RPSBLAST alignment for GI: 254780721 and conserved domain: COG2064

>gnl|CDD|32247 COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 320
 Score =  115 bits (288), Expect = 2e-26
 Identities = 98/322 (30%), Positives = 148/322 (45%), Gaps = 5/322 (1%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           L    EL +    A  +F+L   VV+  L   EL   +K V  E   +    +  L   S
Sbjct: 1   LLMRAELYLTFLVARPLFALAILVVMAVLKRKELLLLLKGVDREIPRIILLSLIRLLIGS 60

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPII- 126
            S R        LR  +  L L     D     KL  A +R E +L + L   L+   + 
Sbjct: 61  VSIRELLAFL--LRKIISGLLLFFGGEDSKPRFKLVEALYRLELALPLFLFALLLALFLG 118

Query: 127 FLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDA 186
            L+   I +      +  P    +   +LI  +G   P +  S  ++KR   I R  PD 
Sbjct: 119 VLLSLPILLLVLGSFIILPLSDFLAIALLISLLGLPLPFILFSLALKKRLKEIARELPDF 178

Query: 187 LDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRT 246
           L L+ +C+E+G+S+  AL+RVA+++ GQ   L+EE+  T AELS   + + A      R 
Sbjct: 179 LRLMAVCLEAGLSLADALKRVADELYGQ-RILAEELARTTAELSLGLSIEEALIRLAVRL 237

Query: 247 QMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE-RLMEAEKKAASLGPKLTVPMIIF 305
             D V+     L Q+   G S+ D+LRVL  E   E RL   E +A  +G  + +P+I+ 
Sbjct: 238 GSDEVKRVVSLLTQALESGGSLADALRVLSMELSRETRLKLGEIRAGKIGVGILLPLILV 297

Query: 306 FLPVLILVIIGPAILSIIDTMK 327
            +PVL+ V+I PAIL I  +  
Sbjct: 298 IIPVLLFVVILPAILGIASSGG 319