--VCISVLVGAVWAANRIAPN 124

Query: 144 YPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQA 203
                 +   +      F   +++I      ++   +R +PD +D+L++C+++G+SI+ A
Sbjct: 125 MSQMATLILGMFAAGATFILVNIYIDRRGAAKEREYRRLFPDFMDMLIVCLDAGMSIEAA 184

Query: 204 LRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
             RVA +   +       + + + E+      + A  N   R ++D  R  +    QS+ 
Sbjct: 185 ANRVAREFVDKQQDFGLHLSIMMLEVRGGRRLREALANLATRLRIDEARALSVLFRQSEE 244

Query: 264 YGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            GTS+  +LRV   E R  R++ AE+KA +L  K+ +P+  F  PV + +
Sbjct: 245 LGTSVTQTLRVYSKEMRDIRVVRAEEKANALPVKMLLPLGAFLFPVSLFI 294


>gi|167845808|ref|ZP_02471316.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei B7210]
 gi|167894380|ref|ZP_02481782.1| bacterial type II secretion system protein F domain [Burkholderia
           pseudomallei 7894]
          Length = 237

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 122/238 (51%), Gaps = 1/238 (0%)

Query: 91  AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
                  +  +L +AGFR   +++++  ++LVV     +  +       ++ +Y   LRV
Sbjct: 1   DATQRMKLAARLASAGFREHRAVSVMAGLKLVVGACAGLAALALGAHVPRVGDY-VVLRV 59

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
             +     +G   P   +  ++ +RQ +I    PDALDLL+IC  +G S+  A+RRVA +
Sbjct: 60  LMMAGAFVIGMMLPEHALGFVLARRQKTIAAYLPDALDLLVICTNAGNSLAVAIRRVASE 119

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
           +     PL++E  +   EL    +   A      R  +  +R     L+QS +YGT I  
Sbjct: 120 LKTICPPLADEFSVCADELQIGGDAAFALNAMAARIGLPSMRALVTTLVQSQQYGTPITQ 179

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           SLR+L    R+ +++  E+KAA L PK+T+PM++F +P + L+  GPA++ +I     
Sbjct: 180 SLRMLSRTERAMQMIALEEKAAKLAPKMTLPMMLFVMPTVALIAAGPAVIRLIAVFHK 237


>gi|85859133|ref|YP_461335.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722224|gb|ABC77167.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 327

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/321 (15%), Positives = 114/321 (35%), Gaps = 29/321 (9%)

Query: 10  DATELAVAITTAVSIFSLIYA-VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
              +    +   +S+ +++   V + S  +   +KR+     ++  +  +Q   L  D  
Sbjct: 1   MDMDFLPFVIIFISVVAVVEGFVFLISWRTNPEKKRI----NQQLKMLSRQKEQLAYDDF 56

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
               +TR+  S+    +   L+ I         +  A      S+               
Sbjct: 57  DITRKTRELSSVPWLNE--LLQKIPRLLPTDRLIEQARAPYTMSVY-------------- 100

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           IL  + +F    L+ +         +  G      P +++      R        PDALD
Sbjct: 101 ILAALLLFFVGTLIFHALTKTFLVAVPAGLAMSYLPFLFLIMKKNSRMKKFDAQLPDALD 160

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ- 247
           L+   +++G +    ++ VA++      P+  E    + E +F    + A  N  NR   
Sbjct: 161 LMARALKAGHAFPGGIQMVAKEFDD---PIGIEFAKVVEETNFGVGVEEALRNLANRFDS 217

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
              ++    A++     G ++ + L  +    R    +    +  S   +L+  +I+  +
Sbjct: 218 SSDLKFFAIAVMIQRESGGNLAEILESIARIIRERFKLMGTIRTLSAEGRLSA-IILVAI 276

Query: 308 PVLILV---IIGPAILSIIDT 325
           P  +     I+ P  ++++ T
Sbjct: 277 PFFVAFALSIMNPQYITVLAT 297


>gi|218461009|ref|ZP_03501100.1| probable pilus assembly protein [Rhizobium etli Kim 5]
 gi|218662450|ref|ZP_03518380.1| probable pilus assembly protein [Rhizobium etli IE4771]
          Length = 335

 Score =  112 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 109/276 (39%), Gaps = 21/276 (7%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E+ R +   +  +    S+ R     +L++ ++K   +      ++ ++L  AG     S
Sbjct: 48  EVDRVKVKAARDRVQELSKRRKSVQDNLKD-LEKRQHEKTRKTLSMKSRLLQAGLPI--S 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           +    ++  +   + LI+  I    +           +  + +    G   P   +  L+
Sbjct: 105 VGKFYLISAIFASVLLIVAFIVGASW-----------MVMIGIAVVAGLGLPRWVLGFLI 153

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ+      P+ALD++   ++SG+ ++ A+R +       + P+  E    I      
Sbjct: 154 KRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGT---EGTEPVKSEFRRIIEAQQVG 210

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +   A         +  V      +    + G ++ +++  L    R  R M+A+  A 
Sbjct: 211 LSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSAL 270

Query: 293 SLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           S+  K +  +II  LP ++  ++    P  + I+ T
Sbjct: 271 SMEAKASA-VIIGALPFIVATLVYLTSPNYMMILFT 305


>gi|144897440|emb|CAM74304.1| Flp pilus assembly protein TadC [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 199

 Score =  112 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 73/151 (48%), Positives = 109/151 (72%)

Query: 177 SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQ 236
            ++ R +PDALDL++ICVE+G+S++ AL +V +++   +  L+EE+ LT AEL+FL +R+
Sbjct: 49  QALARGFPDALDLMVICVEAGLSVEAALLKVTDEMANSAPELAEEIGLTAAELAFLGDRR 108

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            A++N   RT +  V++ + AL+QS++YGT +  +LRVL  E R  R+  AEKKAASL  
Sbjct: 109 QAWDNLAERTGLAQVKSLSTALVQSEKYGTPVAQALRVLSQENRETRMAAAEKKAASLPA 168

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           KLTVPMI+FFLPVL +VI GPA + ++   K
Sbjct: 169 KLTVPMIVFFLPVLFIVIAGPAAIQVMAAWK 199


>gi|170724975|ref|YP_001759001.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810322|gb|ACA84906.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 281

 Score =  112 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/254 (19%), Positives = 104/254 (40%), Gaps = 9/254 (3%)

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
              L T     L    K +        E +  +   AGF         +  ++ + ++ +
Sbjct: 34  QRYLETSQESGLEKLSKLVVRVGQEKREELEQQFIEAGFYDTRFARFYVPAKIGLALVII 93

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +L +I         +     +V    +   +    P   ++   +       R  P  LD
Sbjct: 94  LLIVI--------SDMTLSNKVMIGAVAMVMTLIVPDSILAMRKKMLVKKTSRQLPYMLD 145

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++ +CV++G++++ AL  +AE++      L   +  T          + A      R   
Sbjct: 146 MMSVCVQTGMTVEAALAYLAEELKAFDKDLCFHIKKTADTSRI-TGLEKALLELSERIPT 204

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             VR+ +  LIQ+ +YGTSI + L  L  + R  +++  E+    L  K++VP+I+F + 
Sbjct: 205 PEVRSFSLTLIQNIQYGTSIANVLADLAEDMRQMQVLAMEESIGKLAAKMSVPLILFIMF 264

Query: 309 VLILVIIGPAILSI 322
            ++++I+ P  + +
Sbjct: 265 PIVVLILAPGFMQL 278


>gi|163851907|ref|YP_001639950.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|163663512|gb|ABY30879.1| type II secretion system protein [Methylobacterium extorquens PA1]
          Length = 323

 Score =  112 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 55/297 (18%), Positives = 110/297 (37%), Gaps = 28/297 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
                 AV+  SL Y  ++P+L               R   R++ +   Q   A      
Sbjct: 8   LTVGLVAVAAGSLAYVFLMPALSG-----------ERRAEQRRKALGQPQAVLAERGAAA 56

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              + +   +K+L  K       +  +L  AG   ++S     VV  +  ++  +   + 
Sbjct: 57  SRREQVAKSLKELEAKKDKTKVTLELRLARAGL--DWSRQKYRVVSAITAVVLALAAFLV 114

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                          + A + +   GF  P+ W+    ++R  +     P+A+D+++  +
Sbjct: 115 SHNV-----------IVAGLALFVGGFGLPAWWLKRRQKRRVEAFIEELPNAMDVVVRGL 163

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SGI +   LR +A        PL  E  +T+   +   +   A    Y R  +  V   
Sbjct: 164 RSGIPLGDCLRMIAR---EAKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTEVNFF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP ++
Sbjct: 221 SIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALPFVV 276


>gi|332284566|ref|YP_004416477.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
 gi|330428519|gb|AEC19853.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
          Length = 291

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 52/205 (25%), Positives = 97/205 (47%), Gaps = 2/205 (0%)

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
           +  +  + FL L +  +       +      +   +  G +G   P  W+  L ++RQ  
Sbjct: 85  IVAMQFMGFLALLLASVLVLQTSGDARLAHILLPCLGAGLIGMLWPRYWLHGLARQRQFQ 144

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           + R +P  LD+  +CVE+G+++  AL++ A+       PL  E+   +A++     R  A
Sbjct: 145 MLREFPFLLDMTTLCVEAGLNLHGALQQAAQHGPD--GPLRGELRHALADMRAGVPRIQA 202

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            +   +R  +  V++   AL Q+D+ G S+G  LR    + R+ER + AEK A     K+
Sbjct: 203 LQELADRCGLPAVQSLVTALAQADQLGMSLGPLLRSQSEQRRAERFLRAEKLALEAPVKM 262

Query: 299 TVPMIIFFLPVLILVIIGPAILSII 323
             PM+    P   L+I  P ++ ++
Sbjct: 263 LFPMVFCIFPCTFLIIGFPIVIKLL 287


>gi|170696831|ref|ZP_02887931.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170138259|gb|EDT06487.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 372

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 53/271 (19%), Positives = 115/271 (42%), Gaps = 6/271 (2%)

Query: 57  KQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNIL 116
           +    ++++      L  R + +   ++   ++   +V +     L   GF    +  + 
Sbjct: 104 RGTSANVKRARGMKGLLERCADAGTRWLD-TSVGRQVVAQEDRRLLEQCGFVDARARGLF 162

Query: 117 LVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQ 176
           L+ R+   I+  ++       +     Y     V  VI+    G  AP + +      R+
Sbjct: 163 LMARIAGAIMLPLVAGPIAHAHVDGPRY-----VLVVIVAFMCGVMAPKLVLRRRAAARR 217

Query: 177 SSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQ 236
            ++    P  +DLL +    G+S+DQ+L+ +  D  G    L+ E+ +   + +    R+
Sbjct: 218 GAVVDELPMLVDLLRLLQGVGLSLDQSLQVMVNDFRGVLPVLASELEIAQGQFAAGRTRE 277

Query: 237 VAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGP 296
            +     +    + +R   + LIQ DR+G ++ + L+      R  R     ++   +  
Sbjct: 278 QSLSRLASSFDNEDLRAVVRLLIQVDRHGGAVQEPLKQFGDRLRETRRAMLRERIGRMAV 337

Query: 297 KLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           K+T  MI+  LP L++V  GP ++S+  ++K
Sbjct: 338 KMTGVMILTLLPALMIVTAGPGVMSVSHSLK 368


>gi|116249985|ref|YP_765823.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254633|emb|CAK05707.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 110/276 (39%), Gaps = 21/276 (7%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E  R +   +  +    S+ R     +L++ ++K   +      ++ ++L  AG     +
Sbjct: 48  ESDRVKVKAARDRVQELSKRRKSVQDNLKD-LEKRQHEKTKKTVSMKSRLVQAGL--TIT 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
                ++  V   + L++ ++                +  + +    G   P   +  L+
Sbjct: 105 AAKFYLISAVFASVLLLIALVVGASL-----------MVMIGIAVVAGLGLPRWVVGFLI 153

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ+     +P+ALD++   ++SG+ ++ A+R +A      + P+  E L  I      
Sbjct: 154 KRRQTKFLNEFPNALDVITRSIKSGLPLNDAIRLIAT---EGTEPVKSEFLRVIEAQQVG 210

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +   A         +  V      +    + G ++ +++  L    R  R M+A+  A 
Sbjct: 211 LSIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSAL 270

Query: 293 SLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           S+  K +  +II  LP ++  ++    P  + I+ T
Sbjct: 271 SMEAKASA-VIIGALPFIVATLVYMTSPNYMMILFT 305


>gi|297581613|ref|ZP_06943535.1| flp pilus assembly protein TadC [Vibrio cholerae RC385]
 gi|297534020|gb|EFH72859.1| flp pilus assembly protein TadC [Vibrio cholerae RC385]
          Length = 305

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 52/299 (17%), Positives = 134/299 (44%), Gaps = 3/299 (1%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
             + I S     L   +     + +     Q    ++   +  +    ++     +    
Sbjct: 10  LLIAIVSFVGLLLVGMLLWRDQQMQTQWLAQSLRYRQLHLTDTMTENGTRHWLAVLGGYY 69

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
             +    + +   L  AG  S+ +L+ +   +L++ ++  +L + W +   +L      +
Sbjct: 70  PTSDTEKKRLTQMLEQAGIYSKDALDKVRGAKLLLGLLTAMLALGWQWSKGELF---TAM 126

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
            +   ++   +G   P   +    ++ +   ++   DA+DL++I +E+G+S+D+AL RV 
Sbjct: 127 TLTMALVGYVLGSNLPEYGLRRQSKQAKQRQQQIVADAMDLMVISIEAGLSLDRALERVG 186

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
             +      L+++ L T AE+  L +  +  +    RT +  +      L  + RYG+ +
Sbjct: 187 HYLLDVEPMLAKQFLRTHAEIQVLGDTALCMKKLAWRTGLQELERCAATLAMAQRYGSPL 246

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            +++R +  + R  R M  +++A  L  ++T+  + F +  L+++II P +  ++++++
Sbjct: 247 AETMRNISQDARQMRKMALQEQAGKLPGRITLIQMAFIMLPLLVLIIAPTLNVLLESLR 305


>gi|190889885|ref|YP_001976427.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|190695164|gb|ACE89249.1| probable pilus assembly protein [Rhizobium etli CIAT 652]
 gi|327194690|gb|EGE61536.1| putative pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 335

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 108/276 (39%), Gaps = 21/276 (7%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E+ R +   +  +    S+ R     +L++ ++K   +      ++ ++L  AG     S
Sbjct: 48  EVDRVKVKAARDRVQELSKRRKSVQDNLKD-LEKRQHEKTRKTLSMKSRLLQAGLPI--S 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           +    ++  V   + L +  +    +           +  + +    G   P   +  L+
Sbjct: 105 VGKFYLISAVFASVLLFVAFVVGASW-----------MVMIGIAVVAGLGLPRWVLGFLI 153

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ+      P+ALD++   ++SG+ ++ A+R +       + P+  E    I      
Sbjct: 154 KRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGT---EGTEPVKSEFRRVIEAQQVG 210

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +   A         +  V      +    + G ++ +++  L    R  R M+A+  A 
Sbjct: 211 LSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSAL 270

Query: 293 SLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           S+  K +  +II  LP ++  ++    P  + I+ T
Sbjct: 271 SMEAKASA-VIIGALPFIVATLVYLTSPNYMMILFT 305


>gi|307293453|ref|ZP_07573299.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881519|gb|EFN12735.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 332

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 60/307 (19%), Positives = 121/307 (39%), Gaps = 26/307 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   + +A+     +  +  A   PS      ++RM+ +           + +  + + 
Sbjct: 1   MNGNLILMAVLLTTMLGLIAMAFAGPSPDKAR-KRRMELIRGRHSDSADAILEARMRKAI 59

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           S+R    +S  L + V           EN+  ++R  G   +++++  +    V+ ++  
Sbjct: 60  SNRPTGAESTMLVSLV--------PNPENLAKRIRMTG--KKWTVSQYMTSCAVIFLVLC 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L ++  F             + AV+L    G   P +W+S L+ KR       +PDAL+
Sbjct: 110 ALLMLRGFA-----------PLFAVMLGLAAGLGLPHMWVSRLINKRVQQFTAKFPDALE 158

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL   + SG+ I + L  V+ ++ G   P+ EE  L    +        A +   +R   
Sbjct: 159 LLTRGLRSGLPIAETLGVVSSEVPG---PVGEEFKLITERIKIGKTMDQALQETADRLGT 215

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
              +    +L      G ++ ++L  L +  R    M+ + +A S   K +   II  LP
Sbjct: 216 AEFQFFVISLAIQRETGGNLAETLSNLATVLRQRSQMKLKIRAMSSESKASA-YIIGVLP 274

Query: 309 VLILVII 315
             +  +I
Sbjct: 275 FTVFGLI 281


>gi|91783015|ref|YP_558221.1| putative tight adherence TadC related transmembrane protein
           [Burkholderia xenovorans LB400]
 gi|91686969|gb|ABE30169.1| Putative tight adherence TadC related transmembrane protein
           [Burkholderia xenovorans LB400]
          Length = 337

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 57/270 (21%), Positives = 111/270 (41%), Gaps = 6/270 (2%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
           ++ T     +    L  R + +   ++        +V E     L   GF    +  + L
Sbjct: 70  KRATRHAPPTGLKGLLERFAHTGIRWLD-TPFGRQIVAEEDRRLLEQCGFVDTRTRGLFL 128

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
           V RL   ++  +L  +         ++     V  VI+    GF  P   +     KR++
Sbjct: 129 VARLAGAMVLPVLAGMLT-----RGQFEGSRYVALVIIAAMAGFMLPKFVLRRRAGKRRN 183

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
            +    P  +DLL +    G+S+DQ+L+ V  D  G    L+ E+ +   + +    R+ 
Sbjct: 184 GVVDELPLLVDLLRLLQGVGLSLDQSLQVVVNDFRGMLPVLAGELEIAQRQFTAGRTREQ 243

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           +          + +R   + L+Q DR+G ++ + L+      R  R     ++   L  K
Sbjct: 244 SLNRLATSYDNEDLRAVMRLLVQVDRHGGAVQEPLKQFGDRLRETRRAMLRERIGRLAVK 303

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +T  MI+  LP L++V  GP +L++  ++ 
Sbjct: 304 MTGVMIVTLLPALMIVTAGPGVLAVQHSLG 333


>gi|194288829|ref|YP_002004736.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222664|emb|CAQ68667.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 325

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 54/319 (16%), Positives = 115/319 (36%), Gaps = 30/319 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDS 67
                 A  I   V++   +  + +      G   KR+++       LR           
Sbjct: 1   MSTIFYAFGILLFVAVVLCVEGIYLWWNNAHGPAAKRIEA------RLRALSAGGHVGAE 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R         +   L  +     +   L  +G  S +S+  L     +V +  
Sbjct: 55  QLSILKKRLLADSPRLQQW--LMRVPRIGALDRWLEQSG--STWSVAQLFGYCALVVLCT 110

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           + L  +              L    V+L   +    P + + +L  KR   ++   PDA+
Sbjct: 111 VALIPLL------------PLPASLVMLGAVLAAMLPVLHVVHLRAKRLKQLEAQLPDAV 158

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++   + +G S   AL  V +++     P+  E   T  E+++      A  N   R  
Sbjct: 159 DMISRALRAGHSFSGALSMVGQEMK---APIGPEFRTTFEEINYGVALDEAMTNLAMRVP 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +R    A++     G ++ + L  + +  R    +  + +  S   KL+   ++  L
Sbjct: 216 VADLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVLSAEGKLSA-WVLGLL 274

Query: 308 PV---LILVIIGPAILSII 323
           P     ++++I P  ++++
Sbjct: 275 PFGTAGMILVINPGFMNVL 293


>gi|240139030|ref|YP_002963505.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
 gi|240009002|gb|ACS40228.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
          Length = 323

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 55/297 (18%), Positives = 112/297 (37%), Gaps = 28/297 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
                 AV+  SL Y  ++P+L               R   R++ +   Q   A      
Sbjct: 8   LAVGLVAVAAGSLAYVFLMPALSG-----------ERRAEQRRKALGQPQAVLAERGAAA 56

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              + +   +K+L  K       +  +L  AG   ++S     VV ++  ++  ++  + 
Sbjct: 57  SRREQVAKSLKELEAKKDKTKVTLELRLARAGL--DWSRQKYRVVSVITAVVLALVAFLA 114

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                          + A + +   GF  P+ W+    ++R  +     P+A+D+++  +
Sbjct: 115 SHNV-----------IVAGLALFVGGFGLPAWWLKRRQKRRVEAFIEELPNAMDVVVRGL 163

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SGI +   LR +A        PL  E  +T+   +   +   A    Y R  +  V   
Sbjct: 164 RSGIPLGDCLRMIAR---EAKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTEVNFF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP ++
Sbjct: 221 SIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALPFVV 276


>gi|148974880|ref|ZP_01811860.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
 gi|145965389|gb|EDK30638.1| Flp pilus assembly protein TadC [Vibrionales bacterium SWAT-3]
          Length = 288

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 59/309 (19%), Positives = 131/309 (42%), Gaps = 29/309 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
              +   VS+    Y +         +E R    +   E  R                  
Sbjct: 8   IWGVIFVVSMVLATYCLRFWDNTRANIETRRIIGSTREEKKR------------------ 49

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             +   ++ + +++       +    KL AAGF S++  +   ++++V   I LIL    
Sbjct: 50  --TDLFKSILSRISFNK----DETKRKLVAAGFYSDFLADAYYLLKIVPFSICLILIGFD 103

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
            +  +  + +     +GA++         P  ++S   +     I    P  LDL+ +CV
Sbjct: 104 FYSGETEVLFSLLYLLGALLAFVIA----PDAYVSARGKANIKHISSRLPFLLDLMNVCV 159

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G++I+ +L  +A+++      L+  + +T+         + A E FY        ++ 
Sbjct: 160 HTGMTIESSLEYLAKELHSIDSNLAHVVRVTVERSRL-VGLEKALEEFYALVPTSESQSF 218

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              ++QS ++G+S+G  L  L ++ R   +M+ E++   +G K+++P+I F +  ++++I
Sbjct: 219 VMTMVQSLQFGSSVGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVVLI 278

Query: 315 IGPAILSII 323
             P IL ++
Sbjct: 279 AAPGILRML 287


>gi|323525750|ref|YP_004227903.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323382752|gb|ADX54843.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 367

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 106/240 (44%), Gaps = 5/240 (2%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           ++   +V E     L   GF    +  + L+ R+   I+  ++       + +   Y   
Sbjct: 129 SVGRQVVAEEDRRLLEQCGFVDARARGLFLIARVAGAIVLPLVAGALGHAHVEGPRY--- 185

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             V  VI+    G  AP V +      R+ ++    P  +DLL +    G+S+DQ+L+ +
Sbjct: 186 --VLVVIVAFVCGVMAPKVVLRRRAAARRGAVVDELPMLVDLLRLLQGVGLSLDQSLQVM 243

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
             D  G    LS E+ +   + +    R+ +     +  + + +R   + LIQ DR+G +
Sbjct: 244 VNDFRGVLPVLSSELDIAQRQFAAGRTREQSLSRLASSFENEDLRAVVRLLIQVDRHGGA 303

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + + L+      R  R     ++   +  K+T  MI+  LP L++V  GP +LS+  ++K
Sbjct: 304 VQEPLKQFGDRLRETRRAMLRERIGRMAVKMTGVMILTLLPALMIVTAGPGVLSVSHSLK 363


>gi|299532823|ref|ZP_07046210.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719047|gb|EFI60017.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 311

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 66/291 (22%), Positives = 120/291 (41%), Gaps = 8/291 (2%)

Query: 37  GSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDE 96
              E   ++   A+ R         +     A           L       +L   LV +
Sbjct: 25  QRRERSSQVVQDALSRSGAAAANEAATPARPADLLRSLNGDGELPAHWLNTSLGKALVAQ 84

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
                L   G+ S  +    L+ R VV ++ ++L      G  +         +  +   
Sbjct: 85  EDRILLGKCGWGSTRAQLQYLIARCVVSVLLVLLAAFVFSGSKQF--------LLYLFAA 136

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +GF  P   + ++  +R++S+ R  P  +DLL +   +G+S+DQ L+ +  D G    
Sbjct: 137 FAIGFLLPKWVLRSVAGRRRASVARELPLLVDLLGLLQGTGMSLDQTLQVIGSDFGNVMP 196

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            LS E+ L   + S    R+ +F       Q D + N T  +IQ DRYG ++ + LR+  
Sbjct: 197 VLSREIKLANQQYSRGSTRERSFGRMSEVYQNDNLANLTSLMIQIDRYGGAVQEPLRIFG 256

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
              R +R  + ++    +  K+T  M++  LP LI++  GP  L++I  + 
Sbjct: 257 ERLREQRKAKMKELIGKISVKMTAVMVVTLLPALIIITAGPGFLAVIRALG 307


>gi|296284555|ref|ZP_06862553.1| hypothetical protein CbatJ_13051 [Citromicrobium bathyomarinum
           JL354]
          Length = 323

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 117/318 (36%), Gaps = 28/318 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D  +L +     ++   L+ A +       +L++R+  V          ++ S  K + 
Sbjct: 1   MDVIQLFILSLGFLAAIGLVAAALAGPSTRKQLQRRLSGVRTRHTDDANARVESQMKKAL 60

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           ++R       +                + +  +L+A G        +   + L V I  +
Sbjct: 61  AARKPKIQKAA----------GNGSRSQALALRLQATGMGWTVKQYVYASIGLAVMIGMI 110

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +                  + + + I    +G   P + +   +++R +     +PDA+D
Sbjct: 111 VYA-------------QTGVPLLSAIAGLLIGAGVPHMAVGFFMKRRTAQFNARFPDAID 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL+  + SG+ + + L  VA++I G   P+  E    I  +    + + A +   +R  +
Sbjct: 158 LLVRGLRSGLPVTETLAVVAQEIPG---PVGIEFKGIIERIKIGRSMEEAMQESADRLGI 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFF 306
                   AL      G ++ ++L  L    R    M+ + KA S   K +  ++  + F
Sbjct: 215 AEFNFFVIALAIQRETGGNLAETLSNLSDVLRKRAQMKLKIKAMSSESKASAYIVGSLPF 274

Query: 307 LPVLILVIIGPAILSIID 324
           L   ++  + P+ L    
Sbjct: 275 LVFAMIWWVNPSYLGAFF 292


>gi|309792340|ref|ZP_07686810.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225655|gb|EFO79413.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 325

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 88/241 (36%), Gaps = 14/241 (5%)

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           +       +I   L  A    + ++   + V+L+  ++ L++G+                
Sbjct: 65  VSKSKQGGDITRDLARADL--KLTVAEFMGVKLIAAVVGLLVGMYV-------GRANQAA 115

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
             GA ++   +   AP+++++   +KR  S      D + ++   +  G S  Q L  VA
Sbjct: 116 MFGAGLVGAVIFSFAPNIYLNMRAKKRIKSFNDQLGDTITMMANALRGGFSFLQTLDMVA 175

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
                   P+S E    + E+      + A ++   R   + +     A+      G ++
Sbjct: 176 R---DAPAPMSGEFRRVVQEVGLGRTTEEALQSLLRRMPSEDLDLLITAVNIQMEVGGNL 232

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFLPVLILVIIGPAILSIIDTM 326
              L  +    R    ++ E +  +   +++  +I  +     + + +I P  +  I + 
Sbjct: 233 AQILDTIGHTIRERVRIKGEIQTLTAQGRISGWVITGLPIGLAIFITMINPEYMMPIFSF 292

Query: 327 K 327
            
Sbjct: 293 G 293


>gi|299067811|emb|CBJ39022.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CMR15]
          Length = 325

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 51/320 (15%), Positives = 115/320 (35%), Gaps = 25/320 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   +   ++  V+I   +               R ++       L+   + S   D  
Sbjct: 1   MNTLMIGFLLSVFVAIALGVLGTYQWWSTH-----RSQTARRLSHRLQTALLNSASHDKE 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +S L+ R       F +   L+ +   + +   L  +G   ++S+  LL + L   ++  
Sbjct: 56  ASILKQRVLSDSPEFAQ--LLQRLPRIDVVDRFLLQSGL--DWSVGRLLGLSLASAVLAG 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L  +    +   L                 G   P +++     KR   ++   P+A D
Sbjct: 112 GLVSLLHPLWVAQLSITLM------------GASLPLLYVLRCRAKRLLRLEEQLPEAAD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL   + +G S+  AL     ++     P+  E+ L  +E+++      A     +R  +
Sbjct: 160 LLSRALRAGHSLPSALDMAGSEL---PAPIGAELALVFSEINYGVPMGDALTGLTDRVPI 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +     A++     G ++ + L  + S  R    +  + +  S   ++    I+  LP
Sbjct: 217 EDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVLSAEGRM-GGWILTLLP 275

Query: 309 VLILVIIGPAILSIIDTMKD 328
            ++ VI+      +I T+  
Sbjct: 276 PVVGVIVYELNPDLISTLWK 295


>gi|300741822|ref|ZP_07071843.1| putative type II secretion system protein F domain protein [Rothia
           dentocariosa M567]
 gi|300381007|gb|EFJ77569.1| putative type II secretion system protein F domain protein [Rothia
           dentocariosa M567]
          Length = 310

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 45/307 (14%), Positives = 103/307 (33%), Gaps = 5/307 (1%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
              A+      +   ++ A  +         +R+        I       +    ++   
Sbjct: 1   MNFAIIFGLFFAFGVMLIASSLRKRRGPNFGERIAPQMRSVSIRESLHRENQASGTSVLD 60

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                 + +              DE +  +LR AG  S+ +++     +++  +  + L 
Sbjct: 61  ALYSFLEPMMQSFLGRVRSTESRDEALAARLRRAG--SDQTVSAFRAEQILWAVSSVALL 118

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +         +      +  +IL G  GF A   W+  ++ +R+  +   +P   +++ 
Sbjct: 119 GVLSVIGLLENQLSLWSGLMLIILGGVTGFLARDWWLGQIIVRREKQLIAEFPALAEMMA 178

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           + V +G   + AL  +          L+ E    +A+     +   A   F   TQ+  +
Sbjct: 179 LSVAAG---ESALASLERICRTSRGELAREFNDILAQTRAGSSLLAALNEFAQSTQIPAL 235

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
                 +  +   GT + D LR    + R     E  + A      +  P++   LP+ +
Sbjct: 236 SRFVDGVAVAIERGTPLADVLRAQAQDVRDNAKRELLEVAGKKEIAMLAPVVFLILPLTV 295

Query: 312 LVIIGPA 318
           +  I P 
Sbjct: 296 VFAIFPG 302


>gi|222111305|ref|YP_002553569.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221730749|gb|ACM33569.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 288

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 52/224 (23%), Positives = 102/224 (45%), Gaps = 10/224 (4%)

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           LR AG     +       ++V  +   +LG++     +          +  +++I  + F
Sbjct: 73  LRRAGQDYALTPRQFFAGKVVSAVAGALLGVMLSGMLEG--------GLSIIVVIAMLAF 124

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P +W+    ++R  +I +A P  +DLL + +E+G+++  A+++      G   PL  E
Sbjct: 125 FYPDLWLKETTKQRNLAILKALPFFIDLLTLSIEAGLNLSGAMQQAVAKSAG--GPLMVE 182

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
           +   + ++     R  A  +F  R     + +   AL+Q ++ G+S+G  LR    + R+
Sbjct: 183 INRVLRDVRAGKARIDALRDFSARLDFTPITSFVSALVQGEKTGSSLGPILRAQAEQRRT 242

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           ER + AEK A     K+  P+I F  P   +VI  P  +  + +
Sbjct: 243 ERFLRAEKLAMEAPVKMLGPLIFFIFPCTFIVIGFPIAMKFLAS 286


>gi|186474107|ref|YP_001861449.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184196439|gb|ACC74403.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 326

 Score =  112 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 62/309 (20%), Positives = 115/309 (37%), Gaps = 26/309 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGS-GELEKRMKSVAVEREILRKQQITSLQKDS 67
            D T LA A+   V+I  LI  + +      G + KRM +       +R           
Sbjct: 1   MDTTLLAFAVLGFVAIVLLIEGLYVFWNSRHGPVVKRMDA------RIRAMSAGGHVSGE 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R       F +   L  +     +   L+ +G    +S+   +          
Sbjct: 55  QMSILKQRLLSESPTFTR--VLMRVPRVHLLDLYLQQSGLP--WSVGRFVGYSAASA--- 107

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
                   FG         +L V   + +       P V++ +   KR   ++R  PDA 
Sbjct: 108 --------FGGLLFGMGGMRLPVVLALPVAGGAALLPLVYLRSRRAKRVVQLERLLPDAA 159

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+   + +G S   AL  VA+++     PL  E  +   E++   +   A  N  +R  
Sbjct: 160 DLIARALRAGHSFPAALGMVADEL---PQPLGGEFRIAFDEINCGVSMNDALMNLVSRVP 216

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D VR    A++     G ++ + L  + +  R    + A+ +  S   +L+   I+  L
Sbjct: 217 VDDVRYFVIAVLIQREAGGNLAEILGNIATIIRERLKLLAKVRVLSAEGRLSA-WILGLL 275

Query: 308 PVLILVIIG 316
           P +++  + 
Sbjct: 276 PFIVIAALS 284


>gi|156741662|ref|YP_001431791.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232990|gb|ABU57773.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 327

 Score =  112 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 39/320 (12%), Positives = 104/320 (32%), Gaps = 32/320 (10%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
           D T         V I ++   +   S G+   E+R+   A  R    ++           
Sbjct: 6   DLTRFIAPAAIFVVILAVFALLARRSAGNASYEERLTQFAGRRTDQLQRSA--------- 56

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
                   + +   V +               L  A    + ++     ++L+   +   
Sbjct: 57  ----KDQLREIDKVVAR-----GKRGSETQRNLARADL--KLTVTEFYAIKLLAAAV--- 102

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
                      +    ++ ++ + I+   +    P +++    ++R +       D +++
Sbjct: 103 ----GAAVGAFIGRASWEAQLLSGIVGFALFSFFPDLYVGYAAKQRVTKFNAQLGDTINM 158

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           L   + SG S+ Q++  V+        P + E    + E+      + A +N   R   +
Sbjct: 159 LANSLRSGYSLLQSMELVSR---EAPEPTASEYRRVVQEVGLGLRTEDALDNLLKRVPSE 215

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFL 307
            +     A+      G ++   L  +    R    ++ E    +   +++  +I  +   
Sbjct: 216 DLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIAVLTAQGRISAYVITGLPIG 275

Query: 308 PVLILVIIGPAILSIIDTMK 327
             + + +I P  +S + +  
Sbjct: 276 LAIFITVINPNYMSPMFSFG 295


>gi|241207161|ref|YP_002978257.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861051|gb|ACS58718.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 335

 Score =  112 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 110/276 (39%), Gaps = 21/276 (7%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E  R +   +  +    S+ R     +L++ ++K   +      ++  +L  AG     +
Sbjct: 48  ESDRVKVKAARDRVQELSKRRKSVQDNLKD-LEKRQHEKTKKTVSMKARLVQAGL--TIT 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
                ++  V   + L++ ++    +           +  V +    G   P   +  L+
Sbjct: 105 AAKFYLISAVFASMLLLVALVVGASW-----------MVMVGIAVVAGLGLPRWVVGFLI 153

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ+      P+ALD++   ++SG+ ++ A+R +A      + P+  E L  I      
Sbjct: 154 KRRQTKFLNELPNALDVITRSIKSGLPLNDAIRLIAT---EGTEPVKSEFLRVIEAQQVG 210

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +   A         +  V      +    + G ++ +++  L    R  R M+A+ +A 
Sbjct: 211 LSIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVQAL 270

Query: 293 SLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           S+  K +  +II  LP ++  ++    P  + I+ T
Sbjct: 271 SMEAKASA-VIIGALPFIVATLVYMTSPNYMMILFT 305


>gi|114568974|ref|YP_755654.1| type II secretion system protein [Maricaulis maris MCS10]
 gi|114339436|gb|ABI64716.1| type II secretion system protein [Maricaulis maris MCS10]
          Length = 327

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/287 (17%), Positives = 109/287 (37%), Gaps = 23/287 (8%)

Query: 42  EKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNK 101
           +KRM        + R ++ TS    +A    R R  +     +++          +I  +
Sbjct: 31  KKRMNRAVGTGGLQRGRRQTSALDQAAQ---RKRQVQESLKDLEQRQRDQRKKSLSIKAR 87

Query: 102 LRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGF 161
           ++ AG    ++  +  +V   +    L++  I             Q  +    +    G 
Sbjct: 88  IQQAGM--SFTPAVFWMVSAGMAAAGLLIAFI-----------TGQSLLVTAGIGLVSGL 134

Query: 162 CAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEE 221
             P  W+  L  +RQ      + +ALD++   V+SG+ +++ L+ ++        P+  E
Sbjct: 135 GMPRWWLGFLRGRRQKQFSGEFANALDVITRGVKSGLPLNECLKILS---VESPEPVKTE 191

Query: 222 MLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS 281
               +  ++   +     +    R  +  +      LI   + G ++ ++L  L    RS
Sbjct: 192 FAKLVEGIAVGVSLPDGLDRMCERMPLPELNFFRTVLIIQQKTGGNLAETLGNLSVVLRS 251

Query: 282 ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIG---PAILSIIDT 325
            ++M  +  A S   K +   II  LP  ++ I+    P+ +  + T
Sbjct: 252 RKMMREKIGALSSEAKSSAA-IIGSLPPGVMGIVYATTPSYMGQMFT 297


>gi|303241938|ref|ZP_07328431.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590493|gb|EFL60248.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 289

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/241 (23%), Positives = 106/241 (43%), Gaps = 10/241 (4%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            L      E +   L  A   +  S+  +L   ++  +I   L  I + GY  +      
Sbjct: 58  RLMGNEYQEKMRIMLLQADMEN-VSVETVLFTSIIASVIAATLFSIILTGYGNI------ 110

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           L V   I   + GF  P  +I   V KR+  +       ++LL    ++G++ + A+ R+
Sbjct: 111 LAVFGFIAGAFTGFKIPEAYIKRKVDKRKDILNATILYYVELLSTACQAGLNTENAIERI 170

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A++    +  L++E+     E      R+ A ++   R   + VR   +++ Q    GT 
Sbjct: 171 ADN---TNSILADEIKRIWKESYKTKTREEAIQDMIQRCGTNEVRLFMESVGQGLEMGTP 227

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + D L+      RS    E  KK      K+  PMI+F LP ++LV + PA+++++  ++
Sbjct: 228 VTDILKDQARSIRSRAKSEIVKKGELAKVKIVFPMILFLLPSVLLVALTPALITLMKIIQ 287

Query: 328 D 328
           +
Sbjct: 288 E 288


>gi|311111713|ref|YP_003982935.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
 gi|310943207|gb|ADP39501.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
          Length = 310

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/307 (14%), Positives = 103/307 (33%), Gaps = 5/307 (1%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
              A+      +   ++ A  +         +R+        I       +    ++   
Sbjct: 1   MNFAIIFGLFFAFGVMLIASSLRKRRGPNFGERIAPQMRSVSIRESLHRENQVSGTSVLD 60

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
                 + +              DE +  +LR AG  S+ +++     +++  +  + L 
Sbjct: 61  ALYSFLEPMMQSFLGRVRSTESRDEALAARLRRAG--SDQTVSAFRAEQILWAVSSVALL 118

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
            +         +      +  +IL G  GF A   W+  ++ +R+  +   +P   +++ 
Sbjct: 119 GVLSVIGLLENQLSLWSGLMLIILGGVTGFLARDWWLGQIIVRREKQLIAEFPALAEMMA 178

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           + V +G   + AL  +          L+ E    +A+     +   A   F   TQ+  +
Sbjct: 179 LSVAAG---ESALASLERICRTSRGELAREFNDILAQTRAGSSLLAALNEFAQSTQIPAL 235

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
                 +  +   GT + D LR    + R     E  + A      +  P++   LP+ +
Sbjct: 236 SRFVDGVAVAIERGTPLADVLRAQAQDVRDNAKRELLEVAGKKEIAMLAPVVFLILPLTV 295

Query: 312 LVIIGPA 318
           +  I P 
Sbjct: 296 VFAIFPG 302


>gi|296158517|ref|ZP_06841347.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891085|gb|EFG70873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 293

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 112/267 (41%), Gaps = 3/267 (1%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKL-RAAGFRSEYSLN 114
           R     +               KSLR     +N        +   KL      +   +  
Sbjct: 22  RSLNGLAGAVPEEDRLFLDPLPKSLRPLWPLVNFVVHHFGNSFSAKLVEKTDLQLRLTSL 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
             L+       + +I  ++       L+       V  +IL+  +G+  P +W  ++ ++
Sbjct: 82  TFLMNARQFIALSIIASVLASLVVLVLMLALGMFSVLVLILVAALGYIYPRIWTRDVRRR 141

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R   I R  P  LD L + VE+G++I+ A+++  E   G   PL  E+   + +L    N
Sbjct: 142 RVGQILRHLPIYLDFLTLAVEAGLNINGAIQKSVE--KGPEGPLRRELEHVLRDLKSGLN 199

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R  A     +R ++  V N    ++Q++R G+ +  SLR    + RSER   AEK+A   
Sbjct: 200 RTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEA 259

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILS 321
             KL  P+++F  P+  +V+  P ++ 
Sbjct: 260 PVKLVFPLLMFIFPITFIVLGFPIVMK 286


>gi|86355868|ref|YP_467760.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279970|gb|ABC89033.1| probable pilus assembly protein [Rhizobium etli CFN 42]
          Length = 335

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 109/276 (39%), Gaps = 21/276 (7%)

Query: 53  EILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYS 112
           E+ R +   +  +    S+ R     +L++  K+ N +      ++ ++L  AG     +
Sbjct: 48  EVDRAKVKAARDRVQEMSKRRKSVQDNLKDLEKRQN-EKTKKTLSMKSRLVQAGL--TVT 104

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
           L    +   +   + L +  I    +           +  + +    G   P   I  L+
Sbjct: 105 LTQFYLFSAIFASVLLFMAFIIGASW-----------LVMIGIAFVAGLGLPRWVIGFLI 153

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ+     +P+ALD++   ++SG+ ++ A+R +A      + P+  E    I      
Sbjct: 154 KRRQNKFLNEFPNALDVITRSIKSGLPLNDAIRLIAT---EGTEPVKSEFRRVIEAQQVG 210

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
            +   A         +  V      +    + G ++ +++  L    R  R M+A+  A 
Sbjct: 211 LSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSAL 270

Query: 293 SLGPKLTVPMIIFFLPVLILVII---GPAILSIIDT 325
           S+  K +  +II  LP ++  ++    P  + ++ T
Sbjct: 271 SMEAKASA-VIIGALPFIVATLVYLTSPNYMIVLFT 305


>gi|254561625|ref|YP_003068720.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
 gi|254268903|emb|CAX24864.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
          Length = 323

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/297 (18%), Positives = 109/297 (36%), Gaps = 28/297 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
                 AV+  SL Y  ++P+L               R   R++ +   +   A      
Sbjct: 8   LAVGLVAVAAGSLAYVFLMPALSG-----------ERRAEQRRKALGQPKAVLAERGAAA 56

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              + +   +K+L  K       +  +L  AG   ++S     VV  +  ++  +     
Sbjct: 57  SRREQVAKSLKELEAKKDKTKVTLELRLARAGL--DWSRQKYRVVSAITAVVLALAAFFV 114

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                          + A + +   GF  P+ W+    ++R  +     P+A+D+++  +
Sbjct: 115 SHNV-----------IVAGLALFVGGFGLPAWWLKRRQRRRVEAFIEELPNAMDVVVRGL 163

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SGI +   LR +A        PL  E  +T+   +   +   A    Y R  +  V   
Sbjct: 164 RSGIPLGDCLRMIAR---EAKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTEVNFF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP ++
Sbjct: 221 SIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALPFVV 276


>gi|149909542|ref|ZP_01898196.1| bipartite nuclear localization signal containing protein, similarto
           TadC [Moritella sp. PE36]
 gi|149807447|gb|EDM67398.1| bipartite nuclear localization signal containing protein, similarto
           TadC [Moritella sp. PE36]
          Length = 296

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/249 (18%), Positives = 109/249 (43%), Gaps = 5/249 (2%)

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                L    + L+       + I  K  AAGF      ++ + V+ +V     I     
Sbjct: 50  ESKGFLERLSELLSKAFTSNQDEIKMKFIAAGFYQFKYASLFMPVKYLVLFSGGIG---- 105

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           ++   + + +     +  +     +    P   ++   ++    I    P  LDL+ +CV
Sbjct: 106 LYFLSESMAFESASLIAIIASWLVLIIILPDAVLNLRAKQLTEKISNKLPYLLDLMAVCV 165

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           ++G++++ A+  +++++      L+  ++ T           +A +  Y R   + +R+ 
Sbjct: 166 QTGMTLESAISYLSKEMTEFDKDLTNVLVKTNDRARI-VGLAMALDELYLRVPSNEMRSF 224

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L QS ++G+SI   L  L  + R  +++  E+K   L  K+++P+I+F +  ++++I
Sbjct: 225 VMTLKQSLQFGSSISQVLTTLSGDIRQVQILGLEEKIGKLAAKMSIPLIVFIMVPVVILI 284

Query: 315 IGPAILSII 323
             P I+ ++
Sbjct: 285 AAPGIMRMM 293


>gi|255327037|ref|ZP_05368113.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
 gi|255296254|gb|EET75595.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
          Length = 310

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/307 (16%), Positives = 111/307 (36%), Gaps = 5/307 (1%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
             L +     ++    +    + +  S     R+ S      +         +++ +   
Sbjct: 1   MNLPLIFGLLLAAGVGLILSSVLNTRSISFSDRVASQLRGETLRESLLKEQERREPSLLE 60

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
             +     L   +      + L D ++  +LR AG  S  S++     +L+  +  + + 
Sbjct: 61  AISAFCAPLLRSLSSSLSGSSLSDSSVQERLRRAG--SSQSVSAFRAEQLLWALAGVTVM 118

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
                       +   + +  V++ G  GF A   W+   V KR+  +   +P   +++ 
Sbjct: 119 SALTVIGVVQERFSILVALMLVLVSGLSGFLARDWWLGEAVTKREKQLVAEFPALAEMMA 178

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           + V +G S   AL R+          L+ E    +A+     +   A + F  RT++  +
Sbjct: 179 LSVTAGESALAALERIC---LTSRGELAREFSEILAQTRTGVSLLSALQEFAERTRVPAL 235

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
               + +  +   GT + D LR    + R     E  + A      +  P++ F LP+ +
Sbjct: 236 SRFVEGIAVAIERGTPLADVLRAQAQDVRDNAKRELMETAGKKEIAMLAPVVFFILPLTV 295

Query: 312 LVIIGPA 318
           +  + P 
Sbjct: 296 IFAVFPG 302


>gi|307726638|ref|YP_003909851.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307587163|gb|ADN60560.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 293

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/215 (24%), Positives = 98/215 (45%), Gaps = 2/215 (0%)

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
            +   +    L+       + +I  +I        +       V  ++    +G+  P +
Sbjct: 74  LQLRLTSLTFLMNAHQFIALSVIGAVIAALLALLAMLALGVFFVPVLLGAALLGYFYPRI 133

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W  ++ ++R + I +     LD L + VE+G++I+ A+++  E   G + PL  E+   +
Sbjct: 134 WTRDVRRRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVE--KGPAGPLRWELEHVL 191

Query: 227 AELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLME 286
            +L    NR  A     +R ++  V N   A++Q++R G  +  SLR    + RSER   
Sbjct: 192 RDLKSGLNRTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLAKSLRFQSEQRRSERFQR 251

Query: 287 AEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           AEKKA     KL  P+++F  P+  +V+  P  + 
Sbjct: 252 AEKKAMEAPVKLVFPLLVFIFPITFIVLGFPIAMK 286


>gi|78486064|ref|YP_391989.1| type II secretion system protein [Thiomicrospira crunogena XCL-2]
 gi|78364350|gb|ABB42315.1| Flp (type IV) pilus assembly protein, TadB homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 296

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/313 (17%), Positives = 117/313 (37%), Gaps = 17/313 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   +     +F     +V+ +    +         +E   LR   +   Q +    +  
Sbjct: 1   MVWVLLAVAILFFTATLLVVKTFKKNQ----QAQEDIEYLKLRIGLVNQYQANVNRHKTC 56

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                        +  K           L  AGFR E+ L     ++  +    L++ ++
Sbjct: 57  HWC-----ALGAFMGPKNEKEINANRQFLMNAGFREEHHLGAYFFIKYALVFSSLLVMLV 111

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                       FQ+     IL+       P   +      R + +  A PD LD+  IC
Sbjct: 112 L--------WSWFQVSPIVAILVPLAFLLLPERVLIFWGNHRLNKVNIALPDFLDMANIC 163

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           + +G+S  +A++RV++++      +  E    I ++     RQ A + F  R     +++
Sbjct: 164 MSAGLSYLEAIKRVSKELESTFPEICYEFNFLIEQIKIGVPRQEALKQFALRNPSKDIQD 223

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             Q LIQ+++ G+ I  +L         +R    E+KAA    K+ + ++ F +    ++
Sbjct: 224 LVQMLIQNEKLGSPISTALNEFSRRMYQKRESAMEEKAAKTSAKMAIVILPFLMLPYFML 283

Query: 314 IIGPAILSIIDTM 326
           ++G  I+ +    
Sbjct: 284 MLGEKIVMLGRNF 296


>gi|91777214|ref|YP_552422.1| putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
 gi|91689874|gb|ABE33072.1| Putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
          Length = 293

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 63/267 (23%), Positives = 111/267 (41%), Gaps = 3/267 (1%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKL-RAAGFRSEYSLN 114
           R     +               KSLR     +N        +   KL      +   +  
Sbjct: 22  RSLNGLAGAVPEEDRLFLDPLPKSLRPLWPLVNFVVHHFGNSFSAKLVEKTDLQLRLTSL 81

Query: 115 ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQK 174
             L+       + +I  I+       L+       V  +IL+  +G+  P +W  ++ ++
Sbjct: 82  TFLMNARQFIALSIIASILASLVTLLLMLALGMFSVLILILVAALGYFYPRIWTRDVRRR 141

Query: 175 RQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPN 234
           R + I R  P  LD L + VE+G++I+ A+++  E   G   PL  E+   + +L    N
Sbjct: 142 RVAQILRHLPIYLDFLTLAVEAGLNINGAIQKAVE--KGPEGPLRRELEHVLRDLKSGLN 199

Query: 235 RQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL 294
           R  A     +R ++  V N    ++Q++R G+ +  SLR    + RSER   AEK+A   
Sbjct: 200 RTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEA 259

Query: 295 GPKLTVPMIIFFLPVLILVIIGPAILS 321
             KL  P++ F  P+  +V+  P  + 
Sbjct: 260 PVKLVFPLLFFIFPITFIVLGFPIAMK 286


>gi|325963896|ref|YP_004241802.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469983|gb|ADX73668.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 313

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 104/308 (33%), Gaps = 6/308 (1%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           AV     + +   +     P + +  L +R++     + +  +   +  Q  +    L  
Sbjct: 8   AVISGFVMGVGLWLIVFRSPLMRATTLTERIEPQLKSQNLESRLLNSGEQNLTPFGPLER 67

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                 R+ +  L             +L  AG     S       +L+         +  
Sbjct: 68  ILRPVFRDAMAALGKLN-PSPGATTRRLAQAGI--NKSSLEFRAEQLLWAAAGFAAALGV 124

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                        L   AV+     GF     W+   V++R++ +   +P   +L+ + V
Sbjct: 125 TAIGAAAGRVNPLLAAVAVMGSAVGGFILRDYWLGAQVKRRETRMMAEFPSLAELMALAV 184

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G S   AL RV          LS E    +AE         A + F  RT +  +   
Sbjct: 185 SAGESATGALDRVCR---SAKGELSREFSNILAETRAGKPLVQALQEFSARTDLAPLVRF 241

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              ++ +   GT + D LR    + R     +  + A      + VP++   LP+ ++  
Sbjct: 242 VDGIVVAVERGTPLADVLRAQAQDVRDTAKRDLMEAAGKKEIAMMVPLVFGVLPLTVVFA 301

Query: 315 IGPAILSI 322
           + P + +I
Sbjct: 302 VFPGLAAI 309


>gi|193213110|ref|YP_001999063.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
 gi|193086587|gb|ACF11863.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
          Length = 322

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 122/318 (38%), Gaps = 35/318 (11%)

Query: 12  TELAVAITTAVSIFSLI---YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
           T   ++     ++  ++   Y V +         KR +  +++  +    Q  S+ + + 
Sbjct: 2   TTFLISFFAFAAVILIVLFAYGVWVNFFDPSNKAKRKRLKSIKSAVQWGGQSPSIAQINQ 61

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +        +S      +           + N L  A  RS +S   LL +   V I+ +
Sbjct: 62  NDSDLEIWLRSHYRVFVR-----------LENLLHRA--RSPFSALRLLGIMSAVFILVV 108

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +LG++                   + ++      +P +W+S    KR+ +     P+ALD
Sbjct: 109 MLGLLV------------HTNPIVLFVLAVAFASSPLLWLSRQANKRRQAFSEKLPEALD 156

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
            +   + +G S+  A+  V ++  G   P+ +E  +   E+SF    + A +   +R + 
Sbjct: 157 YVTRSLRAGHSLTSAIGIVGKEFPG---PIGQEFKIVFDEISFGIPFKEAMDRLADRVES 213

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +     +L      G ++ + L  L    R    +  + +  S   +++  +++  +P
Sbjct: 214 VDLNFFVISLEIQHETGGNLTELLEGLAKTIRERFKLRGKVRTLSAEGRISA-LVLGSMP 272

Query: 309 VL---ILVIIGPAILSII 323
            +   IL +I P   S++
Sbjct: 273 FILTAILTVINPEYTSVL 290


>gi|261251593|ref|ZP_05944167.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
 gi|260938466|gb|EEX94454.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio orientalis CIP 102891]
          Length = 284

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 115/257 (44%), Gaps = 6/257 (2%)

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
              R ++     V +  +     +     KL   G+ S  + +I +  R     I  ++ 
Sbjct: 33  RLDRVARFGAVQVSRGGILRWARNPKRAQKLAMFGYVSSQAESIFMTARASAMTIAGVVW 92

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
                    +  +   + V   I I           +   V   +  I +  PDALDL++
Sbjct: 93  FYSQQLSVDVGGFAQCVVVALSIGIVI------DRALDWRVNVVRQEIAKNIPDALDLMV 146

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           +CV SG S++     V +++   S  LS E L+T  E++ L + QVA  N   R  +  V
Sbjct: 147 VCVSSGQSLEATFNTVGQEMKSISPSLSREWLVTATEMAVLDSPQVALTNLDTRLALPEV 206

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
            N    + Q+ ++GT + D+L+++ S+ R   ++E E+    +  K++ P+++  +  ++
Sbjct: 207 NNMIVTMSQALKFGTPMADALKLIASDNRQYHMLELEEWVGKIPAKMSFPLVVLIMLPVV 266

Query: 312 LVIIGPAILSIIDTMKD 328
           ++I+ P +LS+  T+  
Sbjct: 267 VIIVAPMVLSLFQTLGQ 283


>gi|294139875|ref|YP_003555853.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
 gi|293326344|dbj|BAJ01075.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
          Length = 293

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 136/273 (49%), Gaps = 6/273 (2%)

Query: 56  RKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNI 115
           + +Q   +                 +N         I V ++I   L  AGF S+++ ++
Sbjct: 26  KARQRDGVVARLQLVERGAIAFSKPQNNNNNQLKSKIRVSDDIKALLLRAGFYSDHAASL 85

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
            +V +L+V I   I  + +            ++ +   ++   +G      W+    +  
Sbjct: 86  FVVAKLLVAISCFIGWMAYSGFSLD------KIILAKGVVFAVIGGIGVEHWVKFRARLV 139

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
            S I  A PDALDL+++CVESG++++    RV +++   S  LS E L+T AEL  L +R
Sbjct: 140 SSRIAGATPDALDLMVVCVESGLTLEAVFGRVGQEMVNFSPELSREWLITEAELRLLDSR 199

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
             A +N   RT +  + N   AL Q+++YG+ I  S+R++ S++R  + +  E+K   + 
Sbjct: 200 PQALKNLALRTGIIEIENMVIALSQAEKYGSPIAKSMRLIASDSRQHQYLALEEKVGKIP 259

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
            K+++P+++  +  ++++I+ P I+ ++ ++ +
Sbjct: 260 AKMSMPLVVLVMIPVVVLIVAPTIIELMTSIGE 292


>gi|283457757|ref|YP_003362345.1| Flp pilus assembly protein TadC [Rothia mucilaginosa DY-18]
 gi|283133760|dbj|BAI64525.1| Flp pilus assembly protein TadC [Rothia mucilaginosa DY-18]
          Length = 310

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/303 (17%), Positives = 112/303 (36%), Gaps = 8/303 (2%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
                + +    +++ S+ +         VA +      ++    ++D     L    S 
Sbjct: 5   LIFGLLLATGVGLILSSVLNTRSISFSDRVASQLRGETLRESLLKEQDRREPSLLEAISA 64

Query: 79  S---LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               L   +      + L D ++  +LR AG  S  S++     +L+  +  + +     
Sbjct: 65  FCAPLLRSLSSSLSGSSLSDSSVQERLRRAG--SSQSVSAFRAEQLLWALAGVTVMSALT 122

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                   +   + +  V++ G  GF A   W+   V KR+  +   +P   +++ + V 
Sbjct: 123 VIGVVQERFSILVALVLVLVSGLSGFLARDWWLGEAVTKREKQLVAEFPALAEMMALSVT 182

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G S   AL R+          L+ E    +A+     +   A + F  RT++  +    
Sbjct: 183 AGESALAALERIC---LTSRGELAREFSEILAQTRTGVSLLSALQEFAERTRVPALSRFV 239

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
           + +  +   GT + D LR    + R     E  + A      +  P++ F LP+ ++  +
Sbjct: 240 EGIAVAIERGTPLADVLRAQAQDVRDNAKRELMETAGKKEIAMLAPVVFFILPLTVIFAV 299

Query: 316 GPA 318
            P 
Sbjct: 300 FPG 302


>gi|221633001|ref|YP_002522226.1| type II secretion system protein F domain [Thermomicrobium roseum
           DSM 5159]
 gi|221156079|gb|ACM05206.1| Bacterial type II secretion system protein F domain
           [Thermomicrobium roseum DSM 5159]
          Length = 323

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 121/316 (38%), Gaps = 30/316 (9%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +F    L +A++ A +   L+ A +        L+ R++  A        +  ++ ++ +
Sbjct: 1   MFGDPLLLIAVSLAGAAVMLVLAGLHARSRGHSLDHRLEQFA--------RSESAPEEVT 52

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
           A   L  R             ++     E I   L  A  R   ++   L +R +V ++ 
Sbjct: 53  AGPHLLARQLDR--------AVRGRPFAEAIRMSLARADIR--LTVGEFLFLRGLVTLLA 102

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
            ++G +   G  +       L +   ++    G+ AP  ++    + R         D +
Sbjct: 103 FVIGFLLGRGITQ-----PLLGLFTGLVFAVSGWLAPHYYVLWRGRHRLQRFVNQLGDTI 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
            L+   + +G S+ Q +  VA      + P+SEE    + E+      Q A ++   R  
Sbjct: 158 GLMANSLRAGYSLLQTMDLVAR---ESAPPMSEEFRRVVREVGLGVPLQDALDHLLERIP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +     A+  +   G ++   L ++    R    ++ E +  +    L+   II  L
Sbjct: 215 SEDLDLLVTAIAINHEVGGNLAQILEIIGETIRERVRIKGEIRVLTAQQSLSG-YIISLL 273

Query: 308 PV---LILVIIGPAIL 320
           PV   +++ ++ P+ L
Sbjct: 274 PVGLAILIFLLNPSYL 289


>gi|317124421|ref|YP_004098533.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315588509|gb|ADU47806.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 314

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/312 (16%), Positives = 109/312 (34%), Gaps = 8/312 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            A+  A+     +    +P      LE+R+     +  +  +   +     +    L   
Sbjct: 10  AAVGVAMLAGLSLIGAGLPWRRRATLEQRLAPYLRDAPMPSRLLGSGPSTLTIFG-LGDL 68

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
            +  LR+               +  +L  AG  ++  L      +++       LG++  
Sbjct: 69  LAPYLRSLGAGFERVLGGGPSVVRRQL-RAGRGAD--LERFRAEQVLWATGGAALGLLGS 125

Query: 136 FGYDKL-LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                    +   + V   ++   VG       +S   ++R+  +   +P   +LL + V
Sbjct: 126 GVLAVSKRSFSVPMLVLLTVIGVAVGAVLRDYSLSRAARRREQRMLAEFPTVAELLALAV 185

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G     AL RV          L++E+   +A+     N   A +   +RT +  +   
Sbjct: 186 SAGEGATGALERVCRL---SDGELADELRRCLADARAGANLPTALQGLADRTGLPSLSRF 242

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              ++ +   GT + D LR    + R +      ++       + VP++   LPV +L  
Sbjct: 243 VDGIVVAVERGTPLADVLRAQAQDVREDGRRVLMEQGGKREIVMMVPVVFLILPVTVLFA 302

Query: 315 IGPAILSIIDTM 326
           I P +  +   +
Sbjct: 303 IYPGLSFLRFEL 314


>gi|75674495|ref|YP_316916.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
 gi|74419365|gb|ABA03564.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
          Length = 324

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 120/320 (37%), Gaps = 29/320 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDS 67
            +   LA+A   A ++  + +  + P L    + EKR  ++A     +R+       +  
Sbjct: 1   MNLQTLALAFMAATAVGGVAWVFLYPVLSGEMKAEKRRAALARTSPAIRQVDRAQRSRRE 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                     +           +       + N++  AG    +S    L+V  ++ +  
Sbjct: 61  QIEESLREIEQR----------QKRDRKVTLNNRIAQAGL--SWSKEKFLIVSGILALAS 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + I+   G        F    G            P   +  L ++R+++  RA PDA+
Sbjct: 109 FAVPIVLGAGPLAAAGLAFAAGFGV-----------PRWLLGFLKKRRETAFLRALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ + ++L+ VA        PL  E    I   +       A    Y R  
Sbjct: 158 DVIVRGIKAGLPLFESLKVVA---ADSPEPLKSEFAAIIETQAIGMPLGEACSRLYERMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + KA S+  K +  +I    
Sbjct: 215 VPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIKAVSMEAKASAAIIGSLP 274

Query: 308 PVLILV--IIGPAILSIIDT 325
           P+++L+  +  P  ++++ T
Sbjct: 275 PIVMLLVYLSTPDYIALLWT 294


>gi|254420696|ref|ZP_05034420.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186873|gb|EDX81849.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/314 (15%), Positives = 121/314 (38%), Gaps = 23/314 (7%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +  A+   ++I  L +  V     SG+  KR +++   +    K +  +   ++  +R +
Sbjct: 4   ILAAVLAFITIGGLGWVFVGGDDSSGQAVKRAQNLGEGKRNAAKARKAAAAANTPEARRK 63

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               +     +++   +      N+  KL+ AG     S+    +V   V +I  +  + 
Sbjct: 64  QIMVQ-----LQEAERRERKARANMAAKLKQAGL--TISVRTFYIVSGGVGLIAAVAALA 116

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +               +  + L   VG   P   +  L + R       +P+A+D+++  
Sbjct: 117 FGL-----------HVLIVLGLAIVVGLGLPRWIVGFLAKARMKKFSLEFPNAVDVIVRG 165

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ++SG+ + +  + +A        PL       +  L      + A +  + +     +R 
Sbjct: 166 IKSGLPVHECFKIIAR---ESPAPLGPAFKKLVEALGVGMTLEQALDKMFEQMPTPELRF 222

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  +    + G ++ ++L  L +  R+ R+M  + KA S     +  +I    P ++ +
Sbjct: 223 FTIVIAIQQKTGGNLAEALSNLSTVLRARRMMREKVKALSSEALASAGIIASLPPAVMTM 282

Query: 314 II--GPAILSIIDT 325
           ++   P  +  + T
Sbjct: 283 VMFTSPGYMMALFT 296


>gi|307730002|ref|YP_003907226.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307584537|gb|ADN57935.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 353

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 102/239 (42%), Gaps = 5/239 (2%)

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           +    V       L   GF    +  + L+ R+   ++  +          +   Y    
Sbjct: 116 VGRQFVAHEDRRLLEQCGFVDARARGLFLIARVAGAVVLPLAAGTLAHAQVQGPRY---- 171

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
            V AVI+    G  AP V +      R++++    P  +DLL +    G+S+DQ+L+ + 
Sbjct: 172 -VLAVIVAFVCGVMAPKVVLRRRAAARRAAVVDELPMLVDLLRLLQGVGLSLDQSLQVMV 230

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            D  G    LS E+ +   + +    R+ +     +    + +R   + LIQ DR+G ++
Sbjct: 231 NDFRGVLPVLSGELEIAQRQFAAGRTREQSLARLASSFDNEDLRAVVRLLIQVDRHGGAV 290

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            + L+      R  R     ++   +  K+T  MI+  LP L++V  GP +LS+  ++K
Sbjct: 291 QEPLKQFGDRLRETRRAMLRERIGRMAVKMTGVMILTLLPALMIVTAGPGVLSVSHSLK 349


>gi|282865305|ref|ZP_06274357.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559778|gb|EFB65328.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 295

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 64/305 (20%), Positives = 120/305 (39%), Gaps = 26/305 (8%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
            EL +A    ++++   + + +            ++ A     L         + + +  
Sbjct: 1   MELLIAAVFGLAVYGAFHGIRMY-----------RAEAELPGDLAVALEVGASRTTVTGS 49

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
              R        V ++        + +  KL  AG     +++     R V   +  I  
Sbjct: 50  AIDRMGMRYAPRVLRMMGPK--RVDKVRRKLDMAGNPGGMTVDRYAARRAVYTGLGGIAA 107

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           +  +                  +L G  G+    V I + + +R+  I R  PD LD+L 
Sbjct: 108 LSMLMNGQT----------VLAVLFGVYGYFWTDVIIRSAISRRKDDIDRTLPDFLDVLA 157

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
           + V +G+   QAL RVAE     S P ++E+ +T+ ++    +R+ AF+    R + + V
Sbjct: 158 VVVSAGLGFRQALERVAEKY---SGPWADELRITLRQMDMGVSRREAFDQLRKRNESEQV 214

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
                AL Q +  G  I D+L  + ++ R      A +KAA   PK T+ +  F LP  +
Sbjct: 215 SMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARRKAAKAVPKATLIVTSFMLPGTM 274

Query: 312 LVIIG 316
           ++I  
Sbjct: 275 ILIAV 279


>gi|116671473|ref|YP_832406.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611582|gb|ABK04306.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 292

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/280 (23%), Positives = 131/280 (46%), Gaps = 11/280 (3%)

Query: 48  VAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGF 107
           +  +R+     Q    +   AS       +  L    ++L       +  +   L  AG 
Sbjct: 24  IVADRKSRLVIQGNLSKGLEASGAATAPQNMDLERMARRLTPSGY--EAKLDRLLALAGR 81

Query: 108 RSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
            S   L  LLV +  + ++  +L ++ +              +   +    + +  P + 
Sbjct: 82  PSSMPLPRLLVAKPALALVVAVLMMLML------SRNGSAQMILLAVFATGLAYFVPDLL 135

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           I +  Q+RQ  I+   P+ LD +LI VE+G+  + A+ R  ++  G   PL+EE++ T+ 
Sbjct: 136 IYSRGQERQKKIQLELPNTLDQMLIAVEAGLGFESAMARAGQNGKG---PLAEELIRTLQ 192

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           ++    +R+ ++     R+ +  +R   +A++Q+D YG +I   L+    E R +R   A
Sbjct: 193 DMQVGRSRRDSYLALAERSNVQDLRTFVRAVVQADTYGIAIAKVLKAQAKEMRVKRRQRA 252

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           E+KA  L   +  P+++F  PV+ +VI+GPA+++II+   
Sbjct: 253 EQKAMKLPVLVLFPLLLFIFPVIFIVILGPAVINIIEAFS 292


>gi|257069182|ref|YP_003155437.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
 gi|256560000|gb|ACU85847.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
          Length = 314

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/305 (20%), Positives = 123/305 (40%), Gaps = 10/305 (3%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVERE--ILRKQQITSLQKDSASSRLRTRD 76
             + ++  L++   +  +       R + +    +  + R + ++      ++SRLR   
Sbjct: 7   LLSGAVLGLLFGAGVALVAGQLPWLRSRDLDARIDPYLRRSRSMSLFAAPRSTSRLRMVL 66

Query: 77  SKSLRNFVKKLN---LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
              L     ++     +    ++ +  +LR AG RS  S +   V ++V   I L+LG++
Sbjct: 67  ENLLGPVAVRVLGVLERLTGGNDQLERRLRLAGRRS--STDSFRVEQVVFGAIGLVLGVV 124

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                  L      L +  V      G       +   +++R + + R +P   DLL + 
Sbjct: 125 LAVMAIALRGSSPLLGLVIVGFGALTGVLLRDYLLGVEIKRRATRMAREFPTVADLLALA 184

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G S   A+ RVA         L +E   T+A++    +   A  +   RT +D +  
Sbjct: 185 VAAGESPIAAMERVAR---TSHGALPDEFAATVADIRAGTSVSQALASLGTRTPLDSLGR 241

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
             + +  +   GT + + LR    + R E   E  + A      + VP++ F LP++I+ 
Sbjct: 242 FGEGVSIAIERGTPLAEVLRAQAQDAREESKRELMETAGQREILMLVPVVFFVLPLVIVF 301

Query: 314 IIGPA 318
            I P 
Sbjct: 302 AIFPG 306


>gi|113867007|ref|YP_725496.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525783|emb|CAJ92128.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 293

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/303 (21%), Positives = 123/303 (40%), Gaps = 17/303 (5%)

Query: 22  VSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLR 81
           V  F+L   +V     +    +R+     +      +    L     S R      +   
Sbjct: 4   VVAFALAAGLVGVLAATTMAMRRLTVAVPD------EARDYLDPLPPSLRAVWPVVRFFD 57

Query: 82  NFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKL 141
           + +  +  K++     +  +LR  G     +    L + +V  + F +L  I + G    
Sbjct: 58  HHLVWITPKSL--RAAVDEQLRLTGMSFLMTARQFLSLSIVSALAFCLLAGIAMLGLGVF 115

Query: 142 LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISID 201
                             GF  P +W+ ++ ++    + R  P  LD L + VE+G++I+
Sbjct: 116 SPLLLLAASAL-------GFFYPRIWLRDVRKRNLLQVTRHLPVFLDFLTLSVEAGLNIN 168

Query: 202 QALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS 261
            AL +  E   G   PL  E    + +L    +R  A     +R ++  V N   A+IQ+
Sbjct: 169 GALLQAVE--KGPEGPLRREFEHVLRDLKSGLSRADALRRMDDRLRVKEVTNFVGAVIQA 226

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
           +R G+ +  +LR    + R+ER   AEK+A     KL  P+++F  PV  +V+  P ++ 
Sbjct: 227 ERMGSGLAATLRFQSEQRRTERFQRAEKQAMEAPVKLIFPLVVFIFPVTFIVLGFPIVMK 286

Query: 322 IID 324
            + 
Sbjct: 287 FMQ 289


>gi|296444391|ref|ZP_06886356.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
 gi|296258038|gb|EFH05100.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
          Length = 322

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 116/309 (37%), Gaps = 30/309 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDS 67
            D   L  A   A+++  ++YAVV P L    + +KR  ++    +  R+ +     K  
Sbjct: 1   MDRQSLIGATLAALAVGGVMYAVVYPYLSGDFKAQKRTAALMASGDRRREGRSADPAK-- 58

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R     SL++   K           +  ++  AG     S             +F
Sbjct: 59  ----RRKMIQDSLKDIETK------AKQITLEQRIAQAGLAVSRS-------------LF 95

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           +I   +             Q  + A+ +   VG   P   +  L ++R +    A+P ++
Sbjct: 96  MIGAGVAGLFAALFSFILNQDPLLAIGVGVAVGVGLPHWGLGFLARRRVAKFIEAFPGSV 155

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ +    R +A        P+  E    +   +   +   A E F  R  
Sbjct: 156 DIIIRGIKAGLPVGDCFRMIAS---EADEPVRSEFRQIVESQTIGLSIGEATERFAERMP 212

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +      +  +   ++ G ++ ++L  L    R  + M+A+ +A S   K +   II  L
Sbjct: 213 VAEASFFSIVISLQEKSGGNLSEALSNLAGVLRERKKMKAKVRAMSAEAKASAG-IIGSL 271

Query: 308 PVLILVIIG 316
           P L+ + + 
Sbjct: 272 PFLVGLAVW 280


>gi|145299824|ref|YP_001142665.1| flp pilus assembly protein FlpH [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866591|gb|ABD57359.1| FlpH [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852596|gb|ABO90917.1| flp pilus assembly protein FlpH [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 294

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/296 (20%), Positives = 130/296 (43%), Gaps = 4/296 (1%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKA 91
           V+   G         +V   R   ++QQ  +        R R   ++    +  +     
Sbjct: 3   VMQLFGLALACLASAAVVGWRGYQQQQQWQAQSHRYGPVRQRRDAARDWLAWCGRGYPVG 62

Query: 92  ILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVG 151
                 +   L  AG  S +  + L   +L+  +   +  ++W         +     + 
Sbjct: 63  AREQARLQQLLAQAGIFSRHGFDRLRAAKLLGGLGGALAALLWRLLAAPADGFT----LM 118

Query: 152 AVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
            V++   VG   P  W+    +K +S+ ++  PDA+DLL+I VE+G+++D+AL RV   +
Sbjct: 119 WVLVAYVVGAGVPERWLQWRARKVKSAQQKVVPDAIDLLVISVEAGLALDRALLRVGHYL 178

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
           G     L+ + L T AE+    ++         RT +  +      L  + +YG+ + ++
Sbjct: 179 GALEPGLARQFLRTHAEIQMRGDQASCLARLAWRTGLPELDRLANTLQMAQQYGSPLAET 238

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           +R +  E R  R +  E++A SL  K+T+  +   +  ++++II P +  +I++++
Sbjct: 239 MRTISQEARQMRRLALEEQAGSLPGKITLIQMALIMLPMLVLIIAPTLNLLINSLR 294


>gi|17545370|ref|NP_518772.1| tight adherence TadB-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427662|emb|CAD14181.1| probable pilus assembly tadb transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 325

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/320 (15%), Positives = 111/320 (34%), Gaps = 25/320 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            +   +   ++  V+I   +               R   ++   E       +  ++ S 
Sbjct: 1   MNTLMIGFLLSVFVAIALGVLGAYQWWSTHRSQTAR--RLSHRLETALLNSASHNKEASI 58

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
             +    DS      +++L        + +   L  +G   ++S+  LL + L    I  
Sbjct: 59  LKQRVLSDSPEFARLLQRL-----PRIDMVDRFLLQSGL--DWSVGRLLGLSLASAAIVG 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            L  +    +   L                 G   P +++     KR   ++   P+A D
Sbjct: 112 GLVWLLHPLWVAQLSITLM------------GASLPLLYVLRCRAKRLLRLEEQLPEAAD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           LL   + +G S+  AL     ++     P+  E+ L  +E+++      A     +R  +
Sbjct: 160 LLSRALRAGHSLPSALDMAGSELP---APIGAELALVFSEINYGVPMNDALAGLTDRVPI 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +     A++     G ++ + L  + S  R    +  + +  S   ++    I+  LP
Sbjct: 217 EDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVLSAEGRM-GGWILTLLP 275

Query: 309 VLILVIIGPAILSIIDTMKD 328
            ++ VI+      +I T+  
Sbjct: 276 PVVGVIVYELNPDLISTLWK 295


>gi|254521552|ref|ZP_05133607.1| type II secretion system protein [Stenotrophomonas sp. SKA14]
 gi|219719143|gb|EED37668.1| type II secretion system protein [Stenotrophomonas sp. SKA14]
          Length = 311

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/309 (19%), Positives = 120/309 (38%), Gaps = 11/309 (3%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
            + + + + +  +          E+R  +        R +          S        +
Sbjct: 9   LSLLVLAAGVALLGFAGWVRSHREQRTSATLKTALQPRDEAREVEATGRDS----LGWLE 64

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
                +    L+A L+       L  AG+ +     I L VRL++        ++ +   
Sbjct: 65  RFGRSLSGGRLEAALLANEDRLLLDLAGWNTRRGTAIYLGVRLLL-------ALLVLALA 117

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
               E     ++  VI     G   P   +S  V++R+ +++   P  +DLL +    G 
Sbjct: 118 LAFSEATGLAKIMVVIGALAAGLLLPKFALSAWVKRRRRAVENELPLLIDLLRLLQGVGF 177

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ+L+ + + +      L  E+       +    R  +     +    D + +  Q +
Sbjct: 178 SMDQSLQTLGDKLRDALPILGGELQEANVAYTHGRTRAQSLRRLSDVYGDDDLSSLVQLI 237

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           +Q   +G ++ + LR      R +R    ++K   L  K+TV M++  LP L+LV+ GPA
Sbjct: 238 LQVHAHGGAVQEPLRQFSIRLREQRRNSLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPA 297

Query: 319 ILSIIDTMK 327
           ++++  TM 
Sbjct: 298 LVALAATMS 306


>gi|163857687|ref|YP_001631985.1| putative Flp pilus assembly protein [Bordetella petrii DSM 12804]
 gi|163261415|emb|CAP43717.1| putative Flp pilus assembly protein [Bordetella petrii]
          Length = 332

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/300 (18%), Positives = 116/300 (38%), Gaps = 3/300 (1%)

Query: 29  YAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN 88
             +V    G     + ++     R+  R        + +       + + +L   + +  
Sbjct: 29  LGMVWRLRGQARSMRVVEQALAGRDPARAALPADESQPAGRLAALAQSTDALGKRLSEGR 88

Query: 89  LKAILVDENIVNKLRAAGFRSEY-SLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           L   L+ +     +  AG+     +    +V+R  + +   +  ++    +  L      
Sbjct: 89  LAESLLPDEDNKLIELAGYAKPAHARARYVVLRFGLALALPMAAVLARRAW--LGPGSMM 146

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             V  + +   VG+  P   +   V+ R+    +  P  +DLL +    G+S+DQ+L  +
Sbjct: 147 ALVFTLFIGFAVGYLLPKWMLVRRVKARKKQAGKELPLLVDLLRLLQGVGLSVDQSLSVI 206

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
             D       L  E  ++ A  +    R+ +          D +    + L+Q DR+G +
Sbjct: 207 VNDFTPVLPVLGHEFGVSTAVYARGRTREQSLARLSQGFDDDDLAAICRLLVQVDRHGGA 266

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + + L       R +R  E ++K   L  K+T  MI+  LP L++V  G  ILS++  + 
Sbjct: 267 VQEPLNRFAQRIRDKRRFELKEKIGRLTVKMTGVMIVTLLPALLIVTGGMGILSVLRGLS 326


>gi|94309585|ref|YP_582795.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353437|gb|ABF07526.1| flp pilus assembly protein TadB [Cupriavidus metallidurans CH34]
          Length = 325

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 54/319 (16%), Positives = 115/319 (36%), Gaps = 30/319 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSL-GSGELEKRMKSVAVEREILRKQQITSLQKDS 67
                 A  I   V++   + A+ +      G   KR+++       LR           
Sbjct: 1   MSTIFYAFGILLFVAVVLSVEAIYLWWNNAHGPAAKRIEA------RLRALSAGGHVSAE 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R         +   L ++     +   L  +G  S +S+            +F
Sbjct: 55  RLSILKKRLLSDSPRMQRW--LMSVPRIGALDRWLEQSG--STWSVAQ----------LF 100

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
              G++ +     +   P  L +    +     +  P + +  L  KR   ++   PDA+
Sbjct: 101 GYCGLVVLCAVALIPLVPVPLPIILGCMAFV--WLLPFLHVMRLRTKRLKQMEVQLPDAV 158

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D++   + +G S   AL  V ++I     PL  E   T  E+++      A  N   R  
Sbjct: 159 DMISRALRAGHSFAGALGMVGQEIK---APLGPEFRTTFEEINYGVALDEAMTNLAMRVP 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +  +R    A++     G ++ + L  + +  R    +  + +  S   +L+   I+  L
Sbjct: 216 VGDLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVLSAEGRLSA-WILGLL 274

Query: 308 PV---LILVIIGPAILSII 323
           P     +++++ P  + ++
Sbjct: 275 PFGTAGLIMVVNPGFMRVL 293


>gi|121534345|ref|ZP_01666169.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307115|gb|EAX48033.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 324

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/313 (16%), Positives = 120/313 (38%), Gaps = 22/313 (7%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           +      + F  ++ VV+     G   +R   + + R + +     + + + A++     
Sbjct: 1   MLTLIVAATFITVFVVVVGLYYFGTAARREVKMRISRYVAKPPAPAAPRPEQAAAPAMGA 60

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +R   +            + ++L  AG     S    LV+     ++ ++   I  
Sbjct: 61  WRSLVRQLSRYFESFQWSR--WLEHRLMQAGLPLRGS--EFLVICTGSALVGMLTLFILA 116

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
            G           R    ++   +G+  P + +   V++R  +      DAL L+   + 
Sbjct: 117 RG-----------RPIFAVIGAIIGYLVPLLVLRVKVERRTKAFNDQLGDALILIANSLR 165

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G S  Q++  V+ ++     P++ E    + E++     + A  N   R   D +    
Sbjct: 166 TGYSFLQSIEMVSREM---LPPIATEFARVLREMNLGVTTEEALNNLAKRVDSDDLDLVV 222

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV---LIL 312
            A++   + G ++ + L  +    RS   ++ E K  +   +++  +II  LPV   L++
Sbjct: 223 TAVLIQRQVGGNLAEVLENIAGTIRSRIKIKGEIKTLTAQGRISG-VIIGLLPVALGLVI 281

Query: 313 VIIGPAILSIIDT 325
             + P  + I+ T
Sbjct: 282 YALNPGYMQILFT 294


>gi|85373128|ref|YP_457190.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
 gi|84786211|gb|ABC62393.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
          Length = 323

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 103/301 (34%), Gaps = 27/301 (8%)

Query: 28  IYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL 87
           +        G    ++  + +   R   R  + T  + +S   +                
Sbjct: 17  MVVGYSALSGPNAAKESQRRLNAVR--YRHSESTDTKVESQLKKAIAARKPKAHRIA--- 71

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
              +    E +  +L   G    ++++      L V +   +L  +              
Sbjct: 72  --GSASRIEALELRLDRTG--KGWTVSQYFYASLGVGLTVAVLIFLRSGAL--------- 118

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             + ++ +   +G   P   +   + KR +     +PDA++LL+  + SG+ + + L  V
Sbjct: 119 --LLSLGVGAVIGAGLPHFVVGFFINKRTADFNSKFPDAIELLVRGLRSGLPVTETLAVV 176

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
           A+++ G   P+  E    +  +      +   ++  ++  +         L      G +
Sbjct: 177 AQEVPG---PVGVEFKSIVERIKIGKTMEEGLQDTADKLNIPEFNFFCITLAIQRETGGN 233

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL---ILVIIGPAILSIID 324
           + ++L  L    R    M+ + +A S   K +   I+  LP +   ++  I P  +    
Sbjct: 234 LAETLSNLSEVLRKRGQMKLKIRAMSSESKASA-YIVGALPFIVFAMIWWINPTYIDGFF 292

Query: 325 T 325
           T
Sbjct: 293 T 293


>gi|194366101|ref|YP_002028711.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348905|gb|ACF52028.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 311

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 60/314 (19%), Positives = 124/314 (39%), Gaps = 11/314 (3%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
           A    + + + + I  + I        E R  +        R++   +      S     
Sbjct: 5   AWFALSLLVLAAGIALLGIGGWVRSHREHRTSATLKTALQPREEARDNETTQRDS----L 60

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +     +    L+A L+       L  AG+ +     I L +RL++        ++ 
Sbjct: 61  GWLERFGRALSGGRLEAALLANEDRLLLDLAGWNTRRGTAIYLGLRLLLA-------LLV 113

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
           +     + +     ++  VI     G   P   +S+ V++R+ ++ +  P  +DLL +  
Sbjct: 114 LALALAVSDATGLAKIMVVIGALAAGLLLPKFVLSSWVKRRRRAVDKELPLLIDLLRLLQ 173

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
             G S+DQ+L+ + + +      L  E+       +    R  +          D + + 
Sbjct: 174 GVGFSMDQSLQTLGDKLRDALPVLGGELQEANVAYTHGRTRAQSLRRLSEVYADDDLSSL 233

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            Q ++Q   +G ++ + LR      R +R    ++K   L  K+TV M++  LP L+LV+
Sbjct: 234 MQLILQVHAHGGAVQEPLRQFSIRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVL 293

Query: 315 IGPAILSIIDTMKD 328
            GPA++++  TM  
Sbjct: 294 AGPALVALATTMSK 307


>gi|110636325|ref|YP_676533.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287309|gb|ABG65368.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 337

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/317 (17%), Positives = 123/317 (38%), Gaps = 19/317 (5%)

Query: 12  TELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           + LA  +  A S   L Y ++  ++ S +  +R        +I       +  + +  ++
Sbjct: 7   SLLAFVVLAACSAGGLAYVLMFNTIASEKKVERRLETVKRAQIEGNVVRAARDRAAEIAK 66

Query: 72  LRTRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
            R    +SL++   +   +   L    +  ++R AG   E S+    ++  VV ++F+I+
Sbjct: 67  RRRSIQESLKDIETRQKDQDRFLKRPPLKIQIRQAGL--EMSMERFYILSAVVGLLFVIV 124

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
             I                +     +    F AP   I+ L ++R  +    +P+ALD++
Sbjct: 125 TFIAGAPL-----------LAVAGAMVAGFFGAPRWIIAYLRRRRVQAFLNEFPNALDII 173

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +  V+SG+ ++ A+R +A        P+  E    +           A            
Sbjct: 174 VRAVKSGLPLNDAVRMIA---VEAQEPVRTEFRRLVEAQQLGLPMAEAAMRMSETMPCPE 230

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IFFLP 308
           V      L    + G ++ ++L  L    R  + ++A  +A S+  K +  +I  +  + 
Sbjct: 231 VNFFGIVLQIQSQAGGNLSEALGNLSRVLRERKKIKARVQALSMEAKASAVIIGALPIVV 290

Query: 309 VLILVIIGPAILSIIDT 325
             ++ I  PA +  + +
Sbjct: 291 AALVYITSPAYIMPLFS 307


>gi|84385699|ref|ZP_00988730.1| putative TadC [Vibrio splendidus 12B01]
 gi|84379679|gb|EAP96531.1| putative TadC [Vibrio splendidus 12B01]
          Length = 290

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 60/250 (24%), Positives = 122/250 (48%), Gaps = 5/250 (2%)

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
           T++  SL++       K     + +   L  AG  +E+   +  ++++V P+IF I+ I 
Sbjct: 45  TQEKVSLKDKFLVFTSKLAFNRDEVKANLIKAGIHNEFFSQVYYLIKIV-PMIFCIVTIG 103

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
           +++   +L      + VG  +LI  +    P ++I++  +   S I    P  LDL+ +C
Sbjct: 104 YMYLNSRLDMLNSFMSVGISLLIFLIA---PDMYIASRGKSNISHISSRLPFLLDLMNVC 160

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V +G++++ +L  ++ ++      L+  +  T            A   FY+       ++
Sbjct: 161 VHTGMTLEASLEYLSNELKMVDENLAFVVQTTSERAKV-VGLDKALSEFYDLVPTTEAQS 219

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L QS +YG+S+G  L  L S+ R   ++E E+K   +G K++VPMI F +  ++++
Sbjct: 220 FVMTLTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSVPMIAFIMIPIVIL 279

Query: 314 IIGPAILSII 323
           I  P I+ ++
Sbjct: 280 IAAPGIMRML 289


>gi|163801322|ref|ZP_02195221.1| hypothetical protein 1103602000598_AND4_10654 [Vibrio sp. AND4]
 gi|159174811|gb|EDP59611.1| hypothetical protein AND4_10654 [Vibrio sp. AND4]
          Length = 298

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 68/309 (22%), Positives = 133/309 (43%), Gaps = 15/309 (4%)

Query: 18  ITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKD--SASSRLRTR 75
           +  A+SI   +   ++  L S  +++  + V   + ++          +  +  S L+  
Sbjct: 1   MIIAISILLFLLGTIVFILNSKSMKEEQEYVDNFKFMISDHDSKQEYYNLFNQISELKDI 60

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
              S+   +KK      L    +   L + G  ++ S     ++ L+  +I   LG+ + 
Sbjct: 61  IDDSIYLVIKKF-----LSGNELYTMLSSGGLVNKKSKINFFLIYLIETVI--ALGLFYY 113

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
              DK   + F L    +  I    F          ++ + +     +   LDLL    +
Sbjct: 114 LTEDKTKFFMFILGFLVINNIAVKMFFKKFFVNVERLRTKTN-----FTYFLDLLATATK 168

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           SG++++ AL  V+E IG  S  LS  + +   ++S      +A EN      +  VR+ T
Sbjct: 169 SGMTVELALVAVSEYIGNMSSSLSNYIKIYSNDIS-NNGFSIAGENLRKSLDLPEVRDFT 227

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII 315
             L  +   G  + D+LRVL  E R+   +E E+K   +  K+ +P+I+F +  +I+ II
Sbjct: 228 AVLENALESGAPVTDALRVLSKEIRNFHFIETEEKIGKVNAKMGIPLILFIMFPIIVEII 287

Query: 316 GPAILSIID 324
            P +L+++ 
Sbjct: 288 APGVLNLLS 296


>gi|150377236|ref|YP_001313831.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150031783|gb|ABR63898.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 332

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/319 (16%), Positives = 111/319 (34%), Gaps = 20/319 (6%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            AT L   +   +   + I  V++ +      +       + R     +   S   +   
Sbjct: 1   MATSLLFPVFVFLLASTSIGGVMVAAFYPRVSKASAYRQRLARMSAPAENKRSEPTEPDG 60

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
              R    K+LR   +K    A      +  +LR +G    +S     VV     +    
Sbjct: 61  RDRRRSVEKTLREIEEKRQANARKGKTTLTARLRQSGLH--WSPKTYFVVCACAALASWC 118

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
             ++                + +       G   P V+++     R +     +P+A+D+
Sbjct: 119 AMLLL-----------DTGALVSAGFAISGGLLLPHVYVNIKRNARFAKFTAEFPNAVDV 167

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  +++G+ +   LR +A +      P+  E L  + + +       A +    R  + 
Sbjct: 168 IVRGLKAGLPMPDCLRVIATEAQE---PVKGEFLAIVQDQTLGIPVDEAVKRMSERMPLA 224

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
                   +    R G S+ ++L  L    R  + M+A+ KA S   K +   II  LP 
Sbjct: 225 EAHFFAIVIAIQSRTGGSLSEALGNLSKVLRERKKMKAKIKAMSSEAKSSAG-IIGALPF 283

Query: 310 LI---LVIIGPAILSIIDT 325
           L+   +    P  ++++  
Sbjct: 284 LVAGAVYFASPDYMALLFA 302


>gi|187921509|ref|YP_001890541.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719947|gb|ACD21170.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 293

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 63/307 (20%), Positives = 124/307 (40%), Gaps = 21/307 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + +   V  F LI  + I            KSV      +  +  T L     S R+  
Sbjct: 1   MLLLIAFVVSFGLIAVIAIGY----------KSVNGLAGSVPDENRTFLDPLPKSLRVLW 50

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                + +       + ++   ++  +L         +    L+       + +I  ++ 
Sbjct: 51  PLVNFVVHHFGGKFSRKLVEKTDLQLRL---------TSLTFLMNAHQFIALSIIASVLA 101

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                 L+          ++ +  +G+  P +W  ++ ++R + I +  P  LD L + V
Sbjct: 102 TLVALLLMLALGMFSALVLLGVAVLGYFYPRIWTRDVRRRRVARILKHLPIYLDFLTLAV 161

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G++I+ A+++  E   G   PL  E    + +L    NR  A     +R ++  V N 
Sbjct: 162 EAGLNINGAIQKAVE--KGPEGPLRWEFEHVLRDLKSGLNRMEALYRMDDRLRIKEVTNL 219

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              ++Q++R G+ +  SLR    + RSER   AEK+A     KL  P+++F  P+  +V+
Sbjct: 220 VGTVVQAERMGSGLSKSLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLVFIFPITFIVL 279

Query: 315 IGPAILS 321
             P  + 
Sbjct: 280 GFPIAMK 286


>gi|117928944|ref|YP_873495.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
 gi|117649407|gb|ABK53509.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
          Length = 311

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 56/308 (18%), Positives = 110/308 (35%), Gaps = 8/308 (2%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
            A+     + + +    +P      L  R+      R+  R  Q         +  +  +
Sbjct: 7   AAVGLCAGVGTALAVSGVPHFRHPRLADRLAPYL--RDRSRPSQPPVHTAARGTWPVVGQ 64

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +   + +   + +    ++  +L AAG     ++    V +++   I  ++G+   
Sbjct: 65  LLAPVLADIARRVDRVMGGPGSVRRRLDAAG--RNMAVEEFRVEQVLWGSIGFLVGLGVS 122

Query: 136 FGYDKL-LEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                     P        ++    G  A  V +S   Q+R   +   +P   +LL + V
Sbjct: 123 LLLLAQNPHRPPLALGMLCVIAACCGAIARDVTLSREAQRRSRRMLAEFPTVAELLALAV 182

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G S   AL RV     G    LS E    ++E     +   A EN   R  +D +   
Sbjct: 183 GAGESPAAALERVVRVCRG---ELSVEFARALSEARTGGSLVTALENLAARNPLDIMSRF 239

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              +I + + GT + D LR   S+ R                 + VP++   LP+ +L  
Sbjct: 240 VDGMIVAMQRGTPLADVLRAQASDVREAAKRSLLDIGGRKEIGMMVPVVFLILPITLLFA 299

Query: 315 IGPAILSI 322
           + P+ +S+
Sbjct: 300 LFPSFVSL 307


>gi|206559898|ref|YP_002230662.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035939|emb|CAR51831.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 332

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 127/320 (39%), Gaps = 11/320 (3%)

Query: 13  ELAVAITTAVSIFSLIYA-----VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            + V +  A++I  ++        ++ +L          +         +  +       
Sbjct: 15  SVGVLLLAALAIVRIVLVQRAERALVNALDRRTAAVEAAAARAGAAEPARDAVAPAAPRV 74

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             + LR R       +++       L+ +     L   GF    +  + +  R+V  I+ 
Sbjct: 75  RFAGLRARFEDVGMRWLE-TGFSRYLIADEDRQLLEQCGFVDVRARALFVGARIVCAILL 133

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             L ++ + G  +   +P  + V         G+  P +++      R+ SI    P  +
Sbjct: 134 PALAVLVLIGRGQQTRWPLWISV-----ALVTGYMLPKIYVRRRATARRQSIAAELPLLV 188

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+L +    G+S+DQ+++ V  D       LS E+ +   + +    R+ + +   N   
Sbjct: 189 DMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWELGVAQRQFAAGRTREQSLQRLTNSFD 248

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +R   + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+  L
Sbjct: 249 NEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREGRRATLREQIGRLTVKMTGVMIVTLL 308

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P L++V  GP I++++  + 
Sbjct: 309 PALLIVTAGPGIMTVLAALA 328


>gi|319779646|ref|YP_004130559.1| Type II/IV secretion system protein TadC [Taylorella equigenitalis
           MCE9]
 gi|317109670|gb|ADU92416.1| Type II/IV secretion system protein TadC [Taylorella equigenitalis
           MCE9]
          Length = 267

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 103/238 (43%), Gaps = 8/238 (3%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
            +        +   L  +G  ++++ + L+       ++  ++    +     +L     
Sbjct: 37  KILGWQFGAGLNVSLAKSGLSTKWTPHKLV------GLVAFVILFELVLVLWVILADLQI 90

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           L +  + +  ++    P  +I   + KR++ +   +P  LD+L + + SG +   +L+  
Sbjct: 91  LYLYILFIFIFITLLWPKAYIKRYISKRRTELSEIFPFFLDVLSVSLSSGQNFTMSLQYA 150

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
              +   +  L +E+  TI E+     +  A ++   R+ ++ V+     + Q+D+ G  
Sbjct: 151 FNSLP--NGVLKDELGFTIREMQAGKPKLEAIDDMAQRSDLNVVKQWVNNIKQADQLGLQ 208

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           +  + R   S  R +R + AEK A     K+  P++ F  P   +V++ P  + I+++
Sbjct: 209 LASAFRAQASYIRKQRYLMAEKLAFEAPVKMLFPLVFFIFPCTFIVLLFPVFMQILES 266


>gi|114321307|ref|YP_742990.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227701|gb|ABI57500.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 312

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 60/317 (18%), Positives = 118/317 (37%), Gaps = 13/317 (4%)

Query: 14  LAVAITTAVSIFSLIYAVV-IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRL 72
           +      ++ +F+   A+V  P     +   R+     E  ++   +      D      
Sbjct: 2   MVWLFVASLVLFAAGLALVVWPLWRRSQEYGRV-----EGRLMGTARGGGRDWDEPVDGR 56

Query: 73  RTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFR--SEYSLNILLVVRLVVPIIFLIL 130
               +   R    +    A+  D  +  +LR  G R   + +   LLV  L   ++   L
Sbjct: 57  SGAHTLWRRLAAGRGAAPALAQDPVLARRLRQWGLRRAGDRAAVALLVQALPWVVVAGGL 116

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
           G +WI       E      VG + L+G      P   ++ L   RQ  I      A+ +L
Sbjct: 117 GFVWISRGALTGED-----VGLLALLGLAALFLPKRVVAGLASARQMRIGEQVTTAVQIL 171

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            + ++SG S+  AL  VA +       LS E+ L +             +      ++  
Sbjct: 172 RMLLDSGQSVQHALGMVAVEGRELMPDLSRELDLALNRARSGEGLVEVLDGLARDLEVPE 231

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           + +    L Q    G ++ + L  L       +    ++K   +  K++V M++F  P L
Sbjct: 232 LDDTVLILKQVVEQGGNVDEPLTRLAELINDRQRTRTQEKVTKMSAKMSVVMMLFLFPAL 291

Query: 311 ILVIIGPAILSIIDTMK 327
           ++V+  P ++S++  + 
Sbjct: 292 LVVLAAPGLISLVGALG 308


>gi|312883313|ref|ZP_07743039.1| putative Flp pilus assembly protein TadC [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368929|gb|EFP96455.1| putative Flp pilus assembly protein TadC [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 288

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 112/230 (48%), Gaps = 5/230 (2%)

Query: 94  VDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAV 153
             +++  +L +AGF     L +   ++ ++  +F +  +I        L   F   V +V
Sbjct: 63  DKDDLEKRLFSAGFYHPMILKLYYPLKYIIMFLFSVCILISFIVGIISLYDLFLYNVISV 122

Query: 154 ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGG 213
            +I    F  P   I   ++    +I    P  LDL+ +CV +G++I+ +L  +A+++  
Sbjct: 123 FMI----FFIPDKIIGLRIKSNIKNISSRLPFLLDLMNVCVHTGMTIESSLEYLAKELQM 178

Query: 214 QSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLR 273
               L+  + LT+           A + FY+       ++    L+QS ++G+S+G  L 
Sbjct: 179 VDRQLARVVTLTVERAKI-VGLDKALQEFYDLVPTSESQSMVMTLVQSLQFGSSVGAVLS 237

Query: 274 VLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSII 323
            L  + R   +M+ E+K   +G K+T+P+++F +  ++++I+ P ++ ++
Sbjct: 238 TLSKDIRELNMMDIEEKIGKMGAKMTMPLVVFIMIPMLVLIVAPKVMRVM 287


>gi|260892929|ref|YP_003239026.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260865070|gb|ACX52176.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 305

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 57/269 (21%), Positives = 117/269 (43%), Gaps = 10/269 (3%)

Query: 60  ITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVV 119
                ++  S R+       L     +  L      E   N L  AG      +N  L +
Sbjct: 45  REQELREPLSRRIFKPWLTKLGRLGGRF-LPGGSRKEMWANLLAMAGHPWGLGVNEFLAL 103

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
           +++  +   +  +++ +                 ++   +GF  P   + + +++RQ  +
Sbjct: 104 KVLAALTGGMAFVLFFW------HLTPFAAPLWGVVGWLLGFLFPDFLLRSRIRRRQREV 157

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
           +R  P+ +DLL + VE+G+  + AL RV E + G   PL +E+   + E+     R+ A 
Sbjct: 158 RRQLPEVIDLLTVSVEAGLGFEGALTRVVEKMDG---PLPQEICRALQEIRVGRPRREAL 214

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
                R  ++ + +   A+I +++ G S+   LR+   E R  R  +A++ A     K+ 
Sbjct: 215 REMAQRIGVEELLSFVGAVIMAEQMGVSLARVLRLQSQEIRRRRRQQAQEAAFKAPVKML 274

Query: 300 VPMIIFFLPVLILVIIGPAILSIIDTMKD 328
           +P+++   P   +V++GPA+L I+     
Sbjct: 275 LPLVLCIFPATFVVLLGPAVLRIMRFFGK 303


>gi|295690794|ref|YP_003594487.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432697|gb|ADG11869.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 325

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 60/314 (19%), Positives = 122/314 (38%), Gaps = 22/314 (7%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I   V  F  I  +    +G        K+    + I          K+  ++    
Sbjct: 1   MLFILAGVLGFITIAGLGFAFVGDDSQAS--KAAKRAQVIGAGGVDRQAAKNKPAANPNE 58

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +++   +K+   K      +I  +++AAG      L  ++ + L V +I ++L +  
Sbjct: 59  VRRQTILKALKEQERKQKKATLSIAARMQAAGLGPNVRLFWMVSLGLAVGVILIVLAL-- 116

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                       Q    A+      G   P   +S L Q R      A+ DA+D+++  +
Sbjct: 117 -----------GQTVWIALGAGFAAGLGLPRWLLSILAQGRIRKFTEAFSDAIDIIVRGI 165

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           +SG+ +   LR + +       PL+ E  +    ++       A +  + R   + +R  
Sbjct: 166 KSGLPLHDCLRIIGQ---ESPEPLAGEFRMLTENVAMGVPLDAALDKMHERMPTNELRFF 222

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
              L    + G ++ ++L  L +  RS ++M+ + KA S     +  +II  LP  ++V+
Sbjct: 223 AIVLAIQQKTGGNLAEALGNLSTVLRSRKMMKEKIKALSAEAVASA-LIIGALPPGVIVL 281

Query: 315 I---GPAILSIIDT 325
           I    PA +  + T
Sbjct: 282 ISVTSPAYMQPLFT 295


>gi|134291850|ref|YP_001115619.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135039|gb|ABO59364.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 325

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 109/308 (35%), Gaps = 25/308 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D+      I T V++   I  V            R          LR        +   
Sbjct: 1   MDSIFYGFVILTFVAVVLAIEGVYQWWNARHGNAARRIE-----SRLRAMSAGGSVQQER 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R     + F     L  +   +++   L+ +G     +  ++L   L      +
Sbjct: 56  MSILKKRMLDESKPF--DRLLLRVPRVQSLDLVLQQSGLDWTVAKLVVLSGALCAATALV 113

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +                  L + AV+ +     C P+++++   ++R   ++R  PD  D
Sbjct: 114 L--------------SVTPLPLVAVLPVALFAGCIPTLYVTRHRRRRMLKLERQLPDVCD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   + SG S   AL  V E+      P+S E  +T  E+++  +   A  N   R   
Sbjct: 160 MIARALRSGHSFTSALGMVGEEF---PEPMSGEFRITFDEINYGVSLHDALVNLATRVPA 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +R    A++     G ++ + L  + +  R    +  + +  S   +L+   I+  LP
Sbjct: 217 NDLRYFVIAVLIQRETGGNLAELLDSIAALVRERFKLFDKVRVLSAEGRLSA-WILGLLP 275

Query: 309 VLILVIIG 316
                ++ 
Sbjct: 276 FGTAGMMA 283


>gi|190574783|ref|YP_001972628.1| putative transmembrane type II secretion protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012705|emb|CAQ46333.1| putative transmembrane type II secretion protein [Stenotrophomonas
           maltophilia K279a]
          Length = 311

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 59/310 (19%), Positives = 122/310 (39%), Gaps = 11/310 (3%)

Query: 19  TTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSK 78
            + + + + +  + I        E+R  +        R++   +      S        +
Sbjct: 9   LSLLVLAAGVALLGIAGWVRSHREQRTSATLKTALQPREEARDTEAARRDS----LGWLE 64

Query: 79  SLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGY 138
                +    L++ L+       L  AG+ +     I L +RL++       G++ +   
Sbjct: 65  RFGRALSGGRLESALLANEDRLLLDLAGWNTRRGTAIYLGLRLLL-------GVLVLVLA 117

Query: 139 DKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGI 198
                     R+  VI     G   P   +S+ V++R+ ++    P  +DLL +    G 
Sbjct: 118 LAFSSTQGLARMMVVIGALAAGLLLPKFILSSWVKRRRRAVDNELPLLIDLLRLLQGVGF 177

Query: 199 SIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAL 258
           S+DQ+L+ + + +      L  E+       +    R  +          D + +  Q +
Sbjct: 178 SMDQSLQTLGDKLRDALPVLGGELQEANVAYTHGRTRAQSLRRLSEVYADDDLTSLMQLI 237

Query: 259 IQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPA 318
           +Q   +G ++ + LR      R +R    ++K   L  K+TV M++  LP L+LV+ GPA
Sbjct: 238 LQVHAHGGAVQEPLRQFSIRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPA 297

Query: 319 ILSIIDTMKD 328
           ++++  TM  
Sbjct: 298 LVALATTMSK 307


>gi|226325183|ref|ZP_03800701.1| hypothetical protein COPCOM_02975 [Coprococcus comes ATCC 27758]
 gi|225206531|gb|EEG88885.1| hypothetical protein COPCOM_02975 [Coprococcus comes ATCC 27758]
          Length = 303

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 64/321 (19%), Positives = 117/321 (36%), Gaps = 22/321 (6%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
              +  + +  A +   + Y +            RM                 +      
Sbjct: 1   MNIQYLLVLLFACAAGGMTYVLAGEPFRKPLARARM----------SIAARKGMHAKPTQ 50

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
                          +K+    +     + +KL  AG +   S          + +   I
Sbjct: 51  RMKIAEAIDRAGEAFEKVIPLKLSESRELQDKLDLAGLKITPSTWR------AISLGITI 104

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
              I + G   +  Y   + +   I+    G+    VW+S+  + R   I R  P AL+L
Sbjct: 105 FTAIMLAGAALVGGYGIAMALLVGIIGAVGGWAVCGVWLSHAGKTRGEEIDRYLPPALEL 164

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELS-FLPNRQVAFENFYNRTQM 248
           L I V +G+ +++  R++AE+      PL++E   T  E+S    +R  A ++   R   
Sbjct: 165 LTISVSAGVLVERGFRQLAEN--KALGPLADEFARTDMEISHLGVSRVDALDHMRRRCDS 222

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +     ALI++ R GTSI   L       R  R      +   L  K+ VP++ F + 
Sbjct: 223 PLMGYFCAALIEATRKGTSISGVLESQAKLARKARYDALTAQINKLSTKMAVPLVFFLIA 282

Query: 309 VLILV---IIGPAILSIIDTM 326
           VL+L+   +I P    +++ M
Sbjct: 283 VLVLILPPLIIPTASMLMEIM 303


>gi|51597675|ref|YP_071866.1| hypothetical protein YPTB3377 [Yersinia pseudotuberculosis IP
           32953]
 gi|51590957|emb|CAH22615.1| Putative exported protein [Yersinia pseudotuberculosis IP 32953]
          Length = 277

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 93/204 (45%), Gaps = 1/204 (0%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I+  IL I+ I     ++    +  +   +L        P + I N + KR +++ ++ P
Sbjct: 74  IVIFILSILTILAIFNVVNINQKTLLTIGLLSIISTLYLPKMIIKNALTKRTNNLLKSLP 133

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+   CV+SG++I+ +L    +     +  L   M             + A +    
Sbjct: 134 FFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEIN-GLENAIKELQY 192

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
            +    ++     L  S  +G+++ + L  L  + R  +L+  E+  + L  KLT+P+ +
Sbjct: 193 YSPAIEMKMFCSTLQYSISFGSTVYEQLTHLSQDMREMQLLMTEESISKLSTKLTLPLFL 252

Query: 305 FFLPVLILVIIGPAILSIIDTMKD 328
           F L   +L++I P+IL +++ +K+
Sbjct: 253 FILIPFVLLVISPSILELLNYVKN 276


>gi|326388861|ref|ZP_08210443.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206461|gb|EGD57296.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 323

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 56/310 (18%), Positives = 118/310 (38%), Gaps = 29/310 (9%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + +AI   V+ ++ I  + +    + E  +R+++V +        ++ +  + + ++R  
Sbjct: 7   ILMAIGLTVAAWAGI-TLFMGPNPARESSRRLQAVKLRHSESTTDKVEAQYRKALAARKP 65

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
                            +    E +  +L   G    ++++  L   L + I+F     I
Sbjct: 66  KAYK----------LAGSSSRLEALSLRLDRTG--RGWTISQYLYASLGLVILFGGFVWI 113

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                           V  + L   +G   P   +S  + KR ++    +PDAL+LL+  
Sbjct: 114 -----------KSGSLVLGLALGIAIGAGLPHFAVSWAINKRINNFITRFPDALELLVRG 162

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           + SG+ I + L  VA ++ G   P+SEE  +    +      + A +   +R  +     
Sbjct: 163 LRSGLPISETLVVVANELPG---PVSEEFKIVTDRIRLGRTMEDALQETADRLDLAEFSF 219

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
               L      G ++ ++L  L    R    M+ + KA S   K +  ++     ++  +
Sbjct: 220 FCITLAIQRETGGNLAETLANLADVLRKRAQMKLKIKAMSSESKASAYIVGSLPFIVFAL 279

Query: 314 I--IGPAILS 321
           I  I P  L 
Sbjct: 280 IYSINPRYLG 289


>gi|167587310|ref|ZP_02379698.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 264

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/266 (19%), Positives = 114/266 (42%), Gaps = 6/266 (2%)

Query: 62  SLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRL 121
           +  + +  ++L  R S +   ++        +V +     L   G+    +  + L  R+
Sbjct: 1   AAGRRARVAQLLERMSTAGARWLD-TGFGRHIVADEDRRLLEQCGYVDARTRGLFLSARI 59

Query: 122 VVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKR 181
              ++  +L + ++        +     V  ++L    GF  P + I      R+ ++  
Sbjct: 60  AGALVAPVLFLAFVGPRLHGGRW-----VLGLVLAFVTGFMLPKILIRRRAAARRQAVVD 114

Query: 182 AWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFEN 241
             P  +D+L +    G+S+DQ+L+ V  D  G    LS EM +   + +    R+ + + 
Sbjct: 115 ELPLLVDMLRLLQGVGLSLDQSLQVVTNDFRGMMPVLSSEMGIAQRQFAAGRTREQSLQR 174

Query: 242 FYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVP 301
             +    + +R   + +IQ D++G ++ + L+      R  R     ++   L  K+T  
Sbjct: 175 LASGFDNEDLRAIVRLMIQVDKHGGAVQEPLKQFGDRLREARRAMLRERIGRLTVKMTGV 234

Query: 302 MIIFFLPVLILVIIGPAILSIIDTMK 327
           MI+  LP L++V  GP ++S++  + 
Sbjct: 235 MIVTLLPALLIVTAGPGMISVMHALS 260


>gi|269926133|ref|YP_003322756.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789793|gb|ACZ41934.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 336

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 54/320 (16%), Positives = 129/320 (40%), Gaps = 22/320 (6%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +F   E    +T A+ IF +   + +  +     ++R+  +             +  +  
Sbjct: 7   IFTQPENLAGVTVALGIFLIFLGLTL-YIKHRRWQERLHQLIGRHLEATSSSQDTSPEIL 65

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
               L +           +  LK +++      +L  AG     + +  ++VRL   ++ 
Sbjct: 66  PQKALLSWRI--------REKLKDLIITPKFRRELLTAGL--GIAADKFILVRLAGALLC 115

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             L ++ I             R  A I     G+  P  +++   ++R S+++R  P A+
Sbjct: 116 SFLVMLLI------PGNYPLFRTIAAIFGLIAGYQLPRAYLALRRKRRLSALERQLPGAI 169

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+L   +E+G S+ QA+   A ++   S P+S+E++  + +     +++ A      R  
Sbjct: 170 DVLAGALEAGSSLAQAMMLAAREM---SNPISDELIKVVRDQELGLSQEEALRRMLERCP 226

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI--IF 305
            + +     A+    R G S+   L+ + +  R    ++ E K  +   +++  ++  I 
Sbjct: 227 SEDLDMMITAINIQYRVGGSLAHVLKSISTTIRERLRIKGEIKVLTAQGRISAYIVTAIP 286

Query: 306 FLPVLILVIIGPAILSIIDT 325
           FL   ++ ++  + +  + T
Sbjct: 287 FLLTAVIFLLNRSYIMPLFT 306


>gi|309780756|ref|ZP_07675497.1| TadB protein [Ralstonia sp. 5_7_47FAA]
 gi|308920438|gb|EFP66094.1| TadB protein [Ralstonia sp. 5_7_47FAA]
          Length = 325

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 122/319 (38%), Gaps = 25/319 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D   +  A++  +++   + AV +          R  S       L+    +S+     
Sbjct: 1   MDPLVIGFALSVFIAMMLAVLAVYLWWDSRHSSAARRFS-----HRLKMALASSVSHGGT 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R             L  +   + +  +L  +G   ++S++    + L+VP +  
Sbjct: 56  DSILKQRMLSESPEVAA--MLGRLPRIQTLDRRLLQSGL--DWSVSRFSALTLMVPAMIA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I+  ++                  +++    G   P++++ +   +R   ++   P+A D
Sbjct: 112 IVFSLF------------DPPPMTLLVFVLAGASLPALYVMHRRTRRLLKLEAQLPEATD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+   + +G S+  AL     ++     P+  E+ +  ++++F  +   AF    +R  +
Sbjct: 160 LISRALRAGHSLPAALEMAGTEL---PAPIGAELAIVFSQINFGVSMSDAFAGLTDRVPV 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D +R    A++     G ++ + L  +    R    +  + +  S   +L    I+  LP
Sbjct: 217 DDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVLSAEGRL-GGWILTLLP 275

Query: 309 VLILVIIGPAILSIIDTMK 327
            ++ + I      ++ T+ 
Sbjct: 276 PVMGLAIYLLNPELMSTLW 294


>gi|241662161|ref|YP_002980521.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864188|gb|ACS61849.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 325

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 122/319 (38%), Gaps = 25/319 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D   +  A++  +++   + AV +          R  S       L+    +S+     
Sbjct: 1   MDPLVIGFALSVFIAMMLAVLAVYLWWDTRHSSAARRFS-----HRLKMALASSVSHGGT 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R             L  +   + +  +L  +G   ++S++    + L+VP +  
Sbjct: 56  DSILKQRMLSESPEVAA--MLGRLPRIQTLDRRLLQSGL--DWSVSRFFALTLMVPAMIA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           I+  ++                  +++    G   P++++ +   +R   ++   P+A D
Sbjct: 112 IVFSLF------------DPPPMTLLVFVLAGASLPALYVMHRRTRRLLKLEAQLPEATD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+   + +G S+  AL     ++     P+  E+ +  ++++F  +   AF    +R  +
Sbjct: 160 LISRALRAGHSLPAALEMAGTEL---PAPIGAELAIVFSQINFGVSMSDAFAGLTDRVPV 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           D +R    A++     G ++ + L  +    R    +  + +  S   +L    I+  LP
Sbjct: 217 DDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVLSAEGRL-GGWILTLLP 275

Query: 309 VLILVIIGPAILSIIDTMK 327
            ++ + I      ++ T+ 
Sbjct: 276 PVMGLAIYLLNPELMSTLW 294


>gi|238750902|ref|ZP_04612399.1| Type II secretion system protein [Yersinia rohdei ATCC 43380]
 gi|238710816|gb|EEQ03037.1| Type II secretion system protein [Yersinia rohdei ATCC 43380]
          Length = 265

 Score =  109 bits (271), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 99/204 (48%), Gaps = 1/204 (0%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           II + L I+ I     L+     + +   ++     F  P + I N++ KR  S+ ++ P
Sbjct: 62  IIVVNLVILVILLSTGLININITVFIVFGLITIVGTFFLPKIIIKNILYKRTESVLKSLP 121

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+   CV+SG++ID AL   A+     +  LS  M+            ++A +  + 
Sbjct: 122 FFIDITAACVQSGMTIDGALNYTAKKFKLINPDLSLIMIKMSKRAEIN-GLELAIKELHQ 180

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
            +    +R    AL  S  +G+SI D L  L  E R  +L+ +E+K + L  KLT P+ I
Sbjct: 181 CSTAMEIRMFCSALQYSISFGSSIYDQLAKLSQEMREMQLLVSEEKVSKLSTKLTFPLFI 240

Query: 305 FFLPVLILVIIGPAILSIIDTMKD 328
           F L   I+++I P++L ++  ++ 
Sbjct: 241 FILIPFIVLVISPSVLELLTHVQK 264


>gi|22127363|ref|NP_670786.1| hypothetical protein y3489 [Yersinia pestis KIM 10]
 gi|45442765|ref|NP_994304.1| hypothetical protein YP_3003 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809095|ref|YP_653011.1| hypothetical protein YPA_3104 [Yersinia pestis Antiqua]
 gi|108810710|ref|YP_646477.1| hypothetical protein YPN_0545 [Yersinia pestis Nepal516]
 gi|145597782|ref|YP_001161858.1| hypothetical protein YPDSF_0472 [Yersinia pestis Pestoides F]
 gi|150260282|ref|ZP_01917010.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162421097|ref|YP_001604880.1| hypothetical protein YpAngola_A0262 [Yersinia pestis Angola]
 gi|165925128|ref|ZP_02220960.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939890|ref|ZP_02228429.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009023|ref|ZP_02229921.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166212095|ref|ZP_02238130.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167419193|ref|ZP_02310946.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425195|ref|ZP_02316948.1| type II secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167466380|ref|ZP_02331084.1| type II secretion system protein [Yersinia pestis FV-1]
 gi|186896813|ref|YP_001873925.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927879|ref|YP_002345754.1| hypothetical protein YPO0688 [Yersinia pestis CO92]
 gi|229837370|ref|ZP_04457533.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Pestoides A]
 gi|229840582|ref|ZP_04460741.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842868|ref|ZP_04463020.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229900907|ref|ZP_04516031.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Nepal516]
 gi|270487717|ref|ZP_06204791.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|294502754|ref|YP_003566816.1| hypothetical protein YPZ3_0644 [Yersinia pestis Z176003]
 gi|21960448|gb|AAM87037.1|AE013952_4 hypothetical [Yersinia pestis KIM 10]
 gi|45437631|gb|AAS63181.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774358|gb|ABG16877.1| hypothetical protein YPN_0545 [Yersinia pestis Nepal516]
 gi|108781008|gb|ABG15066.1| hypothetical protein YPA_3104 [Yersinia pestis Antiqua]
 gi|115346490|emb|CAL19364.1| putative exported protein [Yersinia pestis CO92]
 gi|145209478|gb|ABP38885.1| hypothetical protein YPDSF_0472 [Yersinia pestis Pestoides F]
 gi|149289690|gb|EDM39767.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162353912|gb|ABX87860.1| type II secretion system protein [Yersinia pestis Angola]
 gi|165912201|gb|EDR30839.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923328|gb|EDR40479.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992362|gb|EDR44663.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166206841|gb|EDR51321.1| type II secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166963187|gb|EDR59208.1| type II secretion system protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167055958|gb|EDR65739.1| type II secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186699839|gb|ACC90468.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682246|gb|EEO78338.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Nepal516]
 gi|229690135|gb|EEO82192.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696948|gb|EEO86995.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229705493|gb|EEO91503.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis Pestoides A]
 gi|262364731|gb|ACY61288.1| hypothetical protein YPD8_0598 [Yersinia pestis D182038]
 gi|270336221|gb|EFA46998.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|294353213|gb|ADE63554.1| hypothetical protein YPZ3_0644 [Yersinia pestis Z176003]
 gi|320016749|gb|ADW00321.1| Type II/IV secretion system protein TadC,associated with Flp pilus
           assembly [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 277

 Score =  109 bits (271), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 93/204 (45%), Gaps = 1/204 (0%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I+  IL I+ I     ++    +  +   +L        P + I N + KR +++ ++ P
Sbjct: 74  IVIFILSILTILAIFNVVNINQKTLLTIGLLSIISTLYLPRMIIKNALTKRTNNLLKSLP 133

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+   CV+SG++I+ +L    +     +  L   M             + A +    
Sbjct: 134 FFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEIN-GLENAIKELQY 192

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
            +    ++     L  S  +G+++ + L  L  + R  +L+  E+  + L  KLT+P+ +
Sbjct: 193 YSPAIEMKMFCSTLQYSISFGSTVYEQLTHLSQDMREMQLLMTEESISKLSTKLTLPLFL 252

Query: 305 FFLPVLILVIIGPAILSIIDTMKD 328
           F L   +L++I P+IL +++ +K+
Sbjct: 253 FILIPFVLLVISPSILELLNYVKN 276


>gi|304311188|ref|YP_003810786.1| type II secretion system protein [gamma proteobacterium HdN1]
 gi|301796921|emb|CBL45134.1| type II secretion system protein [gamma proteobacterium HdN1]
          Length = 319

 Score =  109 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 55/318 (17%), Positives = 116/318 (36%), Gaps = 16/318 (5%)

Query: 5   FFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            FD         +   A+        +             +               +   
Sbjct: 3   MFDSITLQSGLFSYLPALLGALTAAFLTYSLT--------VIIRNRRAATGLLGDESWRD 54

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                 RL     K L   V+   L      E I N+L + G R        + ++ +  
Sbjct: 55  PTPLIYRLFKPFIKLLA--VEFSKLIKPAKRERISNRLSSGGLRYAILPEEFMAMKYICA 112

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           ++   + +  +     +      L     +    VGF  P +W+S+ + +R+    + +P
Sbjct: 113 VVAGGITVWSLLTMPDMKAEFKLLLYPLAL----VGFFYPDIWLSDQINRRRRITLKEFP 168

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             LDLL++ + +G++   AL    E +   +  + +E    + E+    +R+ A     +
Sbjct: 169 FMLDLLVLGMRAGLNYAAALGHAIEAMP--NGVIRDEFSKVLREIRAGKSRREALLTLAD 226

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           R  ++ + N   A+ Q +  G  I   L V   + R+ER   AE  A     ++ +PM++
Sbjct: 227 RMNLEAISNFVAAVNQVEETGGEIVSVLMVQAEQRRNERFTAAEIAANKAPIRMLIPMML 286

Query: 305 FFLPVLILVIIGPAILSI 322
           F  P++ +++    I+ +
Sbjct: 287 FLFPIIFMLLTFIIIVKL 304


>gi|330830427|ref|YP_004393379.1| Flp pilus assembly protein TadC [Aeromonas veronii B565]
 gi|328805563|gb|AEB50762.1| Flp pilus assembly protein TadC [Aeromonas veronii B565]
          Length = 294

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 112/242 (46%), Gaps = 4/242 (1%)

Query: 86  KLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYP 145
           +           +   L  AG  +    + L   +L+  +   I+ + W         + 
Sbjct: 57  RGYPVGGREQARLQQLLAQAGIFASQGFDRLRGAKLLGGLGLAIMVLTWRLLGAPADGFT 116

Query: 146 FQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALR 205
               +  V++   VG   P  W+    +K +++ ++  PDA+DLL+I VE+G+++D+AL 
Sbjct: 117 ----LMWVLMAYVVGAGLPERWLQWRARKVKAAQQKVVPDAIDLLVISVEAGLALDRALL 172

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYG 265
           RV   +      L+ + L T AE+    ++         RT +  +      L  + +YG
Sbjct: 173 RVGHYLEALEPGLARQFLRTHAEIQMRGDQASCLARLAWRTGLPELDRLANTLQMAQQYG 232

Query: 266 TSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDT 325
           + + +++R +  E R  R +  E++A SL  K+T+  +   +  ++++II P +  +I++
Sbjct: 233 SPLAETMRTISQEARQMRRLALEEQAGSLPGKITLIQMALIMLPMLVLIIAPTLNLLINS 292

Query: 326 MK 327
           ++
Sbjct: 293 LR 294


>gi|269955831|ref|YP_003325620.1| type II secretion system protein [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304512|gb|ACZ30062.1| type II secretion system protein [Xylanimonas cellulosilytica DSM
           15894]
          Length = 312

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 50/292 (17%), Positives = 107/292 (36%), Gaps = 11/292 (3%)

Query: 33  IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS--SRLRTRDSKSLRNFVKKLNLK 90
                   L  R+      R+           +       RL       L ++ ++L   
Sbjct: 26  WFRARRVTLASRLAPALRPRDATSGLLREQPVRSPFPVVERLLAPWLADLAHWFERLGSP 85

Query: 91  AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRV 150
                  +  +L  AG  S  S++     ++V     L++G++          +      
Sbjct: 86  RA----EVRRRLDRAG--STESVDQFRARQVVWTGAGLVVGLVLALLIGAARGFAPVPLA 139

Query: 151 GAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAED 210
             V++ G  GF A    ++  + +R+  +   +P   +LL + V +G +   AL RVA  
Sbjct: 140 ALVLISGACGFAACDQVLTRQISQREERMVAEFPTIAELLALAVTAGEAPISALERVA-- 197

Query: 211 IGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGD 270
                  LS E+  T+A++       +A  +  +RT +  +    + +  +   GT + +
Sbjct: 198 -ATARGELSVEIRRTLADVRAGAPIALALTDMADRTGLPSLTRFAEGVAVALERGTPLAE 256

Query: 271 SLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
            LR    + R        +        + VP++   LP+ ++  I P++ ++
Sbjct: 257 VLRAQAQDVRESGRRALMEAGGRKEVVMLVPVVFLILPITVVFAIYPSLATL 308


>gi|323529156|ref|YP_004231308.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386158|gb|ADX58248.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 293

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/223 (22%), Positives = 97/223 (43%), Gaps = 2/223 (0%)

Query: 99  VNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGY 158
              +     +   +    L+       + +I   +        +       V  +I    
Sbjct: 66  RKLVAKTELQLRLTSLTFLMNAHQFIALSIIGAALASLLALLAMLALGVFSVLVLIGAAL 125

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL 218
           +G+  P +W  ++ ++R + I +     LD L + VE+G++I+ A+++  E   G + P 
Sbjct: 126 LGYFYPRIWTRDVRRRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVE--KGPAGPF 183

Query: 219 SEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSE 278
             E+   + +L    NR  A     +R ++  V N   A++Q++R G  +  SLR    +
Sbjct: 184 RWELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLAKSLRFQSEQ 243

Query: 279 TRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILS 321
            RSER   AEK+A     KL  P+++F  P+  +V+  P  + 
Sbjct: 244 RRSERFQRAEKQAMEAPVKLVFPLLVFIFPITFIVLGFPIAMK 286


>gi|170732851|ref|YP_001764798.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169816093|gb|ACA90676.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 332

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 128/320 (40%), Gaps = 11/320 (3%)

Query: 13  ELAVAITTAVSIFSLIYA-----VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            + V +  A++I  ++        ++ +L          +         ++    +    
Sbjct: 15  SVGVLLLAALAIVRIVLVQRAERALLHALDRRAAAVEAAAARAGSADAAREAAAPVAPRV 74

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             +RLR R       ++        L+ +     L   GF    +  + +  R+V  I+ 
Sbjct: 75  RFARLRERFEDVGMRWLD-TGFSRYLIADEDRRLLEQCGFVDVRARALFVGARIVCAILL 133

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             L ++ + G  +   +P  L +         G+  P +++      R+ S+    P  +
Sbjct: 134 PALAVLVLIGRGQQARWPLWLSI-----ALVTGYMLPKIYVRRRATARRQSLGAELPLLV 188

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+L +    G+S+DQ+++ V  D       LS E+ +   + +    R+ + +   N   
Sbjct: 189 DMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWELGVAQRQFAAGRTREQSLQRLTNSFD 248

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +R   + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+  L
Sbjct: 249 NEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREGRRATLREQIGRLTVKMTGVMIVTLL 308

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P L++V  GP I++++  + 
Sbjct: 309 PALLIVTAGPGIMTVLSALA 328


>gi|153950588|ref|YP_001399590.1| type II secretion system protein [Yersinia pseudotuberculosis IP
           31758]
 gi|152962083|gb|ABS49544.1| type II secretion system protein [Yersinia pseudotuberculosis IP
           31758]
          Length = 277

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 93/204 (45%), Gaps = 1/204 (0%)

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I+  IL I+ I     ++    +  +   +L        P + I N + KR +++ ++ P
Sbjct: 74  IVIFILSILAILAIFNVVNINQKTLLTIGLLSIISTLYLPRMIIKNALTKRTNTLLKSLP 133

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+   CV+SG++I+ +L    +     +  L   M             + A +    
Sbjct: 134 FFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEIN-GLENAIKELQY 192

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
            +    ++     L  S  +G+++ + L  L  + R  +L+  E+  + L  KLT+P+ +
Sbjct: 193 YSPAIEMKMFCSTLQYSLSFGSTVYEQLTHLSQDMREMQLLMTEESISKLSTKLTLPLFL 252

Query: 305 FFLPVLILVIIGPAILSIIDTMKD 328
           F L   +L++I P+IL +++ +K+
Sbjct: 253 FILIPFVLLVISPSILELLNYVKN 276


>gi|293606486|ref|ZP_06688844.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815109|gb|EFF74232.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
          Length = 330

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/300 (17%), Positives = 114/300 (38%), Gaps = 6/300 (2%)

Query: 32  VIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLN--- 88
            +        + R + V  +    R+    +      +    +  ++    F K+L+   
Sbjct: 28  GVSMTRRLRGQGRSRQVIDQALATRQGGGAAAAPVEGNPGRLSSAARVADAFGKRLSEGR 87

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLN-ILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           L   L+       +  AG+ +  +     +  R  + I   I+ ++      K L     
Sbjct: 88  LADTLLAAEDRKMVDMAGYANAGTARSRFVAARFGLAIALPIVAVL--IDLHKSLTNSSM 145

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
               A      +G+  P   +S  + +R+       P  +DLL +    G+SIDQ+++ +
Sbjct: 146 GVFIAAFFGFAIGYMLPKWVVSRRLARRKRMAGDELPLLIDLLRLLQGVGLSIDQSMQVL 205

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            ++       LS E+ L          R+ +          D +    + + Q D++G +
Sbjct: 206 IKEFAQVLPVLSYELRLASEGYVRGRTREQSLARLATGFDNDDLSAICRLIAQVDQHGGA 265

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           + + L       R +R +E ++K A    K+T  MI+  LP L++V  G   ++++  + 
Sbjct: 266 VQEPLNRFGERLRDKRRLELKEKVAKTTVKMTGVMIVTLLPALLIVTGGAGFIAVLRGLS 325


>gi|237798377|ref|ZP_04586838.1| type II secretion system protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021229|gb|EGI01286.1| type II secretion system protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 295

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 113/275 (41%), Gaps = 6/275 (2%)

Query: 55  LRKQQITSLQKDSASSRLRTRDSKSLRNFV--KKLNLKAILVDENIVNKLRAAGFRSEYS 112
            R++    + +      +R     SL   +   ++  ++I +D      L   G+R    
Sbjct: 23  RRRRNERLVAQRLRGKVVRESRIGSLLRLLGDTRIGQRSISLDSETQVLLNRIGWRRARK 82

Query: 113 LNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLV 172
            ++    ++ VPI  + +  +    + K +E P    + A +     G+  P   ++ + 
Sbjct: 83  RSLFAACQIGVPIGLMCVVALGQLLFFKNIEQP----LIAPVFALGAGYLLPKRALAAVA 138

Query: 173 QKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFL 232
           ++RQ  I       + LL I  ESG++++QALR ++ +       LSEE+ + +A +   
Sbjct: 139 KRRQKQIVVEISTFIPLLRILFESGMAVEQALRVLSNEGKDLLPVLSEEIRVVLARVDSG 198

Query: 233 PNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAA 292
                          +D + +    L Q    G     SL  L       RL   ++  +
Sbjct: 199 LELGEELRKMAALLDVDELSDTCIILNQLIHQGGGALKSLLTLKQLIDDRRLTRLQEYIS 258

Query: 293 SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
            L  K+++ M++F  P L++V+ GP  ++I   + 
Sbjct: 259 KLSAKMSMVMMVFLFPALLIVLAGPGFIAISRALG 293


>gi|115361040|ref|YP_778177.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115286368|gb|ABI91843.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 325

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/320 (17%), Positives = 113/320 (35%), Gaps = 25/320 (7%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D+      I T V++   I  V            R          LR        +   
Sbjct: 1   MDSIYYGFVILTFVAVVLAIEGVYQWWNARHGAAARRIE-----SRLRAMSAGGSVQQER 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R     + F     L  +   + +   L+ +G   ++++  L+ +  V+P+   
Sbjct: 56  LSILKKRMLDESKPF--DRLLMRVPRIQALDLVLQQSGL--DWTVAKLVTISAVLPVTAA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +   +              L + AV+ I  +  C P++++     +R   ++R  PD  D
Sbjct: 112 LALAV------------TPLPLIAVLPIALLTACLPAMYVMRHRNRRMLKLERQLPDICD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   + SG S   AL  V E+      P+  E  +T  E+++  +   A  N   R   
Sbjct: 160 MIARALRSGHSFSSALGMVGEEFPD---PMGGEFRITFDEINYGVSLHDALVNLATRVPA 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R    A++     G ++ + L  + S  R    +  + +  S   +L+   I+  LP
Sbjct: 217 HDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSAEGRLSA-WILGLLP 275

Query: 309 VLILVIIGPAILSIIDTMKD 328
                ++       +  +  
Sbjct: 276 FGTAAMMAMMNREFLSVLWQ 295


>gi|16127171|ref|NP_421735.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|221235972|ref|YP_002518409.1| TadB-like pilus assembly protein [Caulobacter crescentus NA1000]
 gi|7208429|gb|AAF40196.1|AF229646_8 TadB [Caulobacter crescentus CB15]
 gi|13424567|gb|AAK24903.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|220965145|gb|ACL96501.1| TadB-related pilus assembly protein [Caulobacter crescentus NA1000]
          Length = 325

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/313 (16%), Positives = 117/313 (37%), Gaps = 20/313 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + +   +  F  I  +     G        K+    + I +  +  +  +  A++    
Sbjct: 1   MLFVLAGILGFITIAGLGFAFAGGDSASS--KAAKRAQIIAKGGERQANVRAKAAANTPD 58

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +++   +K  + K      +I  +L+AAG      +             F I+    
Sbjct: 59  ARRQAILKALKDQDRKQKKASLSIAARLQAAGLGDNVKM-------------FWIVSGTL 105

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                 ++    Q  + A+      G   P   +  L + R      A+ DA+D+++  +
Sbjct: 106 GLFIAMIILLLGQSPLVALGAGFAAGAGLPRWVLGFLAKGRTQKFTEAFADAVDIIVRGI 165

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           +SG+ +   L+ + ++      PL+ E  +    ++       A E  Y R   + +R  
Sbjct: 166 KSGLPVHDCLKIIGKECPE---PLAGEFRILTENVAMGVPMDAALEKMYERMPTNELRFF 222

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP--VLIL 312
              L    + G ++ ++L  L +  RS +LM+ + KA S     +  +I    P  V ++
Sbjct: 223 AIVLAIQQKTGGNLAEALGNLSAVLRSRKLMKEKIKALSAEAVASAFIIGCLPPGVVTLI 282

Query: 313 VIIGPAILSIIDT 325
            +  PA ++ + T
Sbjct: 283 SVTSPAYMAPMFT 295


>gi|119961380|ref|YP_948378.1| type II secretion system protein subunit F [Arthrobacter aurescens
           TC1]
 gi|119948239|gb|ABM07150.1| putative type II secretion system protein F domain [Arthrobacter
           aurescens TC1]
          Length = 313

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/284 (15%), Positives = 106/284 (37%), Gaps = 6/284 (2%)

Query: 28  IYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL 87
           +  V +P +       R++     + +  +   T     +            +R+ +  +
Sbjct: 21  LIVVRLPFMRGTRFADRIEPQLKSQNLESRLLRTPTHNLTPFGPFERILRPIIRDALTSM 80

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           + +  + +  +  KL  AG  S+ S       +L+      +L I+ +        +   
Sbjct: 81  S-RFNVGNTALAKKLARAG--SKKSTLDFRAEQLLWAGAAFVLSIVVVVAGASAGRFSPA 137

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
           +   +VI     G+      +   +++R+S +   +P   +L+ + V +G   + A+  +
Sbjct: 138 VSCSSVIASALGGYLLRDYALGLRIKRRESRMLSEFPSLAELMALAVAAG---ESAMGAM 194

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
                  +  LS E    +A+         A + F +R+++  +      L+ +   GT 
Sbjct: 195 DRVSRSSNGELSAEFATILADTRSGKPLTEALQAFSSRSELPPLVRFIDGLMVAVERGTP 254

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           + D LR   ++ R     +  + A      + VP++   LP+ +
Sbjct: 255 LADVLRAQAADVRDAAKRDLMESAGRKEIAMMVPLVFGVLPLTV 298


>gi|152981972|ref|YP_001355002.1| Flp pilus assembly protein TadC [Janthinobacterium sp. Marseille]
 gi|151282049|gb|ABR90459.1| Flp pilus assembly protein TadC [Janthinobacterium sp. Marseille]
          Length = 317

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 59/292 (20%), Positives = 114/292 (39%), Gaps = 8/292 (2%)

Query: 39  GELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKL--NLKAILVDE 96
            +L + M+S     +++  Q+    +K      LR      L      +   L   LV  
Sbjct: 27  RQLWQFMRSERTLEKMIDVQEHPGAEKLPEGPVLRRWMDGFLAYMAHWVDTPLGKQLVAP 86

Query: 97  NIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
                L   G        +    R+++ I   I   +         E   Q  + AV   
Sbjct: 87  EDRTLLDQCGVNDSRGKTLFFATRVLLGIGLPIFAWLLF------AEKSIQTLLLAVFFG 140

Query: 157 GYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSV 216
             +G+  P   +    ++R+       P  +DLL +    G+SIDQ+L  V  +      
Sbjct: 141 FALGYMGPKWVMQIRARERRQQANEELPLLIDLLRLLQGVGMSIDQSLHVVENEFSTSLP 200

Query: 217 PLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLV 276
            L +E+ +   +      R+ +   F +  + + +    + ++Q DRYG ++   L+   
Sbjct: 201 VLGKELQIAAQQYQNGRTREQSLRRFSSLFENEDMSAVARLIVQVDRYGGAVQQPLQQFS 260

Query: 277 SETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKD 328
              R +R ++ ++K   L  K+T  M++  LP L+++  G   L+II T+  
Sbjct: 261 DRLREQRKLDMKEKVGKLTVKMTGVMVLALLPALLIITGGAGFLAIIRTLSK 312


>gi|116689547|ref|YP_835170.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|116647636|gb|ABK08277.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 332

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 128/320 (40%), Gaps = 11/320 (3%)

Query: 13  ELAVAITTAVSIFSLIYA-----VVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            + V +  A++I  ++        ++ +L          +         ++    +    
Sbjct: 15  SVGVLLLAALAIVRIVLVQRAERALLHALDRRAAAVEAAAARAGSADAAREAAAPVAPRV 74

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             +RLR R       ++        L+ +     L   GF    +  + +  R+V  I+ 
Sbjct: 75  RFARLRERFEDVGMRWLD-TGFSRYLIADEDRRLLEQCGFVDVRARALFVGARIVCAILL 133

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             L ++ + G  +   +P  L +         G+  P +++      R+ S+    P  +
Sbjct: 134 PALAVLVLIGRGQQARWPLWLSI-----ALVTGYMLPKIYVRRRATARRQSLAAELPLLV 188

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+L +    G+S+DQ+++ V  D       LS E+ +   + +    R+ + +   N   
Sbjct: 189 DMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWELGVAQRQFAAGRTREQSLQRLTNSFD 248

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
            + +R   + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+  L
Sbjct: 249 NEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREGRRATLREQIGRLTVKMTGVMIVTLL 308

Query: 308 PVLILVIIGPAILSIIDTMK 327
           P L++V  GP I++++  + 
Sbjct: 309 PALLIVTAGPGIMTVLSALA 328


>gi|207728102|ref|YP_002256496.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
 gi|206591347|emb|CAQ56959.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
          Length = 325

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/321 (14%), Positives = 115/321 (35%), Gaps = 27/321 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPS-LGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            D   +   ++  V+I   +  + +       +  KR+         L+   ++S +   
Sbjct: 1   MDTLVIGFVLSVFVAIALGVSGLYLWWDSSHSQTAKRLSQ------RLKMALLSSARHGG 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R             L  +     +   L  +G    +S    L + L +P++ 
Sbjct: 55  DESILKQRVLAESPEVAA--MLGRLPRIAQLDRILLQSGL--NWSAGRFLALSLGLPVVV 110

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           ++               P      A + +       PS ++     +R   ++   P+A 
Sbjct: 111 IV------------GMSPLNPPWMATLALAVAAGSLPSFYVMYRRTRRLLRLEAQLPEAT 158

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+   + +G S+  AL    +++     P+  E+ +   ++++  +   A     +R  
Sbjct: 159 DLISRALRAGHSLPSALEMAGDELP---QPIGPELAIVFGQINYGVSMNDALAGLIDRVP 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D +R    A++     G ++ + L  + +  R    +  + +  S   +L    I+  L
Sbjct: 216 VDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRL-GGWILTAL 274

Query: 308 PVLILVIIGPAILSIIDTMKD 328
           P  + V++      ++ T+  
Sbjct: 275 PPAMAVVVYQLNPELMSTLWK 295


>gi|172065280|ref|YP_001815992.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171997522|gb|ACB68439.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 325

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 54/308 (17%), Positives = 110/308 (35%), Gaps = 25/308 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D+      I T V++   I  V            R          LR        +   
Sbjct: 1   MDSIYYGFVILTFVAVVLAIEGVYQWWNARHGAAARRIE-----SRLRAMSAGGSVQQER 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R     + F     L  +   + +   L+ +G   ++++  L+ +  V+P+   
Sbjct: 56  LSILKKRMLDESKPF--DRLLMRVPRIQALDLVLQQSGL--DWTVAKLVAISAVLPVTAA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           +   +              L +  V+ I  +  C P++++     +R   ++R  PD  D
Sbjct: 112 LALAV------------TPLPLIVVLPIALLTACLPAMYVMRHRNRRMLKLERQLPDICD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   + SG S   AL  V E+      P+  E  +T  E+++  +   A  N   R   
Sbjct: 160 MIARALRSGHSFSSALGMVGEEFPD---PMGGEFRITFDEINYGVSLHDALVNLATRVPA 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R    A++     G ++ + L  + S  R    +  + +  S   +L+   I+  LP
Sbjct: 217 HDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSAEGRLSA-WILGLLP 275

Query: 309 VLILVIIG 316
                ++ 
Sbjct: 276 FGTAAMMA 283


>gi|296156493|ref|ZP_06839331.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893092|gb|EFG72872.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 325

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/317 (16%), Positives = 112/317 (35%), Gaps = 28/317 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            + + +  A+   +++   I  V +            K V    E +R            
Sbjct: 1   MNTSFIGFAVLAFLAVVLSIEGVYLFWTSHHS-----KGVKRMDERIRALSAGGNVSSEQ 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R      +      L  +     +  +L+ +G   ++S+   +   L+  +   
Sbjct: 56  LSILKRRMLSD--SPFVTSLLLRMPRVHALDRQLQQSGL--KWSVARFIAYTLLSALTGA 111

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
             G +       L             +   V    P++ +     +R   ++R  PDA D
Sbjct: 112 FAGFVLHVPAPVLG------------VFAAVAGLLPTMIVRRKRVRRILQLERQLPDAAD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+   + +G S    L  V +++     PL  E  L   E+++  +   A  N  +R  +
Sbjct: 160 LIARALRAGHSFPATLGMVGQELPD---PLGGEFALVFDEINYGVSMNDALLNMVSRVPV 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
           + +R    A++     G ++ + L  +    R    +  + +  S   +L+   ++  LP
Sbjct: 217 EDLRYFVIAVLIQREAGGNLAEILGSISGIIRERLKLLGKVRVLSAEGRLSA-WVLAVLP 275

Query: 309 VLILVI---IGPAILSI 322
             IL +   + P  +S+
Sbjct: 276 FAILGLLTVLNPGYISV 292


>gi|167836788|ref|ZP_02463671.1| type II secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 267

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 98/252 (38%), Gaps = 6/252 (2%)

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             +      +    L   +V E     L   G+   ++  + L  R+   I       + 
Sbjct: 17  DRAGKFGMRLLDTRLGKQIVAEEDRMLLEQCGYVDAHTRGVFLSARIACAIALPAAVALA 76

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                +     +      V L    GF  P +++      R+ S+    P  +D+L +  
Sbjct: 77  GGETVRTHLTAW------VALCVIAGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQ 130

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
             G+S+DQ+++ V  D  G    LS E+ +   +      R+ + +        + +R  
Sbjct: 131 GVGLSLDQSIQVVTNDFKGMLPVLSSELGIAQRQFVAGRTREQSLQRLATSFDNEDLRAI 190

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+  LP L +V 
Sbjct: 191 VRLLIQVDKHGGAVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVT 250

Query: 315 IGPAILSIIDTM 326
            GP +L++   +
Sbjct: 251 AGPGMLAVTHAL 262


>gi|107022598|ref|YP_620925.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|105892787|gb|ABF75952.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
          Length = 321

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 58/323 (17%), Positives = 125/323 (38%), Gaps = 10/323 (3%)

Query: 9   FDATELAVAITTAVSIFSLIY----AVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQ 64
            DA  L         +  ++       ++ +L          +         ++    + 
Sbjct: 1   MDANRLGALALVLAIVRIVLVQRAERALLHALDRRAAAVEAAAARAGSADAAREAAAPVA 60

Query: 65  KDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVP 124
                +RLR R       ++        L+ +     L   GF    +  + +  R+V  
Sbjct: 61  PRVRFARLRERFEDVGMRWLD-TGFSRYLIADEDRRLLEQCGFVDVRARALFVGARIVCA 119

Query: 125 IIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWP 184
           I+   L ++ + G  +   +P  L +         G+  P +++      R+ S+    P
Sbjct: 120 ILLPALAVLVLIGRGQQARWPLWLSI-----ALVTGYMLPKIYVRRRATARRQSLAAELP 174

Query: 185 DALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYN 244
             +D+L +    G+S+DQ+++ V  D       LS E+ +   + +    R+ + +   N
Sbjct: 175 LLVDMLRLLQGVGLSLDQSIQVVTHDFQTMLPVLSWELGVAQRQFAAGRTREQSLQRLTN 234

Query: 245 RTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
               + +R   + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+
Sbjct: 235 SFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREGRRATLREQIGRLTVKMTGVMIV 294

Query: 305 FFLPVLILVIIGPAILSIIDTMK 327
             LP L++V  GP I++++  + 
Sbjct: 295 TLLPALLIVTAGPGIMTVLSALA 317


>gi|297618077|ref|YP_003703236.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145914|gb|ADI02671.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 329

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/289 (12%), Positives = 95/289 (32%), Gaps = 28/289 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
              +   V   ++ + + +       L  R   V    E        + +K+ ++  L+ 
Sbjct: 15  MGFVLVMVFFTAMFFTLALV-----RLLDRKSEVKDRLERYIAGNAENEKKEKSTPALKA 69

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
              +    F  +         E I  +L  AG   +      + + +++      +  + 
Sbjct: 70  GFERMASVFASR------SYTEKIQVELLQAGLPLKG--EEFITLWVLLATAIPAMTWLV 121

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
              +   +                     P  ++ +   +R  +  +   DAL ++   +
Sbjct: 122 TRNWPLAILVLLLAV------------FGPRFYLQHKKGERLKTFNQQLGDALVIMANAL 169

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G    QA+  V  ++     P+S E   T+ E+      + +  N   R + D +   
Sbjct: 170 RAGFGFQQAMETVRREL---PPPISTEFEWTLREIQLGSTTEESLLNLCERVKSDDLDMV 226

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
             A++   + G ++   L  +    R    ++ E +  +   +L+  +I
Sbjct: 227 VTAVLIQRQVGGNLAQILDNISRTIRDRTRIKGEIRTLTAQGRLSGIII 275


>gi|154250530|ref|YP_001411354.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154480|gb|ABS61697.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 315

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/279 (18%), Positives = 120/279 (43%), Gaps = 6/279 (2%)

Query: 48  VAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGF 107
           + V    +  +       +     L       L    +++      V+  +      AGF
Sbjct: 29  LLVRHREVSARLSLLFTPEREYGTLTETALVLLERLGRRIE--GTRVNRELRQLALRAGF 86

Query: 108 RSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVW 167
               S+ + + +R  V +   ++ ++           P    +   +  GY+ +    + 
Sbjct: 87  FQPSSVYVFVALRYGVALAIGLVIVLAR----SDGGVPAVADILYGVFFGYLFYRYVLIA 142

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +     +R ++I+R  P  LD++L+ +++G+S+DQ +R VA  +   +    + +   IA
Sbjct: 143 LGVYADRRANTIRRELPPVLDIMLMALDAGVSVDQCMRYVAGVVRRTAPVTGKVLRRHIA 202

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           ++        A +    R  +D  ++    + Q+   G  +  +LR    +   +R+  A
Sbjct: 203 DIDAGMPYDAALDRLGQRLGLDEGQDLAATIKQALFQGGELSTTLRRFSVDLSDKRMGMA 262

Query: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTM 326
            ++     P+LT+ MI+FF+PVL++V+ GPA++++   +
Sbjct: 263 REQVGRKAPQLTLVMILFFMPVLLIVLAGPAVVTLQGAL 301


>gi|220923699|ref|YP_002499001.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948306|gb|ACL58698.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 327

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/314 (16%), Positives = 113/314 (35%), Gaps = 19/314 (6%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + + +            +++ +        R  ++    +++R     + +   +    R
Sbjct: 1   MLLPLLVFFLGAFSTGGLLLAAF--HPRLARTSALDRRLQLVRASAGQTTRAAGSDDNRR 58

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            R  + L    ++          ++V +LR A      S             I L +G +
Sbjct: 59  KRSVQELLRETEQKQKAKNSAKLSLVMRLRQADLGWSKSTYY---------TICLTVGTL 109

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
                  L+       VG  +     G   P +++S   ++R       +P+A+D+++  
Sbjct: 110 AFLAMWGLMGLGLLPAVGFGLCG---GMLLPHLYVSARRKRRFKRFAAEFPNAIDVIVRG 166

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           V++G+ +   L  VA        P+  E    + + +     Q A E    R  +   R 
Sbjct: 167 VKAGLPLVDCLNIVA---AEAQEPVKSEFRALVEDQTLGMPLQDAVERLPERMPLSEARF 223

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL--I 311
               +    R G S+ ++L  L    R  + M+ + KA S   K +  +I     V+  +
Sbjct: 224 FAIVIAIQSRTGGSLSEALGNLSRVLRERKKMQGKIKAVSSEAKASAGIIAALPIVVGSL 283

Query: 312 LVIIGPAILSIIDT 325
           + +  PA ++++ T
Sbjct: 284 VYLTSPAYMALLFT 297


>gi|170700845|ref|ZP_02891834.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170134253|gb|EDT02592.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 325

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 104/308 (33%), Gaps = 25/308 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D+      I T V++   I  V            R          LR        +   
Sbjct: 1   MDSIYYGFVILTFVAVVLAIEGVYQWWNARHGAAARRIE-----SRLRAMSAGGSVQQER 55

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+ R     + F     L  +   + +   L+ +G                  +  L
Sbjct: 56  LSILKKRMLDESKPF--DRLLMRVPRIQALDLVLQQSGLD--------------WTVAKL 99

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
           ++    +     L+     L +  V+ I  +  C P++++     +R   ++R  PD  D
Sbjct: 100 VVISAVLAVTAALVLTVSPLPLITVLPIALLTACLPAMYVMRHRNRRMLKLERQLPDICD 159

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   + SG S   AL  V E+      P+  E  +T  E+++  +   A  N   R   
Sbjct: 160 MIARALRSGHSFSSALGMVGEEFPE---PMGGEFRITFDEINYGVSLHDALVNLATRVPA 216

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R    A++     G ++ + L  + S  R    +  + +  S   +L+   I+  LP
Sbjct: 217 HDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSAEGRLSA-WILGLLP 275

Query: 309 VLILVIIG 316
                ++ 
Sbjct: 276 FGTAAMMA 283


>gi|253996762|ref|YP_003048826.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983441|gb|ACT48299.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 322

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 58/321 (18%), Positives = 125/321 (38%), Gaps = 33/321 (10%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLG-SGELEKRMKSVAVEREILRKQQITSLQKDS 67
            D      AI   +++   +    +      G   KR++         R+ +  +L K+ 
Sbjct: 1   MDYLYYLFAILAFLAVVLFLEGAYLAWNAYKGPEAKRIE---------RRLEAMTLGKEH 51

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            S+ ++ R   +         L+ +   + +   L  +G   +YS+   L + L+  ++ 
Sbjct: 52  ESTLVKQRMLANTPGVAS--MLQQVPRIQQLDKALLQSGL--QYSVAKFLGICLMFAVVG 107

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + + +               V   I++  V  C P + + +  QKR ++I++  P AL
Sbjct: 108 FAIALYFG------------ANVLVSIIVAAVAACLPLLHMFSAKQKRINTIEQQLPSAL 155

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+   + +G +   AL+ V  ++     P++ E  +   E+++      A  N   R  
Sbjct: 156 DLMGRAMVAGHAFPSALQMVGTEMPE---PIASEFRIVFDEINYGIPTSEALMNLIQRVP 212

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
              V     A++     G ++ + L  +    R+   +    +  S   +L+   I+  L
Sbjct: 213 STDVSYFVIAVLIQRETGGNLAELLGNISELIRARLKLLGSVRVLSAEGRLSA-WILTLL 271

Query: 308 PV---LILVIIGPAILSIIDT 325
           P     +L ++ P  LSI+ T
Sbjct: 272 PFALGAVLQLVNPKFLSILWT 292


>gi|303241710|ref|ZP_07328207.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590711|gb|EFL60462.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 327

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 125/312 (40%), Gaps = 21/312 (6%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + ++  VS     Y ++   +G      R+       E++  ++    ++      L   
Sbjct: 5   ILVSAFVSALLFSYQILKFLIGKQTPIMRLTRYTNLMEMVGGEEKRRSKQKEYKVGL--- 61

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +   VK+         + I  +L+ A           ++++    I   I+     
Sbjct: 62  --GFISRGVKEAKSLDGYK-KKIQLELQRA----------HILLKPEEYITVSIILFFAF 108

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
             +  +L     L +   I+ G +G+  PS++I   ++KR   +     DA+ L+   ++
Sbjct: 109 GTFMFVLASSSSLAILVAIVGGVIGWVLPSLYIKIKIKKRLRILNDQLNDAIVLISNSLK 168

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G S  QA+  V++++   + P++EE      E++F    + A EN   R   D +    
Sbjct: 169 AGYSFFQAVDIVSKEM---TGPMAEEFAQLQKEVNFGTTTEKALENLVTRVTSDDLELVV 225

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV--LILV 313
            A++   + G ++ + L  + +  R    ++ E K  +   +++  +I    P    IL 
Sbjct: 226 TAVLIQRQVGGNLSEVLDNISTTIRERIRIKGEVKTVTAQGRMSGMIIAALPPALGFILF 285

Query: 314 IIGPAILSIIDT 325
           +I  + + ++ T
Sbjct: 286 LINKSHVMVLFT 297


>gi|167620218|ref|ZP_02388849.1| hypothetical protein BthaB_28185 [Burkholderia thailandensis Bt4]
          Length = 268

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/266 (19%), Positives = 101/266 (37%), Gaps = 6/266 (2%)

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
            +     +        +      +    L   +V E     L   G+   ++  I L  R
Sbjct: 4   AAPHARRSRFATLLDRAGKFGMRLLDTRLGKQIVAEEDRMLLEQCGYVDAHTRGIFLSAR 63

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           +   I       ++     +     +      V L    GF  P +++      R+ S+ 
Sbjct: 64  IACSIALPAAVALFGSATVRTHLSAW------VALSVIAGFMLPKIYVRRRAAARRQSVV 117

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
              P  +D+L +    G+S+DQ+++ V  D  G    LS E+ +   +      R+ + +
Sbjct: 118 DEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFKGMLPVLSSELGIAQRQFVAGRTREQSLQ 177

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
                   + +R   + LIQ D++G ++ + L+      R  R     ++   L  K+T 
Sbjct: 178 RLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTG 237

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTM 326
            MI+  LP L +V  GP +L++   +
Sbjct: 238 VMILTLLPALFIVTAGPGMLAVTHAL 263


>gi|85713509|ref|ZP_01044499.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699413|gb|EAQ37280.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 324

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 60/320 (18%), Positives = 124/320 (38%), Gaps = 29/320 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSG-ELEKRMKSVAVEREILRKQQITSLQKDS 67
            +   LA+    A ++  + +  + P+L    + EKR  + A     +R+          
Sbjct: 1   MNLQTLALGFMAATAVGGVAWVFLYPALSGEMKAEKRRAAFARTTPAIRQVDRAQR---- 56

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
                R +   SLR   ++      L    + +++  AG    +S    L+V  V+ +I 
Sbjct: 57  ---SRREQIEGSLREIEQRQKRDRKL---TLNHRIAQAGL--SWSKEKFLIVSGVLAMIC 108

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
             + +I   G        F    G            P   +  L Q+R+++  RA PDA+
Sbjct: 109 FSVPMILGAGPLAAAGLAFAAGFGV-----------PRWLLGFLKQRRETAFLRALPDAV 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D+++  +++G+ + ++L+ V   +     PL  E    I   +       A    Y R  
Sbjct: 158 DVIVRGIKAGLPLFESLKVV---VADSPEPLKSEFAAIIETQAVGMPLGEACSRLYERMP 214

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +         +    + G ++ ++L  L    R  + M  + KA S   K +  +I    
Sbjct: 215 VPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIKAVSTEAKASAAIIGSLP 274

Query: 308 PVLILV--IIGPAILSIIDT 325
           P+++L+  +  P  ++++ T
Sbjct: 275 PIVMLLVYLSTPDYIALLWT 294


>gi|218530658|ref|YP_002421474.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|218522961|gb|ACK83546.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
          Length = 323

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 112/297 (37%), Gaps = 28/297 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
                 AV+  SL Y  ++P+L      ++ +    + + +  ++  +  +         
Sbjct: 8   LAVGLVAVAAGSLAYVFLMPALSGERRAEQRRRALGQPQAVLAERGAAASRREQ------ 61

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                +   +K+L  K       +  +L  AG   ++S     VV  +  ++  +   + 
Sbjct: 62  -----VAKSLKELEAKKDKTKVTLELRLARAGL--DWSRQKYRVVSAITAVVLALAAFLV 114

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                          + A + +   GF  P+ W+    ++R  +     P+A+D+++  +
Sbjct: 115 SHNV-----------IVAGLALFVGGFGLPAWWLKRRQKRRVEAFIEELPNAMDVVVRGL 163

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SGI +   LR +A        PL  E  +T+   +   +   A    Y R  +  V   
Sbjct: 164 RSGIPLGDCLRMIAR---EAKEPLRSEFRVTMESQALGLSMSDAILRMYERVPVTEVNFF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP ++
Sbjct: 221 SIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQAMSMEAKASAA-IIGALPFVV 276


>gi|238762413|ref|ZP_04623384.1| Type II secretion system protein [Yersinia kristensenii ATCC 33638]
 gi|238699398|gb|EEP92144.1| Type II secretion system protein [Yersinia kristensenii ATCC 33638]
          Length = 272

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 95/208 (45%), Gaps = 1/208 (0%)

Query: 116 LLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKR 175
             +    + II + L +  +     L     +  +   +++  +    P   + N++  R
Sbjct: 63  YNIAYFKLMIIIISLVVTVVLTALNLFSINLKNILIVGVIMLIMMLYLPKYIVKNIITSR 122

Query: 176 QSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNR 235
             S+ ++ P  +D+   CV+SG++ID +L   A+     +  LS  ML            
Sbjct: 123 NKSLLKSLPFFIDITAACVQSGMTIDSSLSYTAKKFELINADLSLIMLKVTRRAEIN-GL 181

Query: 236 QVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLG 295
           + A + F+  +    +R    AL  S  +G ++ + L  L  + R  +L+  E+K + L 
Sbjct: 182 ESAIKEFHQSSTELEIRMFCSALQYSISFGATVYEQLIKLSQDMREMQLLVTEEKISKLT 241

Query: 296 PKLTVPMIIFFLPVLILVIIGPAILSII 323
            KLT+P+ +F L   I+++I P++L ++
Sbjct: 242 AKLTIPLFLFILIPFIILVISPSVLELL 269


>gi|21673274|ref|NP_661339.1| TadB protein [Chlorobium tepidum TLS]
 gi|21646363|gb|AAM71681.1| tadB protein [Chlorobium tepidum TLS]
          Length = 305

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 100/240 (41%), Gaps = 7/240 (2%)

Query: 88  NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQ 147
           +L   L +  +   LR+     E  +N++   R       ++  ++ +F    L     +
Sbjct: 39  SLLTNLEEHELETWLRSRSRAFEKLVNLVQQSRSSFSAGSVLGLMLALFAVVLLAGLLTK 98

Query: 148 LRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRV 207
             +  ++++       P +W+S   +KR+ + +   P+ALD +   + +G S+  A+  +
Sbjct: 99  TNILFLLVLAVAIASMPVMWLSRKAKKRRMAFEAKLPEALDYISRSLRAGHSLSSAIGMI 158

Query: 208 AEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTS 267
            ++      PL  E      E++F    + AF +  NR + + +     AL+     G +
Sbjct: 159 GKEFPD---PLGGEFKTVFDEMNFGIPFKEAFAHLSNRIRSNDISFFVIALMIQHETGGN 215

Query: 268 IGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI---LVIIGPAILSIID 324
           + + L  L +  R    +  + +  S   +++  +++  +P +    + +I P  +  + 
Sbjct: 216 LAELLGGLATTIRERFKLRGKVRTLSSEGRISA-LVLGSMPFVFATIISLINPRYILPLF 274


>gi|326424177|ref|NP_762076.2| type II/IV secretion system protein TadC [Vibrio vulnificus CMCP6]
 gi|319999560|gb|AAO07066.2| Type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus CMCP6]
          Length = 292

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 62/290 (21%), Positives = 121/290 (41%), Gaps = 27/290 (9%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + I  A+ I  ++    +        E  ++ +    +  +K+                 
Sbjct: 9   IFIFVALIISVVVAVFALKVWDETRAEISVRKIIGSTKEQKKRD---------------- 52

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
                 +F K+ +       +    KL AAG  S++      + +++ P+   IL  +++
Sbjct: 53  --DLFLSFFKRFSFNK----DETKKKLVAAGVYSDFIAQTYYLFKII-PLFLTILISVYL 105

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
                L      L +   ++I  VG   P ++IS+        I    P  LDL+ +CV 
Sbjct: 106 MSIKVLDTNELILTIALGMVIFVVG---PDMYISSRANSITRHISSRLPFLLDLMNVCVH 162

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G++I+  L  +A+++      L+  + +T+           A E FY        ++  
Sbjct: 163 TGMTIEATLEYLAKELQTVDKYLAFTVNVTVQRSKV-IGINKALEEFYEMVPSSEAQSFV 221

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             LIQS ++G+S+G  L  L ++ R   +ME E+K   LG K+++PMI+F
Sbjct: 222 MTLIQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIPMIVF 271


>gi|83749634|ref|ZP_00946617.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|207744162|ref|YP_002260554.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
 gi|83723695|gb|EAP70890.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|206595566|emb|CAQ62493.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
          Length = 325

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/321 (14%), Positives = 116/321 (36%), Gaps = 27/321 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPS-LGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
            D   +   ++  V+I   +  + +       +  KR+         L+   ++S +   
Sbjct: 1   MDTLAIGFVLSVFVAIALGVSGLYLWWDSRHSQTAKRLSQ------RLKMALLSSARHGG 54

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             S L+ R     +       L  +     +   L  +G    +S    L + L +P++ 
Sbjct: 55  DESILKQRVLAESQEVAA--MLGQLPRIHQLDLILLQSGL--NWSAGRFLALTLGLPVVV 110

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           ++               P      A + +       PS ++     +R   ++   P+A 
Sbjct: 111 IV------------GVSPLAPPWMATLALAVAAGSLPSFYVMYRRTRRLLRLETQLPEAT 158

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DL+   + +G S+  AL    +++     P+  E+ +   ++++  +   A     +R  
Sbjct: 159 DLISRALRAGHSLPSALEMAGDELP---QPIGPELAIVFGQINYGVSMNDALAGLIDRVP 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           +D +R    A++     G ++ + L  + +  R    +  + +  S   +L    I+  L
Sbjct: 216 VDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRL-GGWILTAL 274

Query: 308 PVLILVIIGPAILSIIDTMKD 328
           P  + V++      ++ T+  
Sbjct: 275 PPAMAVVVYQLNPELMSTLWK 295


>gi|323491539|ref|ZP_08096718.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
 gi|323314115|gb|EGA67200.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
          Length = 322

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 122/319 (38%), Gaps = 29/319 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                    +    ++  +  A+++P+ GS    K +          R ++  S   + A
Sbjct: 1   MQQDATLFFVLLFFAVVFISQALILPAAGSKAKHKELSE--------RLKESQSKLDEEA 52

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
            S L+    KSL  + ++  L  I    ++   +  +G+  ++SL   L++     +   
Sbjct: 53  RSLLQEHYLKSLTPWDRR--LVKIEALSSLKKMIELSGY--DWSLTQTLMITSFASVCGF 108

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
            + ++                +   I      +     W+   +  R ++ +   P+ALD
Sbjct: 109 FIALLIG------------QPIYVGIAAIVAVWVCLYFWLGKKISDRLAAFEEQLPEALD 156

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           ++   +++G  + QA   V  ++     P+  E   T   L++  + ++A      RT  
Sbjct: 157 IMRRMLQAGQPVTQAFNEVGVEM---PAPIGIEFKNTFNLLNYGYDMRMAIMQMAERTPT 213

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +   + A++     G ++ ++L  +    R+   ++ + K  S   +L+  +++    
Sbjct: 214 VSMLAFSSAVLLQKETGGNLSENLEKVSRVLRARFKLQRKIKTLSAESRLSAWILVLSPF 273

Query: 309 VLILVI--IGPAILSIIDT 325
           VL + +  I P  +  + T
Sbjct: 274 VLFIFLSVINPGYVEPLYT 292


>gi|315121887|ref|YP_004062376.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495289|gb|ADR51888.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 328

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 117/308 (37%), Gaps = 20/308 (6%)

Query: 20  TAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKS 79
           + + +  +  +V             ++S +  R+  +  +        +++  R +  + 
Sbjct: 7   SFLLVGLISISVFFLLYFLLFKTTGLESSSESRDPKKVIKDKKNDTIPSAAVKRRKVLRD 66

Query: 80  LRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYD 139
             + ++  + +     +++ + +  +G    +S     +   V+ ++F I+ +       
Sbjct: 67  AMDKIELSHKEKFGNTKSLSSLISYSGIP--FSKEHFYIFSCVMGLVFGIISLALF---- 120

Query: 140 KLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGIS 199
                 F + +   +    V    P V +  L++KR +     +P+ALD+++  V SG+ 
Sbjct: 121 ----SSFFVSLCVCLSSALV---VPRVLLQYLIKKRTAKFLNEFPNALDIIVRSVRSGLP 173

Query: 200 IDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI 259
           +  A+  +   +G  S P+  E    +       +   +         +  V   +  + 
Sbjct: 174 VSDAISII---VGQSSDPVRSEFRRVVEAQHLGLSVSESVARMVRYMPLQEVSFFSTVIS 230

Query: 260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVII---G 316
              + G ++ ++L  L    R  + M+ + +A ++  K +   II  LP  +  ++    
Sbjct: 231 IQAQSGGNLSEALSNLSGILRERKKMKGKVQALAMEAKSSA-WIIGSLPFFVSSLVHFTS 289

Query: 317 PAILSIID 324
           P  + I+ 
Sbjct: 290 PGYIDILF 297


>gi|261856881|ref|YP_003264164.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837350|gb|ACX97117.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 298

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 60/290 (20%), Positives = 112/290 (38%), Gaps = 20/290 (6%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
            + I   V I   +  +     G                +    +     +D     LR 
Sbjct: 5   LIIILVGVLIAGSVGMLFWALTG---------------FLRDVPEADRNYQDPLPLGLRL 49

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                           +    E   + L+ AG     +   L  +R+   +   I+   +
Sbjct: 50  IWPLVNAATFVLAPRLSPDKLEKAHHTLQTAGQDFVLNPEQLYGLRV---VGAGIVVAFF 106

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                 L +    L    ++L   +G+  PS+W++   + RQ  + +  P  LD +++ V
Sbjct: 107 WLILAMLHKQSASLFAMTLVLGAVLGWLYPSLWLTERRKHRQRLVIKDLPVFLDFIVMAV 166

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
           E+G++I   + +    + G   PL++E    + ++     R  A +    R  M  + + 
Sbjct: 167 EAGLNITGGIEQA--TLKGPKGPLAQEFRRLLRDMRSGLARAEALKRMAERMDMPQISSF 224

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           T  LIQ+DR G S+G SLRV   + R ER + AEK A     K+ +P+++
Sbjct: 225 TGTLIQADRVGASLGASLRVQADQRREERFLRAEKLALEAPVKMMLPLVM 274


>gi|319788658|ref|YP_004148133.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467170|gb|ADV28902.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 296

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 57/297 (19%), Positives = 121/297 (40%), Gaps = 26/297 (8%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
                + VA+  A ++  ++                       R  +R+ ++        
Sbjct: 1   MSWMLILVALLAAGAVVLVMLG--------------------TRGAIREVELEDRTYYDP 40

Query: 69  SSRLRTRDSKSLRNFVKKLNLK-AILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
             RL       +    ++L  +  +   E    +L+AAG     +      +R    I+ 
Sbjct: 41  LPRLMQMMWPLVTVLTRRLAPRLNVSQLEQTHRQLQAAGQDYTLTPEEFYGLRAASAIVV 100

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           ++  ++ +    KL        +  V+  G +G+  P++W+    + R  ++ R  P  L
Sbjct: 101 ILFFLLCVLMLGKLGPSSV---LACVMFGGVLGWLYPALWLGERRKLRHKAVVRDLPVYL 157

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           D + + VE+G+++   + +      G +  LS+E    + ++     R  A +    R  
Sbjct: 158 DFITMSVEAGLNVTGGIEQAVA--KGPAGALSQEFSRMLRDIRAGLPRAEALKRMSERMD 215

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMII 304
           +  + N T ALIQ+D+ G ++ D+LR   ++ R ER + AEK A     K+ +P+++
Sbjct: 216 ISQITNFTSALIQADKVGANLSDTLRAQANQRREERFLRAEKLALEAPVKMMLPLVM 272


>gi|239814536|ref|YP_002943446.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801113|gb|ACS18180.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 330

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/324 (15%), Positives = 132/324 (40%), Gaps = 25/324 (7%)

Query: 4   YFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSL 63
            F +L   T + +++   V++  +I  + +         +  +   V++   R Q +++ 
Sbjct: 1   MFQNLVGDTLITLSVLVFVTVLMVIEGLYMLW-------RSYRGPGVQKIGKRLQALSAA 53

Query: 64  QKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVV 123
               A +RL      S   +++++ L  +     +   +  AG   E++++ +L+   + 
Sbjct: 54  TDRIAQARLVKDRVLSEAPWMQRV-LLKLPRAHRLDRFILQAGL--EWTVSHVLLACALS 110

Query: 124 PIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAW 183
            ++F              +           +L+   G   P +++++   +R + ++R  
Sbjct: 111 GMLFFFA-----------MTSLANQPAWIALLVSAAGAAVPLLYLNHRRSRRLAHLERQL 159

Query: 184 PDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFY 243
           PDALDL+   + +G S   +++ + +++   S P++ E  +   E+ F  + Q A  N  
Sbjct: 160 PDALDLVTRALRAGHSFASSVQMIGDEM---SEPIAGEFRMVADEVGFGVSLQQALTNMS 216

Query: 244 NRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMI 303
            R  +  +R    +++     G ++ + L  L    R    + A  +  S   +L+   I
Sbjct: 217 ERVPLTDLRYFVVSVLIQRDSGGNLTEVLGNLSRLIRDRLKLLARVRVLSAEGRLSA-WI 275

Query: 304 IFFLPVLILVIIGPAILSIIDTMK 327
           +  +P  ++ ++       +  + 
Sbjct: 276 LGLMPFALVALLNAFNPEFMSPLW 299


>gi|238027558|ref|YP_002911789.1| type II secretion system protein [Burkholderia glumae BGR1]
 gi|237876752|gb|ACR29085.1| Type II secretion system protein [Burkholderia glumae BGR1]
          Length = 330

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 61/318 (19%), Positives = 120/318 (37%), Gaps = 9/318 (2%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + V +   ++I   +         +  L++R+ +         + Q   L+   A     
Sbjct: 16  IGVLLLAGLAIVRAMLLQRSERALASALDQRLAASRAAAARAGQAQAAELKPAEARPAGF 75

Query: 74  TRDSKSLRNFVKKL---NLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
                       +     L   LV +     L   G+    S  + LVVRL   I   + 
Sbjct: 76  AAWRAQAERIGMRWLDTGLGKQLVADEDRKLLEQCGYVEARSRGLFLVVRLACAIGLPLA 135

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
                     L        +  + L    GF  P V++      R+ S+    P  +D+L
Sbjct: 136 ------ILPFLTHGGPGKWLFGLFLALAAGFMLPKVYVRRRAAARRESVADEMPLFVDML 189

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
            +    G+S+DQ+++ +  D       LS E+ +   + +    R+ +          + 
Sbjct: 190 RLLQGVGLSLDQSMQVITHDFTSMLPVLSWELGVAQRQFAAGRTREQSLARLTTSFDNED 249

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +R   + LIQ D++G ++ + LR+     R  R     ++   L  K+T  MI+  LP L
Sbjct: 250 LRAIVRLLIQVDKHGGAVQEPLRLFGDRLREGRRATLRERIGRLTVKMTGVMIVTLLPAL 309

Query: 311 ILVIIGPAILSIIDTMKD 328
           ++V  GP I++++  + +
Sbjct: 310 LIVTAGPGIMTVVVALAN 327


>gi|323700364|ref|ZP_08112276.1| Type II secretion system F domain [Desulfovibrio sp. ND132]
 gi|323460296|gb|EGB16161.1| Type II secretion system F domain [Desulfovibrio desulfuricans
           ND132]
          Length = 324

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 124/319 (38%), Gaps = 28/319 (8%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            +  L +A    + +F L+  +        +  +R        +   +    +   D+AS
Sbjct: 1   MSMTLIIAAAAVLIVFLLVMGIGSLMQSGSDKAER------RVKDRLRAMALTADIDAAS 54

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
             L  R++      +    L+++    N+   L  A   ++ S  + L++ +++ +I   
Sbjct: 55  VDLVLREAAMSEVPLFNRLLESMRWSSNLSRLLYQA--DAKGSPGVYLLLCMLLAVIGFY 112

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
            G              F  ++   +    +    P   +    +KR    ++  P+ALDL
Sbjct: 113 AG-------------SFSGKIWVSLAGAIMLGYLPIWILQGKKRKRMDRFQKQLPEALDL 159

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           +   +++G +    +R VA++  G   P+  E   T+ E+++  +   A  N  +R    
Sbjct: 160 MARALKAGHTFGGGMRMVADEFDG---PIGPEFGKTLDEINYGMDVDRALSNLQSRVDCP 216

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            ++    ++      G ++ + +  + +  R    +  + +  S   +++   I+  LP 
Sbjct: 217 DLKFFVVSVNIQRETGGNLAEIIAKIAALVRERFALFGKIRVLSAEGRVSA-YILIALPF 275

Query: 310 L---ILVIIGPAILSIIDT 325
           L   IL ++    +S++ T
Sbjct: 276 LLTGILYVVNSDYISLLWT 294


>gi|311743760|ref|ZP_07717566.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
 gi|311312890|gb|EFQ82801.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
          Length = 303

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/300 (16%), Positives = 107/300 (35%), Gaps = 6/300 (2%)

Query: 23  SIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRN 82
           ++  L++   +  + +G +  R  S+        +     L        +R      L +
Sbjct: 4   AVLGLLWGAGLCLVAAGWVRSRRPSLHDRVAPYVRDVHPVLAAGPPVGAVRAVFGPGLTS 63

Query: 83  FVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLL 142
              +L  + +   E++  +L  A      +L+     +LV     L              
Sbjct: 64  VASRLG-ELVGSSESVQRRLDRA--SGGGTLDEFRFRQLVWTAGTLAAAGSLSGLVWWER 120

Query: 143 EYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQ 202
                  +   ++    G       +S  V++R+ ++   +P   DLL + V +G S   
Sbjct: 121 RSGAVALLAFSLIAAIGGALVCDQRLSAEVRRREQAMTEEFPAVADLLALAVAAGESPTA 180

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSD 262
           AL+RV   +      L++E+   +AE+        AF+    RT +  +    + L  + 
Sbjct: 181 ALQRV---VARAHGELADELGRVLAEVRTGSTIVQAFDRLAARTGVTSIARFAEGLAVAV 237

Query: 263 RYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSI 322
             GT + D L    ++ R        +        + VP++   LPV ++    P ++ +
Sbjct: 238 DRGTPVVDVLHAQTADVREAARRHLMETGGRREVLMMVPVVFAILPVTVVFAFYPGLVGL 297


>gi|163733538|ref|ZP_02140981.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393326|gb|EDQ17652.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
          Length = 320

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 120/320 (37%), Gaps = 29/320 (9%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            + E  +     + +  L+  + + + G         S+        +       +D   
Sbjct: 1   MSPEPIIYGLIFIGVLVLVEGLYLVTFGKS------ISLNSRVNRRLEMLDKGTGRDEVL 54

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
            +LR    + +++               + + L   G +++ +       +LV+ +  L 
Sbjct: 55  EKLRKEMQQHMKS-----------KSIPLYSLL---GEKAQKAAIAFTPSQLVMIMGVLA 100

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +              P ++ +   I +G V F     W+S+   KR + I+   PDA++L
Sbjct: 101 VVAFLGLSVGTESSLPVRIMMSIGIGVGAVYF-----WVSSKANKRLAMIEEQLPDAVEL 155

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  +  G     A++ V++++     PL+ EM +   E ++  +   A +    R  M 
Sbjct: 156 MVRSLRVGHPFSSAVQIVSKEVQD---PLASEMGVIADESAYGRDVGDALKEMAERLDMQ 212

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +R    A+      G ++ + L  L    R+   +    KA +   K +    +   PV
Sbjct: 213 DLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVKAITAEAKWSGK-FLSAFPV 271

Query: 310 LILVIIGPAILSIIDTMKDH 329
           + L++I     +  D ++DH
Sbjct: 272 VALIVINVGDPNYYDAVRDH 291


>gi|167648148|ref|YP_001685811.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350578|gb|ABZ73313.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 325

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 59/315 (18%), Positives = 125/315 (39%), Gaps = 26/315 (8%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           +   +   ++I  L + +     GS +  KR + +A         +  +      + R  
Sbjct: 4   IIAGVLGFITIAGLGFVLAGGDGGSAKTVKRAQLIAGGDRQAVAARAKAAANSPDARR-- 61

Query: 74  TRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
               K +   +K+ + +      +I  +LRAAG              ++  +I L  G I
Sbjct: 62  ----KQILKTLKEQDQQKKKASLSIAARLRAAGLGDNT-----RNFWIISGVIGLTAGAI 112

Query: 134 WIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLIC 193
            +           Q+ + A+      GF  P   +  + + R      A+ DA+D+++  
Sbjct: 113 LLLLR--------QMPLIALGAAFGAGFGLPRWVVGMMAKARTKKFTEAFSDAIDIIVRG 164

Query: 194 VESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRN 253
           ++SG+ ++  L+ + ++      PL+ E  + +       +   A E  Y R   + +R 
Sbjct: 165 IKSGLPVNDCLKIIGKEC---PEPLAGEFRVLVENTGMGMSMDQALERMYERMPTNELRF 221

Query: 254 ATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILV 313
            T  L    + G ++ ++L  L +  R+ +LM  + KA S     +   II  LP  +++
Sbjct: 222 FTIVLTIQAKTGGNLAEALGNLSTVLRARKLMGEKIKALSAEAVASA-FIIGALPPGVVI 280

Query: 314 II---GPAILSIIDT 325
           +I    P  ++ + T
Sbjct: 281 LISVTAPTYMAPMFT 295


>gi|167570100|ref|ZP_02362974.1| hypothetical protein BoklC_09666 [Burkholderia oklahomensis C6786]
          Length = 261

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/252 (21%), Positives = 99/252 (39%), Gaps = 6/252 (2%)

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
             +  L   +    L   +V +     L   G+   ++  I L  R+   I       I 
Sbjct: 11  DRAGKLGMRLLDTRLGKQIVADEDRMLLEQCGYVDAHTRGIFLSARIACGIALPAAVAIV 70

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                   E         V L   VGF  P +++      R+ S+    P  +D+L +  
Sbjct: 71  G------DETVATHLSAWVALSVIVGFMLPKIYVRRRAAARRQSVVDEMPLLVDMLRLLQ 124

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
             G+S+DQ+++ V  D  G    LS E+ +   +      R+ + +        + +R  
Sbjct: 125 GVGLSLDQSIQVVTNDFKGMLPVLSSELGIAQRQFVAGRTREQSLQRLATSFDNEDLRAI 184

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
            + LIQ D++G ++ + L+      R  R     ++   L  K+T  MI+  LP L +V 
Sbjct: 185 VRLLIQVDKHGGAVQEPLKQFGDRLREVRRAMLRERIGRLTVKMTGVMIVTLLPALFIVT 244

Query: 315 IGPAILSIIDTM 326
            GP +L++   +
Sbjct: 245 AGPGMLAVAHAL 256


>gi|289641000|ref|ZP_06473169.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
 gi|289509120|gb|EFD30050.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
          Length = 315

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 105/293 (35%), Gaps = 6/293 (2%)

Query: 33  IPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAI 92
            P +    L  RM     +     +      +   +S        +           + +
Sbjct: 25  SPVVRRIRLADRMDPYLRDAPAQSRLLADRPRTTMSSRSGLEELLRPFVRDAAGRLDRFL 84

Query: 93  LVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGA 152
                ++ +L  AG R+  S+    V +++      ++G   +         P  +   A
Sbjct: 85  GGRAALLRRLTQAGGRT--SVEEFRVQQVICSAAGALVGAFLLLVRALTGVGPPSIVGVA 142

Query: 153 VILIGYVG-FCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDI 211
           +++ G  G   A   W++  +++R+  I   +P   +LL + V +G S   AL RV+   
Sbjct: 143 MVVAGVAGGIVARDWWLTRAIREREERILIEFPTVAELLALAVTAGESPVGALERVSRL- 201

Query: 212 GGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDS 271
                 L  E+ L +A+         A E    RT +  +      +  +   GT + + 
Sbjct: 202 --SHGELGRELRLALADARAGATLVQALEGMATRTTVPSLARFVDGMAVAIERGTPLAEV 259

Query: 272 LRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIID 324
           LR    + R     +  +        + VP++ F LP  ++    PA++S+  
Sbjct: 260 LRAQAVDVREAGKRQLLEAGGRKEIAMMVPVVFFVLPTTVIFAFYPALVSLSF 312


>gi|239908017|ref|YP_002954758.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239797883|dbj|BAH76872.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 326

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/285 (13%), Positives = 99/285 (34%), Gaps = 21/285 (7%)

Query: 44  RMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLR 103
           R+   + +    R +Q+T  +     +    +  +        + L        +   L 
Sbjct: 30  RLTDTSGKEIARRVEQVTRGEGLGLDTADLVKKHELSGLRWLDVLLSRQAWSRRMDKMLD 89

Query: 104 AAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA 163
            A    +  L I +++ L+  +   +   +++                  + +  V    
Sbjct: 90  QADI--KAPLGIFVMLSLIFAVTGYLAASLYLSN------------PLLSLAVAGVCGWL 135

Query: 164 PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEML 223
           P  W+     KR +  +R  P+AL+L+   + +G +    +  V  +      P+  E  
Sbjct: 136 PFKWVVMRKDKRMADFERQLPEALELVGRALRAGHTFTSGMGMVVSEFAD---PIRVEFQ 192

Query: 224 LTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSER 283
            T+ E++F      A +N  +R     +     ++   +  G ++ + +  +    R   
Sbjct: 193 TTLEEINFGMGVTTALDNLMDRVDCPDLNFFVVSVKIQNESGGNLAEIIGNISGLIRERF 252

Query: 284 LMEAEKKAASLGPKLTVPMIIFFLPV---LILVIIGPAILSIIDT 325
            ++   +  S   ++    ++  LP     ++  + P  L ++ T
Sbjct: 253 KLKGRIQVLSAEGRM-AAWVLCLLPFGVAAVIQFVNPGYLGLLFT 296


>gi|251791986|ref|YP_003006706.1| TadC [Aggregatibacter aphrophilus NJ8700]
 gi|247533373|gb|ACS96619.1| TadC [Aggregatibacter aphrophilus NJ8700]
          Length = 288

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 97/204 (47%), Gaps = 4/204 (1%)

Query: 119 VRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSS 178
           V+L++ I+      ++             +    ++++  +    P   ++++++ +   
Sbjct: 84  VKLLIMIVLCGACYLYSLNDSNPNSSSLLISFLTILVVTII---IPGFLVNSILKSKIKK 140

Query: 179 IKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVA 238
           I       +DL+ + V++G+SI+ AL++VA D    +  L+  ML  I +         A
Sbjct: 141 IMNDLAGFIDLVAVNVQTGVSIEAALKQVATDFKTLNPDLTYVMLRIIRKSEI-TGMSQA 199

Query: 239 FENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKL 298
            ++         +R     + QS  +G+SI   L  L S+ R  +L+  E+K  +L  K+
Sbjct: 200 LQDLSISLPTTEIRMFCTVMQQSLNFGSSIYHQLIQLSSDIRELQLLTIEEKLGTLAAKM 259

Query: 299 TVPMIIFFLPVLILVIIGPAILSI 322
           ++P+I+F +  +I++I+ P ++ +
Sbjct: 260 SIPLILFIMFPIIILILAPGVMRV 283


>gi|82703470|ref|YP_413036.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411535|gb|ABB75644.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 323

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/320 (15%), Positives = 117/320 (36%), Gaps = 30/320 (9%)

Query: 9   FDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSA 68
            D       I   +++  L+    +            +    +R   R Q +++   D+ 
Sbjct: 1   MDILYYLFLIFCFLAVVLLLEGGYLAWHAH-------RGPEAKRIQERLQAVSAGWGDAE 53

Query: 69  SSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFL 128
           +  ++ R   +     +   L  I    ++   L+ +G      +   L    +  +  +
Sbjct: 54  TGLMKQRLLSNSPALERF--LLQIPRIHSLDRLLQQSGM--SLMVTHFLGYTAMTALGGM 109

Query: 129 ILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALD 188
               +                    +L G  G   P  +  +  +KR   I+R  P+ +D
Sbjct: 110 ACAALLGL------------PFAVTLLCGATGSVLPLFFTLSAKRKRLEKIERQLPEVID 157

Query: 189 LLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQM 248
           L+   +++G +   AL+  +        P ++E  LT  E++F  + Q A  N   R  +
Sbjct: 158 LMARALKAGHAFSGALQMAST---DGPEPAADEFRLTFDEINFGVSVQDALMNLATRVPI 214

Query: 249 DCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP 308
             +R    A++     G ++ + L  +    R+   +  + +  S   +L+   I+  LP
Sbjct: 215 TDLRYFVIAVLIQRESGGNLAELLDKISGLIRARLTLLGKIRVLSAEGRLSA-WILSCLP 273

Query: 309 V---LILVIIGPAILSIIDT 325
               L++ ++ P  L+++ T
Sbjct: 274 FATALMINLVNPGFLTVLWT 293


>gi|329847257|ref|ZP_08262285.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842320|gb|EGF91889.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 337

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 123/318 (38%), Gaps = 17/318 (5%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLR 73
           + + +  A   F +I +V    +G G         A+ +        T+++         
Sbjct: 1   MLMTLLIAFLGFVVIASVGFAFIGGGGGGNSGGGAALTKRTQTIGLGTNMRGKRGGKSAA 60

Query: 74  TRDSKSLRNFVKKLNLKAILVDEN---IVNKLRAAGFRSEYSLNILLVVRLVVPIIFLIL 130
               +  +   ++L        +    + +++  AG     ++    ++  V+ ++  ++
Sbjct: 61  KSPEERRKQITEQLKEAEKRERKARLTLRSRMLHAGL--TPNVTQFWIITAVLGVVAFVV 118

Query: 131 GIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLL 190
            ++ +   D +L       + A+     + + AP   +  +   R       +P+A+D+L
Sbjct: 119 PLVLLGKMDFMLRL-----LVALGAGFALSYGAPRWVLGMMATGRLKKFTEEFPNAMDIL 173

Query: 191 LICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDC 250
           +  ++SG+ +   L+ +++       PL  E L  +  +    + + A E    R     
Sbjct: 174 VRGIKSGLPVHDGLKIISK---ESPAPLGPEFLRLVENVGVGMSVEGALEKMSERIPSPE 230

Query: 251 VRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVL 310
           +R  T  +    + G ++ ++L  L +  R+ ++M  + KA S     +   II  LP  
Sbjct: 231 LRFFTIVIAIQAKTGGNLAEALNNLSTVLRARKMMREKIKALSSEAIASAS-IIGVLPPG 289

Query: 311 ILVIIG---PAILSIIDT 325
           + V+I    P  +  + T
Sbjct: 290 VGVMISLTRPEYIGGMFT 307


>gi|110679392|ref|YP_682399.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455508|gb|ABG31713.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 320

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 120/320 (37%), Gaps = 29/320 (9%)

Query: 10  DATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSAS 69
            + E  +     + +  L+  + + + G         S+        +       +D   
Sbjct: 1   MSPEPIIYGLIFIGVLVLVEGLYLVTFGKS------ISLNSRVNRRLEMLDKGTGRDEVL 54

Query: 70  SRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLI 129
            +LR    + +++               + + L   G +++ +       +LV+ +  L 
Sbjct: 55  EKLRKEMQQHMKS-----------KSIPLYSLL---GEKAQKAAIAFTPSQLVMIMGMLA 100

Query: 130 LGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDL 189
           +              P ++ +   I +G V F     W+S+   KR + I+   PDA++L
Sbjct: 101 VVAFLGLSVGTASSLPVRIMMSIGIGVGAVYF-----WVSSKANKRLAMIEEQLPDAVEL 155

Query: 190 LLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMD 249
           ++  +  G     A++ V++++     PL+ EM +   E ++  +   A +    R  M 
Sbjct: 156 MVRSLRVGHPFSSAVQIVSKEVQD---PLASEMGVIADESAYGRDVGDALKEMAERLDMQ 212

Query: 250 CVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPV 309
            +R    A+      G ++ + L  L    R+   +    KA +   K +    +   PV
Sbjct: 213 DLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVKAITAEAKWSGK-FLSAFPV 271

Query: 310 LILVIIGPAILSIIDTMKDH 329
           + L++I     +  D ++DH
Sbjct: 272 VALIVINVGDPNYYDAVRDH 291


>gi|221067369|ref|ZP_03543474.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712392|gb|EED67760.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 329

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 114/270 (42%), Gaps = 4/270 (1%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
           +Q  S +      RLR   +    +   KL  + +L D   + ++  +  R+     +++
Sbjct: 33  KQYKSPEAKRLERRLRALSAADDHSSPTKLVKERVLSDMPRMQRMLQSMPRAHQLDRVIV 92

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
              L   +  L+LGI  +F    L    F L +  V+L G V  C P +++     +R  
Sbjct: 93  QSGLEWTVSGLLLGIGILFFLGALAASMFHLPMELVLLAGAVLGCLPWLYLQRKRNQRLG 152

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
            ++R  P+ALDL+   + +G +    L+   E++   S P++ E  L   E+++  + Q 
Sbjct: 153 LLERQIPEALDLIARALRAGHAFSAGLQMAGEEL---SEPIAGEFRLVHDEINYGTSLQQ 209

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           A  N   R  +  +R    A++     G ++ + L  L    R    + A+ +  S   +
Sbjct: 210 ALNNLGERIPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKIRVLSSEGR 269

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTMK 327
           ++   I+  +P  +  ++       + T+ 
Sbjct: 270 MSA-WILGLMPFALAALLNFVNPEFMSTLW 298


>gi|168702878|ref|ZP_02735155.1| secretion system protein TadB [Gemmata obscuriglobus UQM 2246]
          Length = 319

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 102/314 (32%), Gaps = 34/314 (10%)

Query: 14  LAVAITTAVSIFSLIYAVVIPSLGS--GELEKRMKSVAVEREILRKQQITSLQKDSASSR 71
           L + +     + +++  + +    +  G    R+  +              L++      
Sbjct: 4   LLLPVLIGGLVIAMVALLYLALRANPDGAAADRLDQLVGRSSRKDSSADMLLKQALQEVD 63

Query: 72  LRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILG 131
            +T   K +  F             N+      A    + S                + G
Sbjct: 64  KKTLMDKLMPEFF------------NLTKTFEQADCNIKPS---------------ALFG 96

Query: 132 IIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLL 191
           I             + + +  + +     F  P VW+      R  +     PDA++L+ 
Sbjct: 97  ISLGLSVLGAAMSIWLVNLYVLPIGALTCFALPWVWLHMKRSSRLKAFAAQLPDAMELVA 156

Query: 192 ICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCV 251
             + +G S+   +  VAE++     P+ +E      E +     + A +   +R     +
Sbjct: 157 RALRAGHSLAAGMHVVAEEM---PAPICKEFGRVYEEQNLGIPLEEALKGMCDRVPNLDL 213

Query: 252 RNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +    ++    + G  + + L  +    R    +  + KA +   +L+  ++I     L 
Sbjct: 214 KFFVTSVAIQRQTGGDLAEILDRIGHIIRERFKILGQVKALTAEGRLSGVVLIALPIGLF 273

Query: 312 LVIIG--PAILSII 323
           ++++   P  + ++
Sbjct: 274 VMMLWTKPDYVEML 287


>gi|167894486|ref|ZP_02481888.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 269

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/269 (18%), Positives = 99/269 (36%), Gaps = 6/269 (2%)

Query: 58  QQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILL 117
               +              +      +    L   +V +     L   G+   ++  I L
Sbjct: 2   MPEAAPDARRPRFAALLDRAGRFGMRLLDTRLGKQIVADEDRMLLEQCGYVDAHTRGIFL 61

Query: 118 VVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQS 177
             R+   I       +      +     +      V L    GF  P +++      R+ 
Sbjct: 62  SARIACAIALPAAVALVGGETVRTHLGAW------VALSVIAGFMLPKIYVRRRAAARRQ 115

Query: 178 SIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQV 237
           S+    P  +D+L +    G+S+DQ+++ V  D  G    LS E+ +   +      R+ 
Sbjct: 116 SVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFRGMLPVLSSELGIAQRQFVAGRTREQ 175

Query: 238 AFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPK 297
           + +        + +R   + LIQ D++G ++ + L+      R  R     ++   L  K
Sbjct: 176 SLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFGDRLREVRRAMLRERIGRLTVK 235

Query: 298 LTVPMIIFFLPVLILVIIGPAILSIIDTM 326
           +T  MI+  LP L +V  GP +L++   +
Sbjct: 236 MTGVMILTLLPALFIVTAGPGMLAVTHAL 264


>gi|37676258|ref|NP_936654.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37200799|dbj|BAC96624.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 292

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 62/290 (21%), Positives = 121/290 (41%), Gaps = 27/290 (9%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + I  A+ I  ++    +        E  ++ +    +  +K+                 
Sbjct: 9   IFIFVALIISVVVAVFALKVWDETRAEISVRKIIGSTKEQQKRD---------------- 52

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
                 +F K+ +       +    KL AAG  S++      + +++ P+   IL  +++
Sbjct: 53  --DLFLSFFKRFSFNK----DETKKKLVAAGVYSDFIAQTYYLFKII-PLFLTILISVYL 105

Query: 136 FGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVE 195
              + L      L +   ++I  VG   P ++IS+        I    P  LDL+ +CV 
Sbjct: 106 MSIEVLDTNELILTIALGMVIFVVG---PDMYISSRANSITRHISSRLPFLLDLMNVCVH 162

Query: 196 SGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNAT 255
           +G++I+  L  +A ++      L+  + +T+           A E FY        ++  
Sbjct: 163 TGMTIEATLEYLANELQTVDKYLAFTVNVTVQRSKV-IGINKALEEFYEMVPSSEAQSFV 221

Query: 256 QALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIF 305
             LIQS ++G+S+G  L  L ++ R   +ME E+K   LG K+++PMI+F
Sbjct: 222 MTLIQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIPMIVF 271


>gi|322434107|ref|YP_004216319.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161834|gb|ADW67539.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 320

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/313 (15%), Positives = 110/313 (35%), Gaps = 28/313 (8%)

Query: 16  VAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTR 75
           + +T  +    L + +V+  L   + EK ++          +++    +  + + +    
Sbjct: 1   MLVTIFIGALILSFGLVLFLLRPDDAEKALERKLRVISSDARKEQAETEGYALTVKKAEG 60

Query: 76  DSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWI 135
               +   V++ +        ++   +  +G                   +  ++GI  +
Sbjct: 61  ILFEIGEMVERYHFSQ-----DLQQLILHSG---------------TETTVGSVIGISAV 100

Query: 136 FGYDKLLEYPFQLRVGAV-ILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                 L     L +  V  +   VG  A  + +      R    + A PDA+DL+   +
Sbjct: 101 LAVAAALLAHIFLGIYIVDAVAFVVGGSARWMQLKWKKSSRLGKFEEALPDAIDLMARAL 160

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            +G ++  A+  VAE     + PL+ E  +   +  F    + A     +R     +   
Sbjct: 161 RAGHAMSSAIEVVAE---ESAEPLAGEFAIVFQQQKFGLQFRDALLQLGDRVPSKDLSFL 217

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVI 314
             A++     G  + D L       R    ++ E +  +   +LT   I+  LPV++L +
Sbjct: 218 ITAILVQKETGGDLTDVLDRTTRVIRERIRIQGEIRTYTAQGRLTG-WILSALPVVMLCL 276

Query: 315 IG---PAILSIID 324
           I    P    I+ 
Sbjct: 277 INVATPGYSHILF 289


>gi|219850072|ref|YP_002464505.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544331|gb|ACL26069.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 332

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 78/242 (32%), Gaps = 16/242 (6%)

Query: 89  LKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQL 148
           +       +I N+L  A    + ++     ++L   ++  + G                L
Sbjct: 72  VAKSKQGSSIKNELSRAAL--KLTVAEFFGLKLGAALLGGVFGAFLGRASPYAALALGLL 129

Query: 149 RVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVA 208
                          P +++     +R  +      D + ++   +  G S  Q L  VA
Sbjct: 130 CAIIFA-------FLPDIYVKVRAAQRVKAFNNQLGDVITMMANALRGGYSFLQTLDMVA 182

Query: 209 EDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSI 268
            +      P S E    + E+    + + A +N   R   D +     A+      G ++
Sbjct: 183 REAPD---PASTEFRRVVQEVGLGRSTEEALQNLLRRVPSDDLDLLVTAVSIQMEVGGNL 239

Query: 269 GDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLP---VLILVIIGPAILSIIDT 325
              L  +    R    ++ E    +   +++   II  LP      + ++ P  ++ + T
Sbjct: 240 AQVLDTIGHTIRERVRIKGEISTLTAQGRISS-WIITGLPIGLAAFITVVNPDYMAPLFT 298

Query: 326 MK 327
             
Sbjct: 299 FG 300


>gi|188581664|ref|YP_001925109.1| type II secretion system protein [Methylobacterium populi BJ001]
 gi|179345162|gb|ACB80574.1| type II secretion system protein [Methylobacterium populi BJ001]
          Length = 323

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/297 (16%), Positives = 109/297 (36%), Gaps = 28/297 (9%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRT 74
             A   AV+  +L Y  ++P L      ++ +    +   +  ++  +  +         
Sbjct: 8   LAAGLVAVASGALAYVFLMPLLSGERRAEQRRKALGQSRAVLAERGAAANRREQ------ 61

Query: 75  RDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIW 134
                +   +K+L  K       +  ++  AG   ++S     +V  V  +   +   + 
Sbjct: 62  -----VAKSLKELEAKKDKTKVTLELRIARAGL--DWSRRKYQIVSAVTAVGVALAAFLI 114

Query: 135 IFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICV 194
                          + A++ +   GF  P+  +    ++R ++     P+A+D+++  +
Sbjct: 115 SHNV-----------IVALLGLFAGGFGLPAWMLKWRQKRRVAAFVEELPNAMDVVVRGL 163

Query: 195 ESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNA 254
            SGI +   LR ++        PL  E  + +   +       A    Y R  +  V   
Sbjct: 164 RSGIPLGDCLRMISR---EAKEPLRSEFRVAMEAQAMGLPMSDAILRMYERVPVTEVNFF 220

Query: 255 TQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLI 311
           +  +    + G ++ ++L  L    R  + M  + +A S+  K +   II  LP LI
Sbjct: 221 SIVIGIQQKAGGNLSEALSNLSRVLRERKKMAGKIQAMSMEAKASAG-IIGALPFLI 276


>gi|167911130|ref|ZP_02498221.1