RPSBLAST alignment for GI: 254780721 and conserved domain: COG4965

>gnl|CDD|34572 COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion]. Length = 309
 Score = 54.5 bits (131), Expect = 4e-08
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 8/196 (4%)

Query: 120 RLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSI 179
             +  +I L  G         +      L V  V LIG        +   +   +R    
Sbjct: 79  VSLARLILLSAGAGLAVAL--VAWLGLSLLVALVALIGAALLPRLVLR--SRRARRLKRF 134

Query: 180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAF 239
            +  P+ALDL++  + +G  +  ALR  A++      PL  E  L         +   A 
Sbjct: 135 GQQLPEALDLIVRALRAGAPLPDALRLAAKETPE---PLGTEFTLITDRQQLGIDLPAAL 191

Query: 240 ENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLT 299
              Y R  ++ +      +    R+G ++ + L  L    R  + M+A+ +A S   +++
Sbjct: 192 LRMYERYPLEELYFLAIVISIQSRHGGNLSELLDNLSRVIRERKKMKAKVRALSAEARMS 251

Query: 300 VPMIIFFLPVLILVII 315
              I+  LP+L+ ++I
Sbjct: 252 A-WILGALPLLVGLLI 266