BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780721|ref|YP_003065134.1| pilus component protein
[Candidatus Liberibacter asiaticus str. psy62]
         (329 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 329

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60
           MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI
Sbjct: 1   MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQI 60

Query: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120
           TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR
Sbjct: 61  TSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVR 120

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180
           LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK
Sbjct: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIK 180

Query: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240
           RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE
Sbjct: 181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFE 240

Query: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300
           NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV
Sbjct: 241 NFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTV 300

Query: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329
           PMIIFFLPVLILVIIGPAILSIIDTMKDH
Sbjct: 301 PMIIFFLPVLILVIIGPAILSIIDTMKDH 329


>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 798

 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 157 GYVGFCAPSVWISNLVQKRQS-----SIKRAWPDALDLLLICVESGISIDQALRRVA 208
           GYVGF    +   ++ Q   S      I+++ PD L++LL  ++ GI  DQ+ ++++
Sbjct: 558 GYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKIS 614


>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 187

 Score = 30.4 bits (67), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 17/110 (15%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL--------- 218
           + +L++KR +     +P+ALD+++  V +G+ +  A   VA  +G  S P+         
Sbjct: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57

Query: 219 SEEMLLTIAE-----LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ + L+++E     + ++P ++V+F +     Q     N ++AL    R
Sbjct: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSR 107


>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score = 24.6 bits (52), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 101 KLRAAGFRSEYSLNILLVVRLVVPIIFLILGII 133
            L    F   Y   + ++  + +PIIFL+LG+I
Sbjct: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMI 37


>gi|254780237|ref|YP_003064650.1| DNA-directed RNA polymerase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 340

 Score = 23.9 bits (50), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 198 ISIDQALRRVAEDIGGQSVPLS-------EEMLLTIAELSFLPNRQVAF-ENFYNRTQMD 249
           I+ ++  + V EDI  +S+P +       EE+ L++   + L    + +  +   RT+ D
Sbjct: 232 INFEEPKKEVKEDINVKSLPFNPALLKKVEELELSVRSTNCLRGENIVYMGDLIQRTEAD 291

Query: 250 CVRNAT 255
            +R A 
Sbjct: 292 MLRMAN 297


>gi|254780904|ref|YP_003065317.1| tRNA/rRNA methyltransferase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 268

 Score = 23.5 bits (49), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 159 VGFCAPSVWISNLVQKRQSSIKRAWP 184
           +G  A ++W  NL Q R  + +  WP
Sbjct: 28  IGMVARAMWNFNLTQLRLVNPRDGWP 53


>gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62]
          Length = 723

 Score = 23.1 bits (48), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 15  AVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRK 57
             A+TT +S+    Y+V++P+   GE   R  +  V+R+ L++
Sbjct: 193 GAAVTTYLSLAGR-YSVLMPNTSKGETISRKITNPVDRKNLKE 234


>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score = 22.7 bits (47), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156
           L V +IF I+G I    Y K +  P    V A++++
Sbjct: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL 43


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.325    0.139    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,173
Number of Sequences: 1233
Number of extensions: 7375
Number of successful extensions: 53
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 41
Number of HSP's gapped (non-prelim): 20
length of query: 329
length of database: 328,796
effective HSP length: 74
effective length of query: 255
effective length of database: 237,554
effective search space: 60576270
effective search space used: 60576270
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 38 (19.2 bits)