RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780721|ref|YP_003065134.1| pilus component protein
[Candidatus Liberibacter asiaticus str. psy62]
         (329 letters)



>3c1q_A General secretion pathway protein F; type 2 secretion
           system, T2SS, T4PB, inner membrane, membrane,
           transmembrane, transport protein; HET: MSE PE5; 1.70A
           {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* (A:)
          Length = 123

 Score = 46.0 bits (109), Expect = 7e-06
 Identities = 15/129 (11%), Positives = 41/129 (31%), Gaps = 9/129 (6%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +    ++  S            L   V+SG  +++ LR VAE        +   ++   A
Sbjct: 1   MGFAFKRGIS--TPDLALITRQLATLVQSGXPLEECLRAVAEQSE--KPRIRTXLVAVRA 56

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           +++       +  ++ +            + + +      +   L  L     + +   +
Sbjct: 57  KVTEGYTLSDSLGDYPHVFDELFR-----SXVAAGEKSGHLDSVLERLADYAENRQKXRS 111

Query: 288 EKKAASLGP 296
           + + AS   
Sbjct: 112 KLQQASENL 120


>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman
           fold, hydrolase; 1.93A {Burkholderia cepacia} PDB:
           2no5_A* (A:33-106)
          Length = 74

 Score = 27.4 bits (61), Expect = 2.4
 Identities = 17/83 (20%), Positives = 29/83 (34%), Gaps = 17/83 (20%)

Query: 206 RVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS-DRY 264
           R A+++G  +  LS        E S+       + +F+  T         +AL  +   Y
Sbjct: 2   RNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTD--------EALTFALRTY 53

Query: 265 GTSIGDSLRVLVSETRSERLMEA 287
                  L+        +RLM A
Sbjct: 54  HLEDRKGLK--------DRLMSA 68


>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP}
           (A:20-91)
          Length = 72

 Score = 27.0 bits (60), Expect = 3.1
 Identities = 15/86 (17%), Positives = 26/86 (30%), Gaps = 17/86 (19%)

Query: 203 ALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS- 261
            + R  E   G+   +S        E ++L +    + NF   T+         AL  + 
Sbjct: 2   VVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATE--------DALRFTC 53

Query: 262 DRYGTSIGDSLRVLVSETRSERLMEA 287
              G  +    R          L +A
Sbjct: 54  RHLGLDLDARTR--------STLCDA 71


>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A
           {Xanthobacter autotrophicus} (A:18-89)
          Length = 72

 Score = 26.7 bits (59), Expect = 4.2
 Identities = 11/84 (13%), Positives = 26/84 (30%), Gaps = 17/84 (20%)

Query: 205 RRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQS-DR 263
                   G+   +++       E S+L      + +F++ T+        +AL  +   
Sbjct: 4   DATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYADFWSVTR--------EALAYTLGT 55

Query: 264 YGTSIGDSLRVLVSETRSERLMEA 287
            G    +S            + +A
Sbjct: 56  LGLEPDESFL--------ADMAQA 71


>2r6g_G Maltose transport system permease protein MALG; ABC
           transporter, catalytic intermediate, E. coli maltose
           transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli
           K12} (G:73-244)
          Length = 172

 Score = 25.6 bits (56), Expect = 8.4
 Identities = 22/126 (17%), Positives = 45/126 (35%), Gaps = 16/126 (12%)

Query: 107 FRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSV 166
           F  + +L   +++  + P +  ++ +  +F           L     ++  Y+G  A  V
Sbjct: 43  FPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHV 102

Query: 167 WISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTI 226
           W        +   +       +   +    G +  QA R V        +PLS  +L  +
Sbjct: 103 WT------IKGYFETIDSSLEEAAALD---GATPWQAFRLVL-------LPLSVPILAVV 146

Query: 227 AELSFL 232
             LSF+
Sbjct: 147 FILSFI 152


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.325    0.139    0.390 

Gapped
Lambda     K      H
   0.267   0.0617    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,284,571
Number of extensions: 97137
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's gapped: 314
Number of HSP's successfully gapped: 11
Length of query: 329
Length of database: 4,956,049
Length adjustment: 89
Effective length of query: 240
Effective length of database: 1,947,404
Effective search space: 467376960
Effective search space used: 467376960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.2 bits)