>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62]
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV