BLAST/BLAST alignment of GI: 254780721 and GI: 254780722
>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 187
 Score = 30.4 bits (67), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 17/110 (15%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL--------- 218
           + +L++KR +     +P+ALD+++  V +G+ +  A   VA  +G  S P+         
Sbjct: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57

Query: 219 SEEMLLTIAE-----LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ + L+++E     + ++P ++V+F +     Q     N ++AL    R
Sbjct: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSR 107