HHsearch alignment for GI: 254780722 and conserved domain: COG2064

>COG2064 TadC Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=99.56  E-value=1.9e-12  Score=95.74  Aligned_cols=129  Identities=23%  Similarity=0.342  Sum_probs=113.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC--HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCH
Q ss_conf             169999999999999999999999995699989999999992484--289999999998630388889999977534873
Q gi|254780722|r    2 KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD--PVRSEFRRVIETQHLGLSLSESISRMVRYMPLQ   79 (187)
Q Consensus         2 ~~~~~~R~~~~~~~l~~~l~~l~~~l~aG~sl~~Al~~~a~~~~~--~l~~e~~~i~~~~~~G~~~~~al~~~~~~~~~~   79 (187)
T Consensus       161 ~~~~~~r~~~i~~~~p~~l~~~~~~~~~G~~l~~al~~va~~~~~~~~l~~~~~~~~~~~~~g~~~~~al~~~~~~~~~~  240 (320)
T COG2064         161 SLALKKRLKEIARELPDFLRLMAVCLEAGLSLADALKRVADELYGQRILAEELARTTAELSLGLSIEEALIRLAVRLGSD  240 (320)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             99998621358998899999999998828789999999987332338899999999999876997799999998744349


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHH
Q ss_conf             479999999998742574689999999999999999999-999864345677
Q gi|254780722|r   80 EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK-VQALSMEAKASA  130 (187)
Q Consensus        80 ~~~~~~~~l~~~~~~gg~~~~~L~~la~~~~~~~~~~~~-~~~~~a~~~~~~  130 (187)
T Consensus       241 ~~~~~~~~l~~~~~~g~~l~~~l~~~~~~~~~~~~l~~~~~~~~~i~~~~~~  292 (320)
T COG2064         241 EVKRVVSLLTQALESGGSLADALRVLSMELSRETRLKLGEIRAGKIGVGILL  292 (320)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998833209999999999999998899998899988879999