BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780722|ref|YP_003065135.1| pilus assembly protein
[Candidatus Liberibacter asiaticus str. psy62]
         (187 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040399|gb|ACT57195.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 187

 Score =  380 bits (975), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/187 (100%), Positives = 187/187 (100%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH
Sbjct: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ
Sbjct: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR
Sbjct: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180

Query: 181 LMINFDV 187
           LMINFDV
Sbjct: 181 LMINFDV 187


>gi|315121887|ref|YP_004062376.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495289|gb|ADR51888.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 328

 Score =  306 bits (783), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 173/186 (93%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++LIKKRTAKFL++FPNALDIIVRSVR+GLPVSDA+++IVGQSSDPVRSEFRRV+E QH
Sbjct: 142 LQYLIKKRTAKFLNEFPNALDIIVRSVRSGLPVSDAISIIVGQSSDPVRSEFRRVVEAQH 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+SES++RMVRYMPLQEVSFFSTVIS+Q+Q GGNLSEAL+NLS ILR+RK MK KVQ
Sbjct: 202 LGLSVSESVARMVRYMPLQEVSFFSTVISIQAQSGGNLSEALSNLSGILRERKKMKGKVQ 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+MEAK+SAWIIGSLPF VS+LV+FTSPGY+++L  D RGH++LG+AA  M++G ++MR
Sbjct: 262 ALAMEAKSSAWIIGSLPFFVSSLVHFTSPGYIDILFLDSRGHIILGIAAFLMVLGAVIMR 321

Query: 181 LMINFD 186
            MINFD
Sbjct: 322 TMINFD 327


>gi|86355868|ref|YP_467760.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279970|gb|ABC89033.1| probable pilus assembly protein [Rhizobium etli CFN 42]
          Length = 335

 Score =  254 bits (648), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 154/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++FPNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q +GL
Sbjct: 152 LIKRRQNKFLNEFPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFRRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH ++G +A +M IGI+VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYLTSPNYMIVLFTDPRGHFIMGASAVWMSIGILVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|209551763|ref|YP_002283680.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537519|gb|ACI57454.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 335

 Score =  252 bits (644), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 114/184 (61%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q +GL
Sbjct: 152 LIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFRRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEVSFF+ VI++QSQ GGNLSEA+ NLS+++R+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTAHMPLQEVSFFAIVIAIQSQAGGNLSEAIGNLSKVIRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYLTSPSYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|241207161|ref|YP_002978257.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861051|gb|ACS58718.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 335

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 114/184 (61%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEF RVIE Q +GL
Sbjct: 152 LIKRRQTKFLNELPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKVQALS
Sbjct: 212 SIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVQALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|116249985|ref|YP_765823.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254633|emb|CAK05707.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 114/184 (61%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++FPNALD+I RS+++GLP++DA+ +I  + ++PV+SEF RVIE Q +GL
Sbjct: 152 LIKRRQTKFLNEFPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|190889885|ref|YP_001976427.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|190695164|gb|ACE89249.1| probable pilus assembly protein [Rhizobium etli CIAT 652]
 gi|327194690|gb|EGE61536.1| putative pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 335

 Score =  251 bits (640), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 154/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q +GL
Sbjct: 152 LIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G++A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISAVWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|218516696|ref|ZP_03513536.1| probable pilus assembly protein [Rhizobium etli 8C-3]
          Length = 335

 Score =  250 bits (639), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 154/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q +GL
Sbjct: 152 LIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRVIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G++A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISAVWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|218461009|ref|ZP_03501100.1| probable pilus assembly protein [Rhizobium etli Kim 5]
 gi|218662450|ref|ZP_03518380.1| probable pilus assembly protein [Rhizobium etli IE4771]
          Length = 335

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRR+IE Q +GL
Sbjct: 152 LIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRIIEAQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV ALS
Sbjct: 212 SIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR M+
Sbjct: 272 MEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|150398545|ref|YP_001329012.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150030060|gb|ABR62177.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 336

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 111/183 (60%), Positives = 152/183 (83%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IK+R  KFLD+FPNALD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q +GL+
Sbjct: 154 IKRRCRKFLDEFPNALDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQVGLN 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV ALSM
Sbjct: 214 VPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVNALSM 273

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           EAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G +A +M IGI +MR MIN
Sbjct: 274 EAKASACIIGALPFIVATLVYLTSPAYMAILFTDPRGHLIMGASAVWMSIGIWMMRNMIN 333

Query: 185 FDV 187
           FD+
Sbjct: 334 FDI 336


>gi|227823975|ref|YP_002827948.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|227342977|gb|ACP27195.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 336

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 154/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++K+R  KFLD+FPNALD++VRS+++GLP++DA+ +I     +PV++EFRRV+E+Q +GL
Sbjct: 153 MVKRRCKKFLDEFPNALDVMVRSIKSGLPLNDALRLIASDGQEPVKTEFRRVVESQQVGL 212

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ ++ +RM++ +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+RK MKAKV ALS
Sbjct: 213 NVPDACARMIQSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERKKMKAKVGALS 272

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR MI
Sbjct: 273 MEAKASACIIGALPFIVATLVYLTSPEYMMVLFTDPRGHLIMGASAVWMSIGIFVMRNMI 332

Query: 184 NFDV 187
           NFD+
Sbjct: 333 NFDI 336


>gi|15963898|ref|NP_384251.1| hypothetical protein SMc02821 [Sinorhizobium meliloti 1021]
 gi|307315795|ref|ZP_07595309.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|15073073|emb|CAC41532.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898563|gb|EFN29236.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 336

 Score =  248 bits (632), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++K+R  KFLD+FPN+LD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q +GL
Sbjct: 153 MVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQVGL 212

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV ALS
Sbjct: 213 NVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVSALS 272

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR MI
Sbjct: 273 MEAKASACIIGALPFIVATLVYLTSPDYMMVLFTDPRGHIIMGASAVWMSIGIWVMRNMI 332

Query: 184 NFDV 187
           NFD+
Sbjct: 333 NFDI 336


>gi|307320430|ref|ZP_07599847.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306893996|gb|EFN24765.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 336

 Score =  247 bits (630), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++K+R  KFLD+FPN+LD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q +GL
Sbjct: 153 MVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQVGL 212

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV ALS
Sbjct: 213 NVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVGALS 272

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR MI
Sbjct: 273 MEAKASACIIGALPFIVATLVYLTSPDYMMVLFTDPRGHIIMGASAVWMSIGIWVMRNMI 332

Query: 184 NFDV 187
           NFD+
Sbjct: 333 NFDI 336


>gi|222084473|ref|YP_002543002.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721921|gb|ACM25077.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 335

 Score =  247 bits (630), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 153/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIK+R  KFL++FPNALD+I RS+R+GLP++DAV ++  ++ +PVR+EFRRV+ETQ +GL
Sbjct: 152 LIKRRQNKFLEEFPNALDLITRSIRSGLPLNDAVRLVASEAREPVRTEFRRVVETQQVGL 211

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S++++ +RM  +MPLQEV+FFS VI++Q+Q GGNLSEAL NL+++LR+RK MKAKV ALS
Sbjct: 212 SMTDACARMNNHMPLQEVNFFSIVIAIQAQAGGNLSEALGNLAKVLRERKKMKAKVVALS 271

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V  LVY TSP YM +L  DPRGH+++ +A  +M  G+++MR M+
Sbjct: 272 MEAKASAVIIGALPFIVMLLVYLTSPQYMMILFTDPRGHLIMLLAGIWMAFGVIIMRQMV 331

Query: 184 NFDV 187
           NFD+
Sbjct: 332 NFDI 335


>gi|222147178|ref|YP_002548135.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734168|gb|ACM35131.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 334

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 151/184 (82%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI++R  KFL +FPNALD++VRS+++GLP++DA+ +I   + +PV++EFRRV++ Q LG+
Sbjct: 151 LIRRRQEKFLTEFPNALDVMVRSIKSGLPLNDALRMIAVDAQEPVKTEFRRVVDAQQLGI 210

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ E+  RM   MPLQEVSFF+ VI++QSQ GGNLSEAL+NLS++LR+R+ MKAKV ALS
Sbjct: 211 TVPEACGRMFNSMPLQEVSFFAIVIAIQSQAGGNLSEALSNLSKVLRERRKMKAKVSALS 270

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+ LVY +SP Y+ VL  DPRGHM+LG +A +M IGI VMR MI
Sbjct: 271 MEAKASAVIIGALPFIVAFLVYISSPAYIMVLFTDPRGHMILGFSAFWMSIGIFVMRNMI 330

Query: 184 NFDV 187
           NFD+
Sbjct: 331 NFDI 334


>gi|15887569|ref|NP_353250.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155106|gb|AAK86035.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 334

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 150/184 (81%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L+K+R  KFL++FPNALD++ RS+++GLP++DAV +I     +PV++EF+RV++ Q +G+
Sbjct: 151 LLKRRQKKFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGI 210

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            + + I RM+  MPL EVSFFS VI++Q+Q GGNLSEAL+NLSR+LRDR+ M+AKV ALS
Sbjct: 211 GIPQGIERMMLTMPLFEVSFFSIVINIQAQAGGNLSEALSNLSRVLRDRRKMRAKVNALS 270

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V  LV+FTSP Y+++L  D RGH++LG +A +MLIGI +MR MI
Sbjct: 271 MEAKASAVIIGALPFIVMLLVHFTSPDYLSILFTDTRGHLILGASAIWMLIGIFIMRQMI 330

Query: 184 NFDV 187
           NFD+
Sbjct: 331 NFDI 334


>gi|325291655|ref|YP_004277519.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059508|gb|ADY63199.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 334

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 151/184 (82%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++K+R  KFL++FPNALD++ RS+++GLP++DAV +I     +PV++EF+RV++ Q +G+
Sbjct: 151 ILKRRQKKFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGI 210

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            + + I RM+  +PL EVSFFSTVI++Q+Q GGNLSEAL+NLS++LR+R+ M+AKV ALS
Sbjct: 211 GIPQGIERMMLTVPLFEVSFFSTVINIQAQAGGNLSEALSNLSKVLRERRKMRAKVNALS 270

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V  LV+FTSP Y++VL  D RGH++LGV+  +MLIGI +MR MI
Sbjct: 271 MEAKASAVIIGALPFIVMLLVHFTSPDYLSVLFTDMRGHIILGVSGLWMLIGIFIMRQMI 330

Query: 184 NFDV 187
           NFD+
Sbjct: 331 NFDI 334


>gi|239833233|ref|ZP_04681562.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825500|gb|EEQ97068.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
          Length = 336

 Score =  233 bits (595), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (76%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H  K+R  KFL++FPNALD+IVR+ RAGLP++D + +I  ++ +PV+SEF++V+E Q +G
Sbjct: 152 HRRKQRLKKFLEEFPNALDVIVRATRAGLPLNDGLRLIASEAVEPVKSEFKKVVEAQQIG 211

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LS+ E++ +M   MP  E +FF+ VI +Q+Q GGNLSEAL NLS++LRDRK MKAKV AL
Sbjct: 212 LSIPEAVGKMPDSMPCPETNFFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVNAL 271

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           SMEAKASA IIG+LPF V  LVY TSP YM +L     GHMLLGVAA  ML GI +M+ M
Sbjct: 272 SMEAKASAAIIGALPFIVMVLVYLTSPLYMTLLFTSSTGHMLLGVAAVLMLTGIFIMKNM 331

Query: 183 INFDV 187
           INFD+
Sbjct: 332 INFDM 336


>gi|163757631|ref|ZP_02164720.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
 gi|162285133|gb|EDQ35415.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
          Length = 336

 Score =  233 bits (594), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 105/185 (56%), Positives = 148/185 (80%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L  +R   FL +FPNALDI+VRS+++GLP++DA+ +I  +  +PVR+EF+R++++Q +G
Sbjct: 152 YLRNRRLKAFLSEFPNALDIMVRSIKSGLPLNDAIRMISAEGQEPVRTEFKRIVDSQQMG 211

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +++ E+ +R+   +PL E +FFS VI++Q+Q GGNLSEAL NLSR+LRDRK MKAK+ AL
Sbjct: 212 MNIPEACARLYSRIPLSEANFFSIVIAIQAQAGGNLSEALGNLSRVLRDRKKMKAKINAL 271

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           SMEAKASA IIG+LPF V+ LVY TSP Y+ +L  D RGH++LG +A +M IGI+VMR M
Sbjct: 272 SMEAKASAAIIGALPFIVALLVYLTSPDYIMILFTDTRGHLILGASAIWMSIGILVMRNM 331

Query: 183 INFDV 187
           INFD+
Sbjct: 332 INFDI 336


>gi|153008063|ref|YP_001369278.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559951|gb|ABS13449.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
          Length = 337

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KFL++FPNALD+IVR+ RAGLP++D + +I  ++ +PV+SEF++V+E Q +GLS+
Sbjct: 156 KRRLKKFLEEFPNALDVIVRATRAGLPLNDGLRLIASEAVEPVKSEFKKVVEAQQIGLSI 215

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++ +M   MP  E +FF+ VI +Q+Q GGNLSEAL NLS++LRDRK MKAKV ALSME
Sbjct: 216 PEAVGKMPDSMPCPETNFFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVDALSME 275

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AKASA IIG+LPF V  LVY TSP YM +L     GHMLLG+AA  ML GI +M+ MINF
Sbjct: 276 AKASAAIIGALPFIVMVLVYLTSPQYMTLLFTSSTGHMLLGIAAVLMLTGIFIMKNMINF 335

Query: 186 DV 187
           D+
Sbjct: 336 DM 337


>gi|13474664|ref|NP_106233.1| hypothetical protein mlr5603 [Mesorhizobium loti MAFF303099]
 gi|14025419|dbj|BAB52019.1| mlr5603 [Mesorhizobium loti MAFF303099]
          Length = 337

 Score =  228 bits (582), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/181 (59%), Positives = 143/181 (79%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   FL++FPNALDIIVR+V++GLP++DAV +I  +S +PV++EFRR++++Q +G+S+ 
Sbjct: 157 RRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANESPEPVKAEFRRIVDSQQMGISIP 216

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKVQALSMEA
Sbjct: 217 DATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQALSMEA 276

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           KASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG AA +M IGI+VMR M+NF+
Sbjct: 277 KASAAIIGALPFIVAFLVYLSSPDYLMPLFNTSVGNLILGCAAVWMSIGILVMRKMMNFE 336

Query: 187 V 187
           V
Sbjct: 337 V 337


>gi|110636325|ref|YP_676533.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287309|gb|ABG65368.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 337

 Score =  228 bits (580), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 107/185 (57%), Positives = 146/185 (78%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L ++R   FL++FPNALDIIVR+V++GLP++DAV +I  ++ +PVR+EFRR++E Q LG
Sbjct: 153 YLRRRRVQAFLNEFPNALDIIVRAVKSGLPLNDAVRMIAVEAQEPVRTEFRRLVEAQQLG 212

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           L ++E+  RM   MP  EV+FF  V+ +QSQ GGNLSEAL NLSR+LR+RK +KA+VQAL
Sbjct: 213 LPMAEAAMRMSETMPCPEVNFFGIVLQIQSQAGGNLSEALGNLSRVLRERKKIKARVQAL 272

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           SMEAKASA IIG+LP  V+ LVY TSP Y+  L ++  GH++LG++A +M IGI VMR M
Sbjct: 273 SMEAKASAVIIGALPIVVAALVYITSPAYIMPLFSESVGHLILGLSAVWMSIGIFVMRQM 332

Query: 183 INFDV 187
           +NF+V
Sbjct: 333 MNFEV 337


>gi|260461945|ref|ZP_05810190.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032192|gb|EEW33458.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 337

 Score =  227 bits (579), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 143/181 (79%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   FL++FPNALDIIVR+V++GLP++DAV +I  ++ +PV++EFRR++++Q +GLS+ 
Sbjct: 157 RRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANEAPEPVKTEFRRIVDSQQMGLSIP 216

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKVQALSMEA
Sbjct: 217 DATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQALSMEA 276

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           KASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG +A +M IGI+VMR M+NF+
Sbjct: 277 KASAAIIGALPFIVAFLVYLSSPSYLMPLFNTSVGNLILGCSAVWMSIGILVMRKMMNFE 336

Query: 187 V 187
           V
Sbjct: 337 V 337


>gi|319785604|ref|YP_004145080.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171492|gb|ADV15030.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 337

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 142/181 (78%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   FL++FPNALDIIVR+V++GLP++DAV +I  +S +PV++EFRR++++Q +GLS+ 
Sbjct: 157 RRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANESPEPVKTEFRRIVDSQQMGLSIP 216

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKV ALSMEA
Sbjct: 217 DATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVAALSMEA 276

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           KASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG +A +M IGI+VMR M+NF+
Sbjct: 277 KASAAIIGALPFIVAFLVYLSSPAYLMPLFNTSVGNLILGCSAVWMSIGILVMRKMMNFE 336

Query: 187 V 187
           V
Sbjct: 337 V 337


>gi|114705451|ref|ZP_01438359.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540236|gb|EAU43356.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 335

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 98/182 (53%), Positives = 144/182 (79%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR   F + FP A+D+IVR V+AGLP++D +  +V    DPV SEF++V+E Q +G++L
Sbjct: 154 KKRINDFSNSFPTAIDLIVRGVKAGLPLNDTLRTVVSDVPDPVSSEFQKVVEAQQMGVTL 213

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++  R+ + +PL E +FF+ VI++QSQ GGNLSEAL NLSR+LR+RK M+ K+QA+SME
Sbjct: 214 GDACDRLYKQVPLPETNFFAIVIAIQSQAGGNLSEALGNLSRVLRERKKMRQKIQAVSME 273

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AKASA IIGS+P  V++++Y TSP Y+NVL++DPRG+++L  +A +MLIG+++M+ MINF
Sbjct: 274 AKASASIIGSIPVLVASMIYMTSPDYLNVLLHDPRGNIVLIASAVWMLIGVLIMKKMINF 333

Query: 186 DV 187
           D+
Sbjct: 334 DI 335


>gi|90419768|ref|ZP_01227677.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
 gi|90335809|gb|EAS49557.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
          Length = 335

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 141/181 (77%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR  KF ++FPNA+D+IVR V++GLP++D + ++ G++ DPVRSEFR++IE+Q +G+ +
Sbjct: 154 KKRFHKFGEEFPNAIDLIVRGVKSGLPLNDTLRIVSGETLDPVRSEFRKIIESQQMGVPI 213

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           SE++ ++ R +P  E +FF+ VI++QSQ GGNLSEAL NLS +LRDRK M+AKVQA+SME
Sbjct: 214 SEAVEKLYRNIPTPEANFFAIVIAIQSQAGGNLSEALGNLSNVLRDRKKMRAKVQAMSME 273

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AKAS  IIG+LP  V+ LVY T+P Y++VL     GH++L V+  +M  G+ VM+ MI+F
Sbjct: 274 AKASGGIIGALPVVVAGLVYITTPDYISVLFTTGTGHLILAVSGLWMATGVFVMKKMISF 333

Query: 186 D 186
           D
Sbjct: 334 D 334


>gi|209886534|ref|YP_002290391.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874730|gb|ACI94526.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score =  218 bits (555), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 102/186 (54%), Positives = 139/186 (74%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KFLD  P+A+D+IVR V+AGLP+ D++ V+V  S +P+RSEFR +IETQ 
Sbjct: 139 LNFLKKRREKKFLDALPDAVDVIVRGVKAGLPLFDSLKVVVNDSPEPLRSEFRAIIETQS 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  V+ +Q + GGNLSEAL NLS++LRDRK MKAK+Q
Sbjct: 199 IGMPLGEACMRLYERMPLPEANFFGIVVGIQMKSGGNLSEALGNLSKVLRDRKKMKAKIQ 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  +VYF SP Y+++L  +P G ++L V+ A+M  G+M+M+
Sbjct: 259 AMSMEAKASAGIIGSLPPAVMMIVYFMSPDYISLLWTEPAGRVMLAVSGAWMFAGVMIMK 318

Query: 181 LMINFD 186
            MINFD
Sbjct: 319 KMINFD 324


>gi|323137429|ref|ZP_08072507.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
 gi|322397416|gb|EFX99939.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
          Length = 326

 Score =  214 bits (546), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 135/187 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R +KF+++FP ++D+I+R V+AGLPV+D   VI  +  +PVR EFRR+IE+Q 
Sbjct: 140 LSFLRKRRISKFIEEFPGSIDVIIRGVKAGLPVADCFRVIASEGQEPVRGEFRRIIESQA 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ E++ R    +P+ E SFFS VI++Q + GGNLSEAL NLSR+LRDRK MK KV+
Sbjct: 200 IGLSVGEAVERFAERVPVPEASFFSIVINIQQKSGGNLSEALGNLSRVLRDRKKMKGKVK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLPF V   VY T+P YM VL     G +++     +M IG+ +MR
Sbjct: 260 AMSSEAKASAGIIGSLPFLVGGAVYLTTPSYMMVLFTTNIGKIIIACGLLWMAIGVFIMR 319

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 320 KMINFDI 326


>gi|299132290|ref|ZP_07025485.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
 gi|298592427|gb|EFI52627.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
          Length = 323

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 136/186 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  +FL+  P+A+D+IVR V+AGLP+ D++ V+V  S +P+RSEFR +IETQ 
Sbjct: 137 LSYLKRRREKQFLEALPDAVDVIVRGVKAGLPLFDSLKVVVNDSPEPLRSEFRAIIETQS 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  VI +Q++ GGNLSEAL NLS++LRDRK M+AK+Q
Sbjct: 197 IGMPLGEACMRLYERMPLPEANFFGIVIGIQTKSGGNLSEALGNLSKVLRDRKKMRAKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LP  V  +VY  SP Y+++L   P G  +L   A +M  GI+VM+
Sbjct: 257 AMSMEAKASAAIIGALPPVVMIIVYIMSPDYISLLWTHPTGRFMLACCAVWMTAGILVMK 316

Query: 181 LMINFD 186
            MINFD
Sbjct: 317 KMINFD 322


>gi|39936744|ref|NP_949020.1| type II secretion system protein [Rhodopseudomonas palustris
           CGA009]
 gi|39650600|emb|CAE29123.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 324

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 96/186 (51%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  KFL   P+A+DIIVR ++AGLP+ D++ ++   S +P+RSEF  +IETQ 
Sbjct: 138 LGYLKRRREKKFLAALPDAVDIIVRGIKAGLPLFDSIKMVAADSPEPLRSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+ +R+   MP+ E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPIGEACARLYERMPIPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPIIVMMLVYVTTPDYISLLWTHPTGRILLAASALWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|27376546|ref|NP_768075.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349687|dbj|BAC46700.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 340

 Score =  204 bits (518), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 98/186 (52%), Positives = 135/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R +KFL   P+A+D+IVR ++AGLP+ +++ V+   S +P+RSEF  +IETQ 
Sbjct: 154 LSFLKKRRESKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADSPEPLRSEFLAIIETQA 213

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ SR+   MPL E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M+ K+Q
Sbjct: 214 IGMPLGEACSRLYDRMPLPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMREKIQ 273

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G ++L     +M +GIMVM+
Sbjct: 274 AMSMEAKASAAIIGSLPPIVMFLVYLTTPHYISLLWTHPTGQLMLVGCVVWMSVGIMVMK 333

Query: 181 LMINFD 186
            MINFD
Sbjct: 334 KMINFD 339


>gi|154250693|ref|YP_001411517.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154643|gb|ABS61860.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 328

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 91/186 (48%), Positives = 140/186 (75%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +LIK+R   F ++F NA+D+IVR V++GLPV+D + +I  +S +PVR+EF+ ++E Q 
Sbjct: 142 LSYLIKRRQKAFTEEFANAIDVIVRGVKSGLPVNDCLKLIATESPEPVRTEFQGIVEGQR 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++L + ++++   MPL EV+FF  V+++Q + GGNLSEAL NLS++LR+RK M+ K+Q
Sbjct: 202 VGVTLEQGLAKIYERMPLPEVNFFQIVLAIQQKTGGNLSEALGNLSKVLRERKKMRGKIQ 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLP  V  L+YF+SPGYM+VL +   G+M++     +M IG++VM+
Sbjct: 262 AMSQEAKASAGIIGSLPPGVMLLIYFSSPGYMDVLFSTTAGNMIIVGGIMWMAIGVLVMK 321

Query: 181 LMINFD 186
            MI+F 
Sbjct: 322 KMIDFK 327


>gi|192292570|ref|YP_001993175.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
 gi|192286319|gb|ACF02700.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
          Length = 324

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  +FL   P+A+DIIVR ++AGLP+ D++ ++   S +P+RSEF  +IETQ 
Sbjct: 138 LGYLKRRREKRFLAALPDAVDIIVRGIKAGLPLFDSIKMVAADSPEPLRSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+ +R+   MP+ E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPIGEACARLYERMPIPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPIIVMMLVYVTTPDYISLLWTHPTGRILLAASALWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|296444391|ref|ZP_06886356.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
 gi|296258038|gb|EFH05100.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
          Length = 322

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/187 (49%), Positives = 138/187 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R AKF++ FP ++DII+R ++AGLPV D   +I  ++ +PVRSEFR+++E+Q 
Sbjct: 136 LGFLARRRVAKFIEAFPGSVDIIIRGIKAGLPVGDCFRMIASEADEPVRSEFRQIVESQT 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ E+  R    MP+ E SFFS VIS+Q + GGNLSEAL+NL+ +LR+RK MKAKV+
Sbjct: 196 IGLSIGEATERFAERMPVAEASFFSIVISLQEKSGGNLSEALSNLAGVLRERKKMKAKVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLPF V   V+FT+  YM VL +   G+M++  +  +M +G+ +M+
Sbjct: 256 AMSAEAKASAGIIGSLPFLVGLAVWFTNKPYMAVLFDTTVGNMIIAGSLLWMAVGVFIMK 315

Query: 181 LMINFDV 187
            MI+F++
Sbjct: 316 NMIDFEI 322


>gi|316933035|ref|YP_004108017.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
 gi|315600749|gb|ADU43284.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
          Length = 324

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 134/183 (73%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  KFL   P+A+D+IVR ++AGLP+ D++ V+   + +P+RSEF  +IETQ +G+
Sbjct: 141 LKRRREKKFLAALPDAVDVIVRGIKAGLPLFDSIKVVAADAPEPLRSEFNAIIETQAIGM 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L+++ +R+   MPL E +FF  VI++Q + GGNLSEAL+NLS++LRDRK M  K+QA+S
Sbjct: 201 PLADACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALSNLSKVLRDRKKMAEKIQAMS 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+ MI
Sbjct: 261 MEAKASATIIGALPLIVMLLVYLTTPDYISLLWTHPTGRLLLAGSALWMSAGIFVMKKMI 320

Query: 184 NFD 186
           NFD
Sbjct: 321 NFD 323


>gi|240139030|ref|YP_002963505.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
 gi|240009002|gb|ACS40228.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
          Length = 323

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|163851907|ref|YP_001639950.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|163663512|gb|ABY30879.1| type II secretion system protein [Methylobacterium extorquens PA1]
          Length = 323

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|218530658|ref|YP_002421474.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|218522961|gb|ACK83546.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
          Length = 323

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|86748903|ref|YP_485399.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
 gi|86571931|gb|ABD06488.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
          Length = 324

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KF++  P+A+D+IVR ++AGLP+ D++ V+   S +P++SEF  +IETQ 
Sbjct: 138 LGFLKKRREKKFINALPDAVDVIVRGIKAGLPLFDSLKVVAADSPEPLKSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYDRMPLPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L     +M  GI+VM+
Sbjct: 258 AMSMEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGCVVWMSAGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|146338119|ref|YP_001203167.1| putative pilus assembly protein membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146190925|emb|CAL74930.1| putative pilus assembly protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R  KFL   P+A+D+IVR ++AGLP+ +++ V+   + +P+RSEF  +IETQ 
Sbjct: 138 LGYLKKRREKKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADAPEPLRSEFLAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M +GI+VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLVGCVVWMSMGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|254561625|ref|YP_003068720.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
 gi|254268903|emb|CAX24864.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
          Length = 323

 Score =  197 bits (502), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   ++R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQRRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|254505024|ref|ZP_05117175.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222441095|gb|EEE47774.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 339

 Score =  196 bits (499), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 132/181 (72%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R   FL++ PN +DIIVR V+AGLP+SD V V+  ++ +PV +EFR+V ETQ +G+SL
Sbjct: 158 KRRFNAFLNELPNGIDIIVRGVKAGLPLSDCVKVVAREAREPVATEFRKVTETQVMGVSL 217

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E++S+M   +PL E +F + V+S+Q + GG L+EAL NLSR+LR RK MKAK++ALS E
Sbjct: 218 AEALSKMPDRVPLPETNFLAIVVSIQQKAGGGLAEALGNLSRVLRQRKAMKAKIKALSSE 277

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIG+LPF V  +++F +P YM +L     G +++     +M  GIMVMR MINF
Sbjct: 278 AKSSAAIIGALPFVVGGILFFIAPDYMMILFTATTGKIIVAGCLFWMFCGIMVMRSMINF 337

Query: 186 D 186
           D
Sbjct: 338 D 338


>gi|90425201|ref|YP_533571.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107215|gb|ABD89252.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
          Length = 324

 Score =  196 bits (499), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 131/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R   FL   P+A+D+IVR ++AGLP+ D++ V+   + +P++SEF  ++ETQ 
Sbjct: 138 LNFLKKRREKNFLKALPDAVDVIVRGIKAGLPLFDSLKVVAADAPEPLKSEFLAILETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M IGI VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLAGCVLWMAIGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 QMINFD 323


>gi|148258239|ref|YP_001242824.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146410412|gb|ABQ38918.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 324

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KFL   P+A+D+IVR ++AGLP+ +++ V+   + +P+RSEF  +IETQ 
Sbjct: 138 LNFLKKRREKKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADAPEPLRSEFLAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  V+++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVVAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M +GI VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLVGCVVWMSMGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|115525753|ref|YP_782664.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519700|gb|ABJ07684.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
          Length = 324

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 129/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R   FL   P+A+D+IVR ++AGLP+ D++ V+   + +P+R+EF  +++TQ 
Sbjct: 138 LSFLKKRRERNFLKALPDAVDVIVRGIKAGLPLYDSIKVVAADAPEPLRTEFLTILDTQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACGRLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+ +L   P G M+L     +M IG+ VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMFLVYLTTPDYIALLWTHPTGQMMLAGCVLWMSIGVFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|188581664|ref|YP_001925109.1| type II secretion system protein [Methylobacterium populi BJ001]
 gi|179345162|gb|ACB80574.1| type II secretion system protein [Methylobacterium populi BJ001]
          Length = 323

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 136/187 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R A F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E Q 
Sbjct: 137 LKWRQKRRVAAFVEELPNAMDVVVRGLRSGIPLGDCLRMISREAKEPLRSEFRVAMEAQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL +S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL+NLSR+LR+RK M  K+Q
Sbjct: 197 MGLPMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALSNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF +    Y +SP Y ++L     G + L ++  +ML G++VM+
Sbjct: 257 AMSMEAKASAGIIGALPFLIGGGTYLSSPDYTSLLWTTSVGKIALVISGLWMLAGVLVMK 316

Query: 181 LMINFDV 187
            MI+FDV
Sbjct: 317 KMISFDV 323


>gi|91977989|ref|YP_570648.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
 gi|91684445|gb|ABE40747.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
          Length = 324

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 131/183 (71%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L K+R  +FL+  P+A+D+IVR ++AGLP+ D++ V+   S +P+++EF  +IETQ +G+
Sbjct: 141 LKKRREKRFLNALPDAVDVIVRGIKAGLPLFDSIKVVAADSPEPLKTEFNAIIETQTIGM 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            + E+ +R+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+QA+S
Sbjct: 201 PIGEACARLYDRMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQAMS 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L     +M  GI+VM+ MI
Sbjct: 261 MEAKASAAIIGSLPPIVMLLVYMSTPDYIALLWTHPTGRLMLAGCVVWMAAGILVMKKMI 320

Query: 184 NFD 186
           NFD
Sbjct: 321 NFD 323


>gi|170750193|ref|YP_001756453.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656715|gb|ACB25770.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 325

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 130/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL  KR AKF  + PNA+D++VR +R G+PV D   ++  ++ +PVRSEFR V+ETQ 
Sbjct: 139 LRHLRLKRIAKFNKELPNAVDVVVRGIRTGIPVGDCFRMVSREAEEPVRSEFRTVVETQA 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLSL E+ +R+   +P  EV+FF+ VI++Q Q GGNLSEAL NLS +LRDR  M+ KVQ
Sbjct: 199 MGLSLGEACTRLFERVPTAEVNFFAIVINIQQQSGGNLSEALNNLSTVLRDRAKMRGKVQ 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA II  LPF V+ +   TSP Y+++L     G + L  AA +M IGI  ++
Sbjct: 259 AMSMEAKASASIIACLPFAVAGITALTSPDYISLLWTTDTGKIALVGAAIWMSIGIFTIK 318

Query: 181 LMINFD 186
            MI F+
Sbjct: 319 KMIAFE 324


>gi|328545275|ref|YP_004305384.1| Bacterial type II secretion system protein F domain [polymorphum
           gilvum SL003B-26A1]
 gi|326415017|gb|ADZ72080.1| Bacterial type II secretion system protein F domain [Polymorphum
           gilvum SL003B-26A1]
          Length = 339

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 131/181 (72%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   FL++ PNA+DIIVR V+AGLP+ D + ++  ++ DPV  EFR+++E Q +GL+L
Sbjct: 158 RKRFDAFLNELPNAVDIIVRGVKAGLPLGDCIKIVASEARDPVAGEFRKIVEAQVMGLTL 217

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E++ R+   +PL E +FF+ V+++Q Q GG LSEAL NL ++LR RK +K K++ALS E
Sbjct: 218 TEAVGRLPDRVPLAEANFFAIVVAIQQQAGGGLSEALGNLGKVLRGRKTLKGKIRALSSE 277

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIGSLPF VS ++Y  +P Y+ +L  +  G+M++     +M IG MVM+ MINF
Sbjct: 278 AKSSAAIIGSLPFIVSLILYLIAPDYIMLLFTETAGNMIIAGGLLWMFIGSMVMKNMINF 337

Query: 186 D 186
           D
Sbjct: 338 D 338


>gi|75674495|ref|YP_316916.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
 gi|74419365|gb|ABA03564.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
          Length = 324

 Score =  194 bits (493), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 131/183 (71%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L K+R   FL   P+A+D+IVR ++AGLP+ +++ V+   S +P++SEF  +IETQ +G+
Sbjct: 141 LKKRRETAFLRALPDAVDVIVRGIKAGLPLFESLKVVAADSPEPLKSEFAAIIETQAIGM 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E+ SR+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K++A+S
Sbjct: 201 PLGEACSRLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIKAVS 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L  +A +M  GI+VM+ MI
Sbjct: 261 MEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGSALWMTAGILVMKKMI 320

Query: 184 NFD 186
           NFD
Sbjct: 321 NFD 323


>gi|220923699|ref|YP_002499001.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948306|gb|ACL58698.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 327

 Score =  194 bits (492), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 126/172 (73%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
           +FPNA+D+IVR V+AGLP+ D + ++  ++ +PV+SEFR ++E Q LG+ L +++ R+  
Sbjct: 155 EFPNAIDVIVRGVKAGLPLVDCLNIVAAEAQEPVKSEFRALVEDQTLGMPLQDAVERLPE 214

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            MPL E  FF+ VI++QS+ GG+LSEAL NLSR+LR+RK M+ K++A+S EAKASA II 
Sbjct: 215 RMPLSEARFFAIVIAIQSRTGGSLSEALGNLSRVLRERKKMQGKIKAVSSEAKASAGIIA 274

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +LP  V +LVY TSP YM +L   P G  +L     +ML+G ++MR MINFD
Sbjct: 275 ALPIVVGSLVYLTSPAYMALLFTTPIGKAVLAGCVVWMLLGTLMMRKMINFD 326


>gi|110632960|ref|YP_673168.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283944|gb|ABG62003.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 338

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 135/181 (74%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +F ++F NA+D+IVR +++GLPV D + +I  ++ +PV+SEF  +++ Q LG+SL
Sbjct: 157 KRRFKQFTNEFSNAVDVIVRGLKSGLPVGDCLRIIAAEAQEPVKSEFVAIVQDQTLGISL 216

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++ R+   +PL E +FF+ V+ +QS+ GG+L+EAL NLS++LR+RK M AK++A+S E
Sbjct: 217 DEAVQRLWERVPLAEANFFAIVVGLQSRTGGSLAEALGNLSKVLRERKKMSAKIRAMSSE 276

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIG+LPF VS  +Y TSP YM++L +   G ++L   A +M +GI+VMR MINF
Sbjct: 277 AKSSAGIIGALPFFVSAAIYLTSPDYMSLLFSTLTGKLVLAGCALWMGMGILVMRKMINF 336

Query: 186 D 186
           D
Sbjct: 337 D 337


>gi|46204164|ref|ZP_00050408.2| COG4965: Flp pilus assembly protein TadB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 188

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R A F+++ PNA+D+IVR +R+G+P+ D + +I  ++ +P+RSEFR  +E Q 
Sbjct: 2   LSRLQKRRVAAFVEELPNAMDVIVRGLRSGIPLGDCLRMISREAKEPLRSEFRIAMEAQA 61

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL++ ++I RM   +P+ EV+FF+ VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 62  LGLAMPDAILRMCERVPVTEVNFFAVVIGIQQKSGGNLSEALGNLSRVLRERKKMAGKIQ 121

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V+   Y +SP Y  +L     G + L ++  +M +GI VM+
Sbjct: 122 AMSMEAKASAVIIGALPFFVALATYLSSPDYTALLWTTAVGKIALVLSGLWMALGIFVMK 181

Query: 181 LMINFDV 187
            MI+FDV
Sbjct: 182 KMISFDV 188


>gi|85713509|ref|ZP_01044499.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699413|gb|EAQ37280.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 324

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 131/183 (71%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R   FL   P+A+D+IVR ++AGLP+ +++ V+V  S +P++SEF  +IETQ +G+
Sbjct: 141 LKQRRETAFLRALPDAVDVIVRGIKAGLPLFESLKVVVADSPEPLKSEFAAIIETQAVGM 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E+ SR+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K++A+S
Sbjct: 201 PLGEACSRLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIKAVS 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L  +A +M  GI+VMR MI
Sbjct: 261 TEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGSALWMSAGILVMRKMI 320

Query: 184 NFD 186
           NFD
Sbjct: 321 NFD 323


>gi|118589707|ref|ZP_01547112.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
 gi|118437793|gb|EAV44429.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
          Length = 340

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 131/181 (72%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R   FL++ PN +DIIVR V+AGLP+SD + V+  ++ DPV +EFR++ ETQ +G+SL
Sbjct: 159 KRRFNAFLEELPNGVDIIVRGVKAGLPLSDCIKVVAREARDPVATEFRKITETQIMGISL 218

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++ ++   +PL E +FF+ V+++Q + GG L+EAL NLS++LR RK MK K++ALS E
Sbjct: 219 ADAVGKLPERVPLPEANFFAIVVAIQQKAGGGLAEALNNLSKVLRGRKAMKRKIKALSAE 278

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIGSLPF V  ++Y  SP Y+ VL     G++++     +M  GIMVMR MINF
Sbjct: 279 AKSSAGIIGSLPFFVGGIMYLISPKYIMVLFETTAGNIIIAGGLFWMFCGIMVMRAMINF 338

Query: 186 D 186
           D
Sbjct: 339 D 339


>gi|307943149|ref|ZP_07658494.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773945|gb|EFO33161.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 340

 Score =  191 bits (486), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 131/181 (72%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR   F+++ PN +DIIVR V+AGLP+ D V V+  ++ DPV +EF +++ETQ +G+SL
Sbjct: 159 KKRFTAFMEELPNGVDIIVRGVKAGLPLGDCVRVVSTEAKDPVSTEFAKILETQKMGVSL 218

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E+  ++   +PL E +FF+ V+++Q   GG LSEAL NLSR+LR RK +K K+ ALS E
Sbjct: 219 AEAFMKLPERVPLPEANFFAIVVAIQQSSGGGLSEALNNLSRVLRGRKALKRKIVALSSE 278

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIG++P  +S  ++F +P Y+N+L+    GH+++     +MLIGI+VMR MINF
Sbjct: 279 AKSSAGIIGAMPVLISLALFFIAPDYINILLTTTAGHIVIAGCITWMLIGILVMRQMINF 338

Query: 186 D 186
           D
Sbjct: 339 D 339


>gi|92116009|ref|YP_575738.1| type II secretion system protein [Nitrobacter hamburgensis X14]
 gi|91798903|gb|ABE61278.1| type II secretion system protein [Nitrobacter hamburgensis X14]
          Length = 324

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 91/186 (48%), Positives = 128/186 (68%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   FL   P+A+D+IVR ++AGLP+ +++ V+   S +P++SEF  +IETQ 
Sbjct: 138 LGFLKTRREKAFLRALPDAVDVIVRGIKAGLPLFESIKVVAADSPEPLKSEFAAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+ +L   P G ++L     +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPPVVMMLVYLTTPDYIAMLWTHPTGRLMLAGCVLWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|83859361|ref|ZP_00952882.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852808|gb|EAP90661.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 331

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R  KF ++F +ALDIIVR V++GLP+++ + +I  +   PV+ EF+ ++E   +G+ +
Sbjct: 150 KGRQKKFTENFADALDIIVRGVKSGLPLNETLKIIAQEGEAPVKQEFQLLVEGLAVGVDV 209

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E + RM R MPL E+SFF+TV+++Q + GGNL+EAL NLS +LR RK M+ KV ALS E
Sbjct: 210 EEGMRRMHRRMPLPELSFFTTVLAIQQKTGGNLAEALNNLSAVLRARKMMREKVSALSSE 269

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AKASAWIIGSLP  V  +V   SP YM  L+  P GH LL     +ML GI+VMR MINF
Sbjct: 270 AKASAWIIGSLPPGVGVMVSIMSPDYMTPLLTTPMGHFLLLGGGVWMLTGILVMRSMINF 329

Query: 186 DV 187
            +
Sbjct: 330 KM 331


>gi|254473793|ref|ZP_05087188.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957179|gb|EEA92384.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 339

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 134/182 (73%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR  +FL++FPNA+DIIVR +++G+P+ D + +   ++ DPV +EF  V++   +G+ L
Sbjct: 158 KKRFNRFLEEFPNAVDIIVRGIKSGMPLGDCMHIAASEAKDPVGTEFSLVLDKMQMGMPL 217

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E+I  + + +PLQE +F + V+++Q+Q GG+LSEAL NLS+ LR RK MK K++A+S E
Sbjct: 218 AEAIQSLPKRVPLQETNFLAIVVTIQAQAGGSLSEALGNLSKTLRQRKEMKGKIRAVSQE 277

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK+SA IIGSLPF V+ L++  SP Y+ +L++   G +L+G+   +M IGI+VMR MI+F
Sbjct: 278 AKSSAAIIGSLPFIVTALLFVLSPDYIKLLVDTDIGLVLIGIGLFWMSIGILVMRKMIDF 337

Query: 186 DV 187
            +
Sbjct: 338 KI 339


>gi|16263304|ref|NP_436097.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304377|ref|ZP_07584128.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|14523983|gb|AAK65509.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306902579|gb|EFN33173.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 333

 Score =  187 bits (474), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 129/179 (72%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +F  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q LG+ + E
Sbjct: 154 RFTRFAAEFPNAVDVIVRGLKAGLPMPDCLRVIAMEAQEPVKGEFLAIVQDQTLGIPVDE 213

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ RM   MPL E +FF+ V+++QS+ GG+LSEAL NLS++LR+RK MK K++A+S EAK
Sbjct: 214 AVKRMSERMPLAEANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIKAMSSEAK 273

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +SA IIG+LPF V+  VYF SP YM +L     G +++     +M IGI+VMR MINFD
Sbjct: 274 SSAGIIGALPFLVAGAVYFMSPDYMALLFTTMIGKVVVVGCGLWMGIGILVMRKMINFD 332


>gi|307318084|ref|ZP_07597520.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306896125|gb|EFN26875.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 333

 Score =  187 bits (474), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 129/179 (72%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +F  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q LG+ + E
Sbjct: 154 RFTRFAAEFPNAVDVIVRGLKAGLPMPDCLRVIAMEAQEPVKGEFLAIVQDQTLGIPVDE 213

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ RM   MPL E +FF+ V+++QS+ GG+LSEAL NLS++LR+RK MK K++A+S EAK
Sbjct: 214 AVKRMSERMPLAEANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIKAMSSEAK 273

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +SA IIG+LPF V+  VYF SP YM +L     G +++     +M IGI+VMR MINFD
Sbjct: 274 SSAGIIGALPFLVAGAVYFMSPDYMALLFTTMIGKVVVVGCGLWMGIGILVMRKMINFD 332


>gi|304392380|ref|ZP_07374321.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295484|gb|EFL89843.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 332

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 123/180 (68%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A F   FPNA+D+IVR +++GLP++D + +I   S +PVR EFR++IE   +G+ +
Sbjct: 151 KKRFAAFTKTFPNAIDVIVRGIKSGLPLNDCLRIIATDSDEPVRGEFRKLIEAAQMGIPV 210

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E+  R+ + +P  E +FFS VI++QS  GGNLSEAL NLS++LR+R+ M  K+QA S E
Sbjct: 211 PEACERLYKSIPTSETNFFSIVIAIQSSAGGNLSEALGNLSKVLRERRKMADKIQAFSSE 270

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S  IIG+LPF V+ +V+ TSP Y+  L     GH +L   A  M  GI+VM+ MINF
Sbjct: 271 AKTSTMIIGALPFVVAIMVFATSPYYLVPLWTTTGGHKVLFFCAVSMGFGILVMKKMINF 330


>gi|170740617|ref|YP_001769272.1| type II secretion system protein [Methylobacterium sp. 4-46]
 gi|168194891|gb|ACA16838.1| type II secretion system protein [Methylobacterium sp. 4-46]
          Length = 322

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 141/187 (75%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R A+F+ + PNA+D+IVR +++GLPV D + +I  ++ +PVR+EFR ++E+Q 
Sbjct: 136 LGYLRKRRIARFVLELPNAMDVIVRGIKSGLPVGDCLRIIAREAPEPVRTEFRALVESQA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SLSE+ +++   MP+ E +FF+ VI +Q++ GGNLSEAL NLSR+LRDR+ M  KV 
Sbjct: 196 VGVSLSEAATKLFERMPVSEANFFAIVIGIQAKSGGNLSEALGNLSRVLRDRRRMADKVS 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEA+ASA II SLPF V+ L YF+SP Y+++L     G + + ++  +M++G++VM+
Sbjct: 256 AMSMEARASAAIIASLPFVVAVLCYFSSPDYISLLWTTQVGQIAITLSGLWMVVGVLVMK 315

Query: 181 LMINFDV 187
            MI F++
Sbjct: 316 RMITFEI 322


>gi|254293218|ref|YP_003059241.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041749|gb|ACT58544.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 331

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 121/183 (66%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF   F + +D+IVR V++GLP+ + + +I  +S  P+ +EF+RVI+   +G +
Sbjct: 149 ISARQKKFTQQFSDGIDVIVRGVKSGLPLIECLRIIASESPAPLGTEFKRVIDAIQMGTT 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + +S+S M   MPL EV+FF  VI +Q Q GGNLSEAL NLS +LR RK +  KV+ALS 
Sbjct: 209 VEKSLSNMYNRMPLPEVNFFGIVIGIQQQSGGNLSEALGNLSEVLRSRKMLAEKVKALSS 268

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           EAKASA IIG+LP  V  LVYF+SP Y+ +L   P GH +L V A  M  GI VM+ M+ 
Sbjct: 269 EAKASAMIIGALPIAVMILVYFSSPDYITLLFTHPTGHFMLMVGAGLMGAGIFVMKQMMK 328

Query: 185 FDV 187
            DV
Sbjct: 329 LDV 331


>gi|220922783|ref|YP_002498085.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947390|gb|ACL57782.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 322

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 137/187 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R A+F+ + PNA+D+IVR +++GLP+ D + +I  ++ DPV++EFR ++E+Q 
Sbjct: 136 LAYLRKRRMARFVLELPNAMDVIVRGIKSGLPIGDCLRIIAREAPDPVKTEFRAIVESQA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL L E+ +++   MP+ E +FF+ VI +QS+ GGNLSEAL NLSR+LRDR+ M  KV 
Sbjct: 196 IGLPLPEAAAKLYERMPIPEANFFAIVIGIQSKSGGNLSEALGNLSRVLRDRRRMADKVS 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEA+ASA II SLPF V+ L Y +SP Y+++L     G + +  +  +MLIG++VM+
Sbjct: 256 AMSMEARASAAIIASLPFAVAILCYLSSPDYISLLWTTQVGQIAIAASGLWMLIGVLVMK 315

Query: 181 LMINFDV 187
            MI F++
Sbjct: 316 RMITFEI 322


>gi|300021858|ref|YP_003754469.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523679|gb|ADJ22148.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 332

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 127/183 (69%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L K+R AKF     NA+D++VR V++GLP+++ + VI  +S +P+  EFR V+E Q LG
Sbjct: 148 KLTKRRQAKFTSHLANAIDVVVRGVKSGLPLNECLQVIARESPEPLAGEFRSVMEQQRLG 207

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L++++ RM   MPL EV F + VI++Q Q GGNLSEAL+NLS +LRDR+ +  KV+AL
Sbjct: 208 VPLADALDRMYDRMPLAEVRFLTIVIAIQQQAGGNLSEALSNLSGVLRDRQMLALKVKAL 267

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S EAKASA ++ SLP  V  +VY +SPGYM  L     G  ++ + A +M IG++VM+ M
Sbjct: 268 SAEAKASAMVLASLPPGVMFMVYMSSPGYMMPLFTTTPGRFMMALGATWMTIGVLVMKKM 327

Query: 183 INF 185
           INF
Sbjct: 328 INF 330


>gi|167648148|ref|YP_001685811.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350578|gb|ABZ73313.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 325

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 127/180 (70%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K RT KF + F +A+DIIVR +++GLPV+D + +I  +  +P+  EFR ++E   +G+S+
Sbjct: 144 KARTKKFTEAFSDAIDIIVRGIKSGLPVNDCLKIIGKECPEPLAGEFRVLVENTGMGMSM 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ RM   MP  E+ FF+ V+++Q++ GGNL+EAL NLS +LR RK M  K++ALS E
Sbjct: 204 DQALERMYERMPTNELRFFTIVLTIQAKTGGNLAEALGNLSTVLRARKLMGEKIKALSAE 263

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A ASA+IIG+LP  V  L+  T+P YM  +  D RGH++L VAA +M +GI VMR MINF
Sbjct: 264 AVASAFIIGALPPGVVILISVTAPTYMAPMFTDQRGHLMLMVAAFWMTVGIFVMRKMINF 323


>gi|16127171|ref|NP_421735.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|221235972|ref|YP_002518409.1| TadB-like pilus assembly protein [Caulobacter crescentus NA1000]
 gi|7208429|gb|AAF40196.1|AF229646_8 TadB [Caulobacter crescentus CB15]
 gi|13424567|gb|AAK24903.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|220965145|gb|ACL96501.1| TadB-related pilus assembly protein [Caulobacter crescentus NA1000]
          Length = 325

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 125/185 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K RT KF + F +A+DIIVR +++GLPV D + +I  +  +P+  EFR + E   
Sbjct: 139 LGFLAKGRTQKFTEAFADAVDIIVRGIKSGLPVHDCLKIIGKECPEPLAGEFRILTENVA 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ +  ++ +M   MP  E+ FF+ V+++Q + GGNL+EAL NLS +LR RK MK K++
Sbjct: 199 MGVPMDAALEKMYERMPTNELRFFAIVLAIQQKTGGNLAEALGNLSAVLRSRKLMKEKIK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA+IIG LP  V TL+  TSP YM  +  DPRGH++L  +A +M IGI VMR
Sbjct: 259 ALSAEAVASAFIIGCLPPGVVTLISVTSPAYMAPMFTDPRGHLMLLASAIWMSIGIFVMR 318

Query: 181 LMINF 185
            MINF
Sbjct: 319 NMINF 323


>gi|315497461|ref|YP_004086265.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415473|gb|ADU12114.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 125/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+RT KF  +F +A+DI+VR +++GLPV D + +I  +   P+  EF+R+ E   
Sbjct: 140 LSFLAKRRTTKFTANFADAIDILVRGIKSGLPVHDGLKIIAKELPAPLGPEFQRLNENIS 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L  S+ +M   MP  E+ FF+ VI++Q + GGNL+EAL NLS +LR R+ M+ K++
Sbjct: 200 IGMGLDMSLEKMCERMPTPELRFFTIVIAIQQKTGGNLAEALGNLSHVLRSRRMMREKIK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA IIG LP  V  ++Y T+PGYM  L+ DPRG+ +L   A +ML GI +MR
Sbjct: 260 ALSSEAIASASIIGVLPPGVGIMIYITNPGYMGPLLTDPRGNFMLLGGAVWMLCGIFMMR 319

Query: 181 LMINFD 186
            MINF 
Sbjct: 320 KMINFK 325


>gi|114798049|ref|YP_761687.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738223|gb|ABI76348.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score =  180 bits (456), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK R  K ++ F +ALDIIVR VR+GLP+++ + VI  +S +P+R EF    +   
Sbjct: 153 LNFLIKGRHTKMINQFADALDIIVRGVRSGLPLNECIRVIAKESPEPLRKEFLTFADNLA 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L  S++ + + +PLQE++FF+ V+ +QS+ GGNLSEAL NLS ++R RK M+ KV+
Sbjct: 213 MGAGLERSLAALYKRLPLQEINFFAIVLIIQSKAGGNLSEALHNLSTVIRSRKMMREKVK 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAKASA IIGSLP  V  +V+ T+P Y+  L     GH++L VA   M  GI VMR
Sbjct: 273 ALSSEAKASAMIIGSLPIAVGVMVFLTTPDYIMTLFTTETGHVILVVAVGMMGSGITVMR 332

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 333 NMMNFDM 339


>gi|295690794|ref|YP_003594487.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432697|gb|ADG11869.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 325

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 124/182 (68%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L + R  KF + F +A+DIIVR +++GLP+ D + +I  +S +P+  EFR + E   +G+
Sbjct: 142 LAQGRIRKFTEAFSDAIDIIVRGIKSGLPLHDCLRIIGQESPEPLAGEFRMLTENVAMGV 201

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++ +M   MP  E+ FF+ V+++Q + GGNL+EAL NLS +LR RK MK K++ALS
Sbjct: 202 PLDAALDKMHERMPTNELRFFAIVLAIQQKTGGNLAEALGNLSTVLRSRKMMKEKIKALS 261

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA ASA IIG+LP  V  L+  TSP YM  L  DPRGH++L  AA +M IG++VMR MI
Sbjct: 262 AEAVASALIIGALPPGVIVLISVTSPAYMQPLFTDPRGHLMLLAAAIWMGIGVLVMRKMI 321

Query: 184 NF 185
           NF
Sbjct: 322 NF 323


>gi|150377236|ref|YP_001313831.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150031783|gb|ABR63898.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 332

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 93/179 (51%), Positives = 130/179 (72%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R AKF  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q LG+ + E
Sbjct: 153 RFAKFTAEFPNAVDVIVRGLKAGLPMPDCLRVIATEAQEPVKGEFLAIVQDQTLGIPVDE 212

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ RM   MPL E  FF+ VI++QS+ GG+LSEAL NLS++LR+RK MKAK++A+S EAK
Sbjct: 213 AVKRMSERMPLAEAHFFAIVIAIQSRTGGSLSEALGNLSKVLRERKKMKAKIKAMSSEAK 272

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +SA IIG+LPF V+  VYF SP YM +L     G ++L     +M IGI+VMR MINFD
Sbjct: 273 SSAGIIGALPFLVAGAVYFASPDYMALLFATVTGKIVLVGCGLWMGIGILVMRKMINFD 331


>gi|227818620|ref|YP_002822591.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|36958876|gb|AAQ87301.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Sinorhizobium fredii NGR234]
 gi|227337619|gb|ACP21838.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 332

 Score =  176 bits (447), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 91/180 (50%), Positives = 131/180 (72%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +F  +FPNA+D+IVR ++AGLP++D + VI  ++ +PV+ EF  +   Q LGL + 
Sbjct: 152 RRLKRFTAEFPNAVDVIVRGLKAGLPMTDCLRVIAAEAQEPVKGEFLTIAHDQTLGLPVD 211

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++ R+   MPL E  FF+ VI++QS+ GG+LSEAL NLS++LR+RK MKAK++A+S EA
Sbjct: 212 EAVERLCERMPLPEARFFAIVITIQSRTGGSLSEALGNLSKVLRERKKMKAKIKAMSAEA 271

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K+SA IIG+LPF V+  VY TSP YM++L     G M+L  +A +M IG ++MR MINFD
Sbjct: 272 KSSAGIIGALPFFVAGAVYLTSPDYMSLLFTTMTGKMVLVGSALWMGIGTLLMRKMINFD 331


>gi|144897190|emb|CAM74054.1| pilus assembly protein TadB [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 279

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 122/184 (66%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L K+R A+F   F +ALDI+VR +R+GLP+ + +A+I  +  +P+  EFR V+E Q LGL
Sbjct: 96  LGKRRIARFTTLFADALDIVVRGLRSGLPLGECMAIIGREVPEPLGPEFRLVMEGQKLGL 155

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           SL ES++R V   P  +  +F+ V+ +Q Q GGNL+E LA LS +LR RK M+ K++A S
Sbjct: 156 SLEESLARAVERTPTADFKYFAIVLGIQQQTGGNLAETLAKLSEVLRARKRMRDKIKAFS 215

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA ASA IIGSLP  V+ L+    P Y+ +L + P GH+LL      M +G +VMR MI
Sbjct: 216 SEATASAMIIGSLPVVVALLLTAVGPDYIGILFSTPTGHLLLASGGLLMGMGALVMRKMI 275

Query: 184 NFDV 187
           NFD+
Sbjct: 276 NFDL 279


>gi|114568974|ref|YP_755654.1| type II secretion system protein [Maricaulis maris MCS10]
 gi|114339436|gb|ABI64716.1| type II secretion system protein [Maricaulis maris MCS10]
          Length = 327

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 124/181 (68%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +F  +F NALD+I R V++GLP+++ + ++  +S +PV++EF +++E   +G+SL 
Sbjct: 147 RRQKQFSGEFANALDVITRGVKSGLPLNECLKILSVESPEPVKTEFAKLVEGIAVGVSLP 206

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           + + RM   MPL E++FF TV+ +Q + GGNL+E L NLS +LR RK M+ K+ ALS EA
Sbjct: 207 DGLDRMCERMPLPELNFFRTVLIIQQKTGGNLAETLGNLSVVLRSRKMMREKIGALSSEA 266

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K+SA IIGSLP  V  +VY T+P YM  +   P G ++L     +M IGIMVMR MINF 
Sbjct: 267 KSSAAIIGSLPPGVMGIVYATTPSYMGQMFTHPTGQLMLLGGLTWMFIGIMVMRGMINFK 326

Query: 187 V 187
           +
Sbjct: 327 I 327


>gi|254420696|ref|ZP_05034420.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186873|gb|EDX81849.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 126/184 (68%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L K R  KF  +FPNA+D+IVR +++GLPV +   +I  +S  P+   F++++E   +G+
Sbjct: 143 LAKARMKKFSLEFPNAVDVIVRGIKSGLPVHECFKIIARESPAPLGPAFKKLVEALGVGM 202

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +L +++ +M   MP  E+ FF+ VI++Q + GGNL+EAL+NLS +LR R+ M+ KV+ALS
Sbjct: 203 TLEQALDKMFEQMPTPELRFFTIVIAIQQKTGGNLAEALSNLSTVLRARRMMREKVKALS 262

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA ASA II SLP  V T+V FTSPGYM  L  D RG+ LL +A A M  GI VM+ MI
Sbjct: 263 SEALASAGIIASLPPAVMTMVMFTSPGYMMALFTDIRGNALLLLAGALMGTGIFVMKRMI 322

Query: 184 NFDV 187
           +F +
Sbjct: 323 SFKI 326


>gi|329847257|ref|ZP_08262285.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842320|gb|EGF91889.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 337

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 121/179 (67%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF ++FPNA+DI+VR +++GLPV D + +I  +S  P+  EF R++E   +G+S+  
Sbjct: 158 RLKKFTEEFPNAMDILVRGIKSGLPVHDGLKIISKESPAPLGPEFLRLVENVGVGMSVEG 217

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ +M   +P  E+ FF+ VI++Q++ GGNL+EAL NLS +LR RK M+ K++ALS EA 
Sbjct: 218 ALEKMSERIPSPELRFFTIVIAIQAKTGGNLAEALNNLSTVLRARKMMREKIKALSSEAI 277

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           ASA IIG LP  V  ++  T P Y+  +  DPRG ++L   A +M +GI +MR MINF 
Sbjct: 278 ASASIIGVLPPGVGVMISLTRPEYIGGMFTDPRGQIMLLGGAIWMALGIFMMRKMINFK 336


>gi|302381752|ref|YP_003817575.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192380|gb|ADK99951.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 326

 Score =  167 bits (422), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 124/181 (68%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KF  +F NA+D+IVR +++GLPV D   +I  +S  PV  EF+ ++E   +GL+L
Sbjct: 145 KRRLKKFSLEFANAVDVIVRGIKSGLPVHDCFKIIARESPAPVGPEFQTLVEGLGVGLTL 204

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ +M   +P  E+ FF+ VI++Q + GGNL EAL+NL+ +LR R+ M  K++ALS E
Sbjct: 205 GQALEKMYERIPTPELRFFTIVIAIQQKTGGNLGEALSNLTTVLRARRMMGEKIKALSSE 264

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A ASA IIGSLP  V TLV  T+P YM ++  D RG ++L  +A +M +GI++M+ MI+F
Sbjct: 265 ATASAGIIGSLPPVVMTLVGLTTPAYMGLMFTDFRGQVMLLGSAIWMGMGILMMKKMISF 324

Query: 186 D 186
            
Sbjct: 325 K 325


>gi|304320651|ref|YP_003854294.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
 gi|303299553|gb|ADM09152.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
          Length = 330

 Score =  164 bits (415), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 127/182 (69%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF ++F NA+D+IVR V++GLPV++ + +I   +  PV+ EF+ ++E Q +GL+L
Sbjct: 149 RKRQKKFENEFSNAIDVIVRGVKSGLPVNECLKIISRDAQSPVKEEFQLLVEGQRIGLTL 208

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +S+ R+   MP+ +V+FF+ V+ +Q Q GGNL++AL NLS +LR RK M  K+ ALSME
Sbjct: 209 EQSLERLYNRMPISDVNFFAIVLVIQQQTGGNLADALGNLSTVLRSRKTMLGKIAALSME 268

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AKASA I+ ++PF VS LVY  +P Y+  L +   G  +L  A  +MLIGI+VM+ MI+ 
Sbjct: 269 AKASAAILAAMPFFVSGLVYLAAPDYIAPLFSTQTGQFMLMGAGMWMLIGIVVMKNMISI 328

Query: 186 DV 187
            V
Sbjct: 329 KV 330


>gi|329890993|ref|ZP_08269336.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846294|gb|EGF95858.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 327

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 119/181 (65%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R  KF   F +A+DI+VR ++ GLPV D   +I  +S +P+  EFR ++E   +GL+L
Sbjct: 146 KARMKKFSLAFADAIDILVRGIKTGLPVHDCFKIIARESPEPLAGEFRTLVEGMGVGLTL 205

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++ +M   MP  E+ FF+ VI++Q + GGNL+EAL NL+ +LR R+ M  K++ALS E
Sbjct: 206 AQALDKMYERMPTPELKFFAIVIAIQQKSGGNLAEALGNLTTVLRARRMMVEKIKALSSE 265

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A ASA II SLP  V  LV  ++P YM ++  D RG ++L  AA +M  G+ VM+ MI+F
Sbjct: 266 AIASAGIIASLPPAVMILVMLSNPSYMMLMFTDIRGQVMLMGAALWMATGVFVMKRMISF 325

Query: 186 D 186
            
Sbjct: 326 K 326


>gi|83312844|ref|YP_423108.1| Flp pilus assembly protein TadB [Magnetospirillum magneticum AMB-1]
 gi|82947685|dbj|BAE52549.1| Flp pilus assembly protein TadB [Magnetospirillum magneticum AMB-1]
          Length = 330

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 121/181 (66%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F   F +ALD++VR +R+GLP+ + +A+I  +  DPV +EFR++ E   +GL+L 
Sbjct: 150 KRLKAFASQFADALDVVVRGIRSGLPLGECIAIIGREMPDPVGAEFRQITEGTRIGLTLH 209

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++ R V  MP+ E+ +F+ V+++Q Q GGNL+E LA LS +LR RK M+ KVQA + EA
Sbjct: 210 EALGRAVERMPMAEMRYFAIVLAIQQQTGGNLAETLAKLSDVLRARKRMRDKVQAYAAEA 269

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +ASA IIGSLP  V  ++   +P Y+ +L     G++LL +      +G++VMR MINFD
Sbjct: 270 RASAAIIGSLPLVVVGMLGLVAPQYIALLFTSDLGNILLAIGVGTEAMGVLVMRNMINFD 329

Query: 187 V 187
           +
Sbjct: 330 I 330


>gi|46201039|ref|ZP_00055942.2| COG4965: Flp pilus assembly protein TadB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 331

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 120/181 (66%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F   F +ALD++VR +R+GLP+ + +A+I  +  DPV +EFR++ E   +GL+L 
Sbjct: 151 KRLKAFTAQFADALDVVVRGIRSGLPLGECIAIIGREMPDPVGAEFRQITEGTRIGLTLH 210

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E+++R V  MP+ E+ +F+ V+++Q Q GGNL+E LA LS +LR RK M+ KV + + EA
Sbjct: 211 EAMTRAVERMPMAEMRYFAIVLAIQQQTGGNLAETLAKLSEVLRARKRMRDKVLSYAAEA 270

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +ASA IIGSLP  V  ++   +P Y+ VL     G++LL +       G+MVMR MINFD
Sbjct: 271 RASAAIIGSLPLLVVAMLGMLAPQYIGVLFTTEPGNLLLAIGILTEAAGVMVMRGMINFD 330

Query: 187 V 187
           +
Sbjct: 331 I 331


>gi|197106462|ref|YP_002131839.1| Flp pilus assembly protein TadB [Phenylobacterium zucineum HLK1]
 gi|196479882|gb|ACG79410.1| Flp pilus assembly protein TadB [Phenylobacterium zucineum HLK1]
          Length = 305

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 113/184 (61%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L+ +R  +FL  F  A+ +IVR +RAGLPV++ V V+  +   PV  EFRRV +   LG 
Sbjct: 122 LMGRRRGRFLKTFAEAIALIVRGLRAGLPVTETVGVVGREIEGPVGEEFRRVADEVRLGA 181

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            +  ++    R + L E  F +  ++VQ + GGNL+E+L NL  ILR R+ M+ K++A+S
Sbjct: 182 PIEGAMGEAARRIGLPEFDFLAICLAVQRETGGNLAESLENLEHILRRRQQMRLKIKAMS 241

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA ASA IIG LPF ++ L+   SP YM VL   P G +++    A + +G ++MR M+
Sbjct: 242 SEATASALIIGVLPFAMAVLMSIASPDYMRVLFTGPLGRLMIAAGLASLAVGGLIMRKMV 301

Query: 184 NFDV 187
            F++
Sbjct: 302 RFEI 305


>gi|296284555|ref|ZP_06862553.1| hypothetical protein CbatJ_13051 [Citromicrobium bathyomarinum
           JL354]
          Length = 323

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 123/185 (66%), Gaps = 2/185 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            +K+RTA+F   FP+A+D++VR +R+GLPV++ +AV+  +   PV  EF+ +IE   +G 
Sbjct: 140 FMKRRTAQFNARFPDAIDLLVRGLRSGLPVTETLAVVAQEIPGPVGIEFKGIIERIKIGR 199

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ E++      + + E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++A+S
Sbjct: 200 SMEEAMQESADRLGIAEFNFFVIALAIQRETGGNLAETLSNLSDVLRKRAQMKLKIKAMS 259

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLM 182
            E+KASA+I+GSLPF V  ++++ +P Y+     D R  M+ G+    +M +G+ +M  M
Sbjct: 260 SESKASAYIVGSLPFLVFAMIWWVNPSYLGAFFIDER-LMIAGIGGLVWMSLGVFIMSKM 318

Query: 183 INFDV 187
           ++F++
Sbjct: 319 VSFEI 323


>gi|85373128|ref|YP_457190.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
 gi|84786211|gb|ABC62393.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
          Length = 323

 Score =  147 bits (371), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 121/185 (65%), Gaps = 2/185 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            I KRTA F   FP+A++++VR +R+GLPV++ +AV+  +   PV  EF+ ++E   +G 
Sbjct: 140 FINKRTADFNSKFPDAIELLVRGLRSGLPVTETLAVVAQEVPGPVGVEFKSIVERIKIGK 199

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ E +      + + E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++A+S
Sbjct: 200 TMEEGLQDTADKLNIPEFNFFCITLAIQRETGGNLAETLSNLSEVLRKRGQMKLKIRAMS 259

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLM 182
            E+KASA+I+G+LPF V  ++++ +P Y++    D R  +++G+    +M IG  +M  M
Sbjct: 260 SESKASAYIVGALPFIVFAMIWWINPTYIDGFFTDER-LIVIGLGGMVWMSIGAFIMAKM 318

Query: 183 INFDV 187
           ++F++
Sbjct: 319 VSFEI 323


>gi|332188385|ref|ZP_08390110.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
 gi|332011614|gb|EGI53694.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
          Length = 327

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 116/183 (63%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +RT KF+  FP+A++++VR +R+GLP+++ ++V+  +   PV  EFR V +   +G +
Sbjct: 145 INRRTTKFIARFPDAIELLVRGLRSGLPITETMSVVGQEIPGPVGDEFRAVSDRMKIGRT 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++      +   E  FF   I++Q + GGNL+E L+NL+ +LR R  MK K++A+S 
Sbjct: 205 MDAALQETADRLETPEFQFFVIAIAIQRETGGNLAETLSNLAEVLRKRAQMKLKIKAMSS 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E+KASA+IIG+LPF V  +++  +  YM     DPR  ++ G    +M +G+ +M  MIN
Sbjct: 265 ESKASAYIIGALPFVVFAMIWMINAPYMARFFVDPRLMIIGGGGLLWMALGVFIMSRMIN 324

Query: 185 FDV 187
           F++
Sbjct: 325 FEI 327


>gi|326388861|ref|ZP_08210443.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206461|gb|EGD57296.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 323

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 115/184 (62%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I KR   F+  FP+AL+++VR +R+GLP+S+ + V+  +   PV  EF+ V +   LG +
Sbjct: 141 INKRINNFITRFPDALELLVRGLRSGLPISETLVVVANELPGPVSEEFKIVTDRIRLGRT 200

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + +++      + L E SFF   +++Q + GGNL+E LANL+ +LR R  MK K++A+S 
Sbjct: 201 MEDALQETADRLDLAEFSFFCITLAIQRETGGNLAETLANLADVLRKRAQMKLKIKAMSS 260

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML-IGIMVMRLMI 183
           E+KASA+I+GSLPF V  L+Y  +P Y+     D R  M+ G+     L +G  +M  M+
Sbjct: 261 ESKASAYIVGSLPFIVFALIYSINPRYLGQFFVDER-LMVAGIGGLIWLSMGAFIMSRMV 319

Query: 184 NFDV 187
           NF++
Sbjct: 320 NFEI 323


>gi|148557758|ref|YP_001265340.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148502948|gb|ABQ71202.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 324

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 113/185 (61%), Gaps = 2/185 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L K+R A+F+  FP+A++++VR +RAGLP+++ +  +  +   PV SEF+ V +   +G 
Sbjct: 141 LAKRRIAQFITRFPDAIELLVRGLRAGLPIAETMGAVASEIEGPVGSEFQAVSDRMRIGR 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +L  ++      +   E  FF   +++Q + GGNL+E L NL+ +LR R  MK K+ A+S
Sbjct: 201 TLEGALQETADRLGTAEFQFFVITLAIQRETGGNLAETLGNLADVLRKRMQMKLKISAMS 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLM 182
            E+KASA+IIG LPF V  L+ F SP YM     D R  M+ G     +M IG  +MR M
Sbjct: 261 SESKASAYIIGVLPFVVFGLISFISPTYMAGFFADQR-LMIAGAGGLIWMSIGAYIMRQM 319

Query: 183 INFDV 187
           INF++
Sbjct: 320 INFEI 324


>gi|149186258|ref|ZP_01864572.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
 gi|148830289|gb|EDL48726.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
          Length = 323

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 120/184 (65%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKRT +F   F +A++++VR +R+GLPV++ + V+  +   PV  EF+ ++E   +G +
Sbjct: 141 IKKRTNQFNVKFADAIELLVRGLRSGLPVTETLNVVSQEIPGPVGEEFKSIVERIKIGRT 200

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + ES+      + + E +FF   +++Q + GGNL+E L+NL+ +LR R  MK K++A+S 
Sbjct: 201 MEESLQETADRLGIPEFNFFCITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIKAMSS 260

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLMI 183
           E+KASA+I+GSLPF V  L+++ +P Y+     D R  ++ G+    +M IG+ +M  M+
Sbjct: 261 ESKASAYIVGSLPFIVFGLIFWINPEYLGGFFTDDR-LIVTGLGGLTWMGIGVFIMAKMV 319

Query: 184 NFDV 187
           +F++
Sbjct: 320 SFEI 323


>gi|254486637|ref|ZP_05099842.1| type II secretion system protein [Roseobacter sp. GAI101]
 gi|214043506|gb|EEB84144.1| type II secretion system protein [Roseobacter sp. GAI101]
          Length = 317

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 112/178 (62%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
           A F  D P ALDI  R +RAG PV+D++A++V  +  P+  EF R  +   +G +L E++
Sbjct: 140 ATFAADLPEALDIFARGLRAGRPVTDSMAIVVDNAKGPILREFTRCHDEVRMGNTLPETL 199

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
            R+   +PL EV+FF+   ++Q++ GGNL E + NL+  LR+R+ ++ K +ALS EA+AS
Sbjct: 200 ERLSARLPLPEVTFFAVATALQAETGGNLIETMENLATQLRERRKLRKKARALSSEARAS 259

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           A I+ +LPF V+ L+   +  Y+  L +DPRG  +   AA+ + +GI VM  M   +V
Sbjct: 260 AVILAALPFAVAVLIAVLNGDYLEPLYSDPRGRFMSVTAASSIGLGIFVMVRMGKLNV 317


>gi|85707699|ref|ZP_01038765.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
 gi|85689233|gb|EAQ29236.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
          Length = 323

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 119/185 (64%), Gaps = 2/185 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            IKKRT  F   F + ++++VR +R+GLPV++ +AV+  +   PV  EF+ ++E   +G 
Sbjct: 140 FIKKRTNDFNAKFADGIELLVRGLRSGLPVTETLAVVAQEVPGPVGLEFKGIVERIKIGK 199

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ +S+      + + E +FF+  +++Q + GGNL+E L+NL+ +LR R  MK K++A+S
Sbjct: 200 TMEDSLQETADRLGIPEFNFFTITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIKAMS 259

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLM 182
            E+KASA+I+GSLPF V  L+Y  +P Y+     + R  M+ G+    +M IGI +M  M
Sbjct: 260 SESKASAYIVGSLPFIVFGLIYSVNPSYIGGFFVEER-LMVTGLGGLVWMSIGIFIMAKM 318

Query: 183 INFDV 187
           ++F++
Sbjct: 319 VSFEI 323


>gi|103486614|ref|YP_616175.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98976691|gb|ABF52842.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 310

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 114/184 (61%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKR A+F   FP+A+D++VR +R+GLPV++   V+  +   PV  EF+ V+E   +G +
Sbjct: 128 IKKRVAQFNARFPDAIDLLVRGLRSGLPVTETFQVVSQELPGPVGEEFKGVVERIRIGNT 187

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++      +   E  FF   I +Q + GGNL+E LANLS +LR R  MK K++A+S 
Sbjct: 188 MEAALQETAEMLGTPEFQFFCITIQIQRETGGNLAETLANLSDVLRKRAQMKLKIRAMSS 247

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLMI 183
           EAKASA+I+G+LPF V  +V+  +P Y+     + R  ++ G+    +M IG  +M  M+
Sbjct: 248 EAKASAYIVGALPFFVFGVVWTVNPSYLAGFFVEQR-LIVAGIGGLIWMSIGAGIMAKMV 306

Query: 184 NFDV 187
           NF++
Sbjct: 307 NFEI 310


>gi|87199098|ref|YP_496355.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134779|gb|ABD25521.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 324

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 116/184 (63%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I KR   F+   P+ALD++VR +R+GLPV++ + V+  +   PV  EF+ V +   +G +
Sbjct: 142 INKRIDNFVTRLPDALDLLVRGLRSGLPVTETLGVVAAELPGPVGEEFKLVTDRIKVGRT 201

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + E++      + L E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++A+S 
Sbjct: 202 MEEALQDTADRLNLPEFNFFCITLAIQRETGGNLAETLSNLSDVLRKRAQMKLKIKAMSS 261

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-AFMLIGIMVMRLMI 183
           E+KASA+I+G+LPF V  L+Y+ +P Y+     D R  ++ G+    ++ IG  +M  M+
Sbjct: 262 ESKASAYIVGALPFIVFALIYWINPVYLGKFFVDER-LIIAGLGGLTWLGIGAFIMAKMV 320

Query: 184 NFDV 187
           +F++
Sbjct: 321 SFEI 324


>gi|288956973|ref|YP_003447314.1| type II secretion system [Azospirillum sp. B510]
 gi|288909281|dbj|BAI70770.1| type II secretion system [Azospirillum sp. B510]
          Length = 319

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 100/156 (64%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  +RT +FLD  P+A+D++VR+ RAG+PVS+A+     ++ +PVRSEFRRV +   +G+
Sbjct: 136 LTHRRTIRFLDRLPDAIDLVVRASRAGVPVSEAIIAAGRETEEPVRSEFRRVADQVSIGV 195

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L +++ +    + L +  FF   + VQ + GG L+E L NLS ILR RK+M+ KV+AL+
Sbjct: 196 DLKDALRQSSARVRLPDFDFFVVALVVQRETGGQLAETLGNLSDILRKRKDMRLKVKALT 255

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
            E + SA I+ SLPF    L++   P Y+  L  DP
Sbjct: 256 AEGRMSANIVASLPFVSGGLIFAVDPTYVLNLFTDP 291


>gi|167719678|ref|ZP_02402914.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 205

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 115/184 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 20  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 79

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 80  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 139

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 140 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 199

Query: 184 NFDV 187
           N D 
Sbjct: 200 NLDT 203


>gi|167894382|ref|ZP_02481784.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 205

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 20  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 79

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 80  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 139

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 140 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 199

Query: 184 NFD 186
           N D
Sbjct: 200 NLD 202


>gi|167845810|ref|ZP_02471318.1| type II secretion system protein [Burkholderia pseudomallei B7210]
          Length = 202

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 17  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 76

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 77  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 136

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 137 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 196

Query: 184 NFD 186
           N D
Sbjct: 197 NLD 199


>gi|167824264|ref|ZP_02455735.1| type II secretion system protein [Burkholderia pseudomallei 9]
          Length = 204

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 19  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 78

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 79  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 138

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 139 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 198

Query: 184 NFD 186
           N D
Sbjct: 199 NLD 201


>gi|167738670|ref|ZP_02411444.1| type II secretion system protein [Burkholderia pseudomallei 14]
          Length = 200

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 15  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 74

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 75  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 134

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 135 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 194

Query: 184 NFD 186
           N D
Sbjct: 195 NLD 197


>gi|167815891|ref|ZP_02447571.1| type II secretion system protein [Burkholderia pseudomallei 91]
          Length = 212

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 27  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 86

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 87  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 146

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 147 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 206

Query: 184 NFD 186
           N D
Sbjct: 207 NLD 209


>gi|167911028|ref|ZP_02498119.1| type II secretion system protein [Burkholderia pseudomallei 112]
          Length = 217

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 32  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 91

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 92  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 151

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 152 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 211

Query: 184 NFD 186
           N D
Sbjct: 212 NLD 214


>gi|254178308|ref|ZP_04884963.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|160699347|gb|EDP89317.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
          Length = 331

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 146 LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 205

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 206 DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 265

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 266 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 325

Query: 184 NFD 186
           N D
Sbjct: 326 NLD 328


>gi|167902782|ref|ZP_02489987.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 223

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 38  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 97

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 98  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 157

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 158 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 217

Query: 184 NFD 186
           N D
Sbjct: 218 NLD 220


>gi|121599706|ref|YP_993002.1| Flp pilus assembly protein TadB [Burkholderia mallei SAVP1]
 gi|124386517|ref|YP_001026334.1| hypothetical protein BMA10229_A0332 [Burkholderia mallei NCTC
           10229]
 gi|126449976|ref|YP_001080392.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|121228516|gb|ABM51034.1| Flp pilus assembly protein TadB [Burkholderia mallei SAVP1]
 gi|124294537|gb|ABN03806.1| putative membrane protein [Burkholderia mallei NCTC 10229]
 gi|126242846|gb|ABO05939.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
          Length = 331

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 146 LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 205

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 206 DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 265

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 266 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 325

Query: 184 NFD 186
           N D
Sbjct: 326 NLD 328


>gi|53719427|ref|YP_108413.1| hypothetical protein BPSL1814 [Burkholderia pseudomallei K96243]
 gi|76811973|ref|YP_333440.1| hypothetical protein BURPS1710b_2045 [Burkholderia pseudomallei
           1710b]
 gi|126441337|ref|YP_001058912.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134282297|ref|ZP_01769002.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|217421505|ref|ZP_03453009.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226196396|ref|ZP_03791978.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237812169|ref|YP_002896620.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254259104|ref|ZP_04950158.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|52209841|emb|CAH35813.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76581426|gb|ABA50901.1| putative membrane protein [Burkholderia pseudomallei 1710b]
 gi|126220830|gb|ABN84336.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134246335|gb|EBA46424.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|217395247|gb|EEC35265.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225931613|gb|EEH27618.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506496|gb|ACQ98814.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254217793|gb|EET07177.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 331

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 146 LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 205

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 206 DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 265

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 266 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 325

Query: 184 NFD 186
           N D
Sbjct: 326 NLD 328


>gi|254198194|ref|ZP_04904616.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|169654935|gb|EDS87628.1| type II secretion system protein [Burkholderia pseudomallei S13]
          Length = 331

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 146 LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 205

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 206 DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 265

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 266 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 325

Query: 184 NFD 186
           N D
Sbjct: 326 NLD 328


>gi|126452248|ref|YP_001066154.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242314755|ref|ZP_04813771.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|126225890|gb|ABN89430.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242137994|gb|EES24396.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
          Length = 331

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 146 LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 205

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 206 DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 265

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 266 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 325

Query: 184 NFD 186
           N D
Sbjct: 326 NLD 328


>gi|167919044|ref|ZP_02506135.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
          Length = 216

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 115/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 31  LIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 90

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 91  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 150

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R + 
Sbjct: 151 AEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIA 210

Query: 184 NFD 186
           N D
Sbjct: 211 NLD 213


>gi|239908017|ref|YP_002954758.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239797883|dbj|BAH76872.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 326

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 114/181 (62%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A F    P AL+++ R++RAG   +  + ++V + +DP+R EF+  +E  + G+ ++
Sbjct: 146 KRMADFERQLPEALELVGRALRAGHTFTSGMGMVVSEFADPIRVEFQTTLEEINFGMGVT 205

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  ++  +   +++FF   + +Q++ GGNL+E + N+S ++R+R  +K ++Q LS E 
Sbjct: 206 TALDNLMDRVDCPDLNFFVVSVKIQNESGGNLAEIIGNISGLIRERFKLKGRIQVLSAEG 265

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AW++  LPF V+ ++ F +PGY+ +L  DP G ++    A  + +GI+V+R M+  +
Sbjct: 266 RMAAWVLCLLPFGVAAVIQFVNPGYLGLLFTDPMGRIMSYGVAGLITMGILVIRKMVRIE 325

Query: 187 V 187
           V
Sbjct: 326 V 326


>gi|167842100|ref|ZP_02468784.1| type II secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 200

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 114/183 (62%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +G 
Sbjct: 15  LIARFKQRFLGVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGA 74

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +AL+
Sbjct: 75  DLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALT 134

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + ++ II ++PF ++  ++  +  Y+++L     GH +L +AA  + IG+ ++R + 
Sbjct: 135 AEGRIASKIIAAVPFAIAAFLFVVNRPYIDLLFRTRAGHKMLILAAVLLTIGLAMIRKIA 194

Query: 184 NFD 186
           N D
Sbjct: 195 NLD 197


>gi|21673274|ref|NP_661339.1| TadB protein [Chlorobium tepidum TLS]
 gi|21646363|gb|AAM71681.1| tadB protein [Chlorobium tepidum TLS]
          Length = 305

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 106/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR   F    P ALD I RS+RAG  +S A+ +I  +  DP+  EF+ V +  + G+  
Sbjct: 124 KKRRMAFEAKLPEALDYISRSLRAGHSLSSAIGMIGKEFPDPLGGEFKTVFDEMNFGIPF 183

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E+ + +   +   ++SFF   + +Q + GGNL+E L  L+  +R+R  ++ KV+ LS E
Sbjct: 184 KEAFAHLSNRIRSNDISFFVIALMIQHETGGNLAELLGGLATTIRERFKLRGKVRTLSSE 243

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SA ++GS+PF  +T++   +P Y+  L N P+GH LL +A   ML+G+ V+  M+  
Sbjct: 244 GRISALVLGSMPFVFATIISLINPRYILPLFNTPQGHTLLYIAGGLMLVGMYVLNNMVKI 303

Query: 186 DV 187
            V
Sbjct: 304 KV 305


>gi|94497257|ref|ZP_01303829.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
 gi|94423362|gb|EAT08391.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
          Length = 332

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 114/193 (59%), Gaps = 8/193 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            LI KR ++F   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   +G
Sbjct: 140 RLITKRVSQFNAKFPDALELLTRGLRSGLPIAETLGVVSNEIPGPVGEEFKLITERIKIG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            ++ +++      +   E  FF   +S+Q + GGNL+E L+NL+ +LR R  MK K++A+
Sbjct: 200 RTMEQALQETADRLGTAEFQFFVITLSIQRETGGNLAETLSNLATVLRQRSQMKLKIRAM 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRG------HMLLGVAA-AFMLI 174
           S E+KASA+IIG LPF V  ++ + +  YM      DP G        ++G+    +M I
Sbjct: 260 SSESKASAYIIGVLPFLVFGMICYINFDYMKPFFTPDPVGIFGLSTMQVIGIGGMCWMGI 319

Query: 175 GIMVMRLMINFDV 187
           G  +M  MINF++
Sbjct: 320 GAFIMAQMINFEI 332


>gi|307293453|ref|ZP_07573299.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881519|gb|EFN12735.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 332

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 114/193 (59%), Gaps = 8/193 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            LI KR  +F   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   +G
Sbjct: 140 RLINKRVQQFTAKFPDALELLTRGLRSGLPIAETLGVVSSEVPGPVGEEFKLITERIKIG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            ++ +++      +   E  FF   +++Q + GGNL+E L+NL+ +LR R  MK K++A+
Sbjct: 200 KTMDQALQETADRLGTAEFQFFVISLAIQRETGGNLAETLSNLATVLRQRSQMKLKIRAM 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRG------HMLLGVAA-AFMLI 174
           S E+KASA+IIG LPF V  L+ + +  YM+     DP G        ++G+    +M I
Sbjct: 260 SSESKASAYIIGVLPFTVFGLICYINYDYMSPFFTPDPVGLFGLSTMQVVGIGGMCWMGI 319

Query: 175 GIMVMRLMINFDV 187
           G  +M  MINF++
Sbjct: 320 GAFIMAQMINFEI 332


>gi|294012436|ref|YP_003545896.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675766|dbj|BAI97284.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 332

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 114/193 (59%), Gaps = 8/193 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            LIK R  KF   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   +G
Sbjct: 140 RLIKGRVLKFNAKFPDALELLTRGLRSGLPIAETLNVVSNEVPGPVGEEFKLITERIKIG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            ++ +++      +   E  FF   +++Q + GGNL+E L+NL+ +LR R  MK K++A+
Sbjct: 200 KTMDQALQETADRLGTPEFQFFVISLAIQRETGGNLAETLSNLATVLRQRAQMKLKIRAM 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRG------HMLLGVAA-AFMLI 174
           S E+KASA+IIG LPF V  L+ + +  YM+     DP G        ++G+    +M I
Sbjct: 260 SSESKASAYIIGVLPFTVFGLICYINYDYMSPFFTPDPAGLFGLSTMQVIGIGGMCWMSI 319

Query: 175 GIMVMRLMINFDV 187
           G  +M  MINF++
Sbjct: 320 GAFIMAQMINFEI 332


>gi|167620120|ref|ZP_02388751.1| pilus assembly protein, putative [Burkholderia thailandensis Bt4]
          Length = 217

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 30  RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 89

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 90  GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 149

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 150 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 209

Query: 182 MINFD 186
           + N D
Sbjct: 210 IANLD 214


>gi|167581956|ref|ZP_02374830.1| pilus assembly protein, putative [Burkholderia thailandensis TXDOH]
          Length = 219

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 32  RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 91

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 92  GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 151

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 152 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 211

Query: 182 MINFD 186
           + N D
Sbjct: 212 IANLD 216


>gi|83719955|ref|YP_442976.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|257139200|ref|ZP_05587462.1| pilus assembly protein, putative [Burkholderia thailandensis E264]
 gi|83653780|gb|ABC37843.1| pilus assembly protein, putative [Burkholderia thailandensis E264]
          Length = 330

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 143 RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 202

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 203 GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 262

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 263 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 322

Query: 182 MINFD 186
           + N D
Sbjct: 323 IANLD 327


>gi|209515955|ref|ZP_03264816.1| type II secretion system protein [Burkholderia sp. H160]
 gi|209503613|gb|EEA03608.1| type II secretion system protein [Burkholderia sp. H160]
          Length = 325

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 117/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +  A+FL  FP+ LD+I+R+VRAG+PV  A++    ++ +PVRS FR + ++  L
Sbjct: 138 RFLIARFRAQFLLVFPDTLDLIIRAVRAGIPVVQAISTAGKEAEEPVRSTFRTMGDSLRL 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L E + + V  + + + SFF+  + +Q + GGNL E L NLS I+R R++++ K +A
Sbjct: 198 GADLKEVLDKAVARLQIADFSFFAVCLLLQRETGGNLGETLENLSGIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF +   +Y  +  Y+++L +   GH +L +AA  ++IG+ +++ 
Sbjct: 258 LTAEGRIASKIISAVPFAIMGFLYVINRPYVDLLFHTRAGHKMLTLAAVLLVIGLSLIQK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|187919328|ref|YP_001888359.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717766|gb|ACD18989.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 325

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 114/187 (60%), Gaps = 3/187 (1%)

Query: 4   LIKKRTAKFLD---DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           L +KRT + L      P+A D+I R++RAG     A+ ++  +  +P+  EF  V +  +
Sbjct: 139 LCRKRTKRVLQLERQLPDAADLIARALRAGHSFPAALGMVGEELPNPLGGEFALVFDEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+S+S+++  MV  +P++++ +F   + +Q + GGNL+E L +++ I+R+R  +  KV+
Sbjct: 199 YGVSMSDALLNMVNRVPVEDLRYFVIAVLIQREAGGNLAEILGSIAGIIRERLKLLGKVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAW++G LPF +  L+   +PGY++V   DP G  + GVA A ML GI+ MR
Sbjct: 259 VLSAEGRLSAWVLGVLPFAILGLLSVLNPGYISVFWKDPAGPQIAGVAIAMMLFGILWMR 318

Query: 181 LMINFDV 187
            ++   V
Sbjct: 319 KVVRIRV 325


>gi|224824219|ref|ZP_03697327.1| type II secretion system protein [Lutiella nitroferrum 2002]
 gi|224603638|gb|EEG09813.1| type II secretion system protein [Lutiella nitroferrum 2002]
          Length = 324

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 106/181 (58%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR AKF +  P+A+D++ R++RAG  +  ++ +I  + SDP+  EFR   +  + G SL 
Sbjct: 144 KRLAKFEEQLPDAIDLMCRALRAGHALPQSLKMIGDEMSDPISGEFRTTFDEVNYGFSLQ 203

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P  ++ +    + +Q + GGNL+E L N+S ++R R  +   ++ L+ E 
Sbjct: 204 EAMMNLATRIPSTDLRYMVIAVLIQRETGGNLAELLGNISALIRARLKLYGTIRVLAAEG 263

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SAWI+  LPF V+ +++  +PG+M VL  D  G M++ +    ML GI  MR +I   
Sbjct: 264 KLSAWILTILPFAVALVIHLLNPGFMKVLWEDQTGLMMVSIIGLMMLAGIFWMRQIIKIQ 323

Query: 187 V 187
           V
Sbjct: 324 V 324


>gi|153006802|ref|YP_001381127.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030375|gb|ABS28143.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
          Length = 320

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 105/182 (57%), Gaps = 1/182 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R+ K  +  P AL+++ RS+RAG  ++ A  V+ G+  +PV  EF R  + Q LGLSL 
Sbjct: 139 RRSQKISEQLPEALEMMARSLRAGHALTSAFQVVAGEMPEPVCVEFARSYDEQRLGLSLE 198

Query: 67  ESISRMVRYMPLQ-EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +++  M    P   +V  F+    +Q + GGNL+E L  +S  +R R     K++AL+ E
Sbjct: 199 QAVLHMAERCPGNSDVKIFAVSAVIQRETGGNLAEILEKISDTIRQRYRFYGKLRALTGE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASAW++G LPF V+  V   +PGY+  L  +P GH ++G A     +GI+ +R +   
Sbjct: 259 GRASAWVLGLLPFIVALAVSVMNPGYLRTLAENPSGHWIVGYAIVSWAVGIVWLRRLTQL 318

Query: 186 DV 187
           ++
Sbjct: 319 EI 320


>gi|167836685|ref|ZP_02463568.1| pilus assembly protein, putative [Burkholderia thailandensis
           MSMB43]
          Length = 328

 Score =  130 bits (327), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 114/185 (61%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+A+D++VR+VRAG+PV  A+     +S +PVRS F  + +   +
Sbjct: 141 RMLIVRFRLRFLAVFPDAIDLMVRAVRAGIPVVHAIVTAGVESQEPVRSTFHTIGDGLRV 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L E + +    + + + SFF+  + +Q + GG+L+E L NLS I+R R++++ K +A
Sbjct: 201 GADLKEVLEQACERLQIADFSFFAVCLMLQRETGGSLTETLENLSGIIRARRDVRLKTKA 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E K SA II ++PF +   +Y  +  Y+ +L +   GH +L +AA  + +G++++R 
Sbjct: 261 LTAEGKISAKIIAAVPFAIMGFLYLVNRPYIELLFDTGMGHTMLMLAAVLLTVGLLLIRK 320

Query: 182 MINFD 186
           + N D
Sbjct: 321 IANLD 325


>gi|78186666|ref|YP_374709.1| TadB protein [Chlorobium luteolum DSM 273]
 gi|78166568|gb|ABB23666.1| TadB protein [Chlorobium luteolum DSM 273]
          Length = 322

 Score =  130 bits (327), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 103/176 (58%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F D  P ALD I RS+RAG  ++ A+ ++  +  DP+  EF+ V +    G+   ++I  
Sbjct: 147 FGDKLPEALDYISRSMRAGHSLTSAIGMLGTEFRDPIGHEFKTVFDEIGFGIPFKDAIGE 206

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           +   +   +++FF   + +Q + GGNL+E L  LS  +R R  ++ K++ LS E +ASAW
Sbjct: 207 LADRVQSTDLNFFVISLQIQHETGGNLTELLDGLSNTIRQRIKLRGKIRTLSSEGRASAW 266

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           ++GS+PF +  ++   +PGY++VL   P GH L   A   M +G  +++ ++NF V
Sbjct: 267 VLGSMPFALVAILTLINPGYISVLWTTPEGHKLTLSALGLMSVGFFLLKRIVNFKV 322


>gi|194335918|ref|YP_002017712.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308395|gb|ACF43095.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 332

 Score =  130 bits (327), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 108/182 (59%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R   F D  P ALD I R++RAG  ++ A+ ++  +  DP+  EF+ V +    G+  
Sbjct: 151 KQRRKVFGDKLPEALDYISRAMRAGHSLTSAIGMVGKELPDPIGYEFKTVFDEISFGIPF 210

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++I  +   +   +++FF   + +Q + GGNL+E L  L++ +R+R  ++ KV+ LS E
Sbjct: 211 KDAIGHLADRIQSNDLNFFVISLKIQHETGGNLAELLHGLAKTIRERVKLRGKVRTLSSE 270

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASAWI+G++PF  + ++   +PGY++VL + P+G  L+ +    M +GI V+  ++  
Sbjct: 271 GRASAWILGTMPFVFAGILMLINPGYISVLWSTPQGQNLMFIGCGLMAVGIFVLSRIVQI 330

Query: 186 DV 187
            V
Sbjct: 331 KV 332


>gi|283852077|ref|ZP_06369351.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
 gi|283572467|gb|EFC20453.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
          Length = 327

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 112/181 (61%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A F    P AL+++ R+++AG   S  + ++V + ++P+R EF++ +E  + G+ ++
Sbjct: 147 KRMAAFETQLPEALELVGRALKAGHTFSSGMGMVVSEFAEPIRGEFQKTMEEVNFGMGVT 206

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  ++  +   +++FF   + +Q++ GGNL+E + N++ ++R+R  +K +++ LS E 
Sbjct: 207 VALDNLMERVDCPDLNFFVISVKIQNETGGNLAEIVENIAWLIRERIKLKGRIRVLSAEG 266

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AW++  LPF V   V   +PGY+N+L  +  G   L + A  M +G++V+R M+  D
Sbjct: 267 RMAAWVLCLLPFFVCGAVQMLNPGYLNLLFTEALGRFFLYLVAGLMTLGVLVIRKMVRID 326

Query: 187 V 187
           V
Sbjct: 327 V 327


>gi|303248307|ref|ZP_07334569.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490332|gb|EFL50244.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 326

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 112/181 (61%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +F    P ALD++ R++RAG   +  + ++V + ++P+ SEFR  +E  + G+ ++
Sbjct: 146 KRMTEFERQLPEALDLVGRALRAGHTFTSGMGMVVSEFAEPISSEFRTTLEEINFGMGVT 205

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  ++  +   +++FF   + +Q++ GGNL+E + N++ ++R+R  +K +++ LS E 
Sbjct: 206 VALDNLMDRVDCPDLNFFVISVKIQNETGGNLAEIIGNIASLIRERLKLKGRIRVLSAEG 265

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AW++  LPF V   V   +PGY+ +L  +P G +L+ V    M +G++V+R M+  +
Sbjct: 266 RMAAWVLCLLPFFVCGAVQVLNPGYLGLLFTEPLGRILIYVVMGLMTLGVLVIRKMVRIE 325

Query: 187 V 187
           V
Sbjct: 326 V 326


>gi|221067369|ref|ZP_03543474.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712392|gb|EED67760.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 329

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 112/182 (61%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
            +R        P ALD+I R++RAG   S  + +   + S+P+  EFR V +  + G SL
Sbjct: 148 NQRLGLLERQIPEALDLIARALRAGHAFSAGLQMAGEELSEPIAGEFRLVHDEINYGTSL 207

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AK++ LS E
Sbjct: 208 QQALNNLGERIPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKIRVLSSE 267

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWI+G +PF ++ L+ F +P +M+ L  DP G ++L   A  M+IG++++R ++  
Sbjct: 268 GRMSAWILGLMPFALAALLNFVNPEFMSTLWTDPIGIVILQWLAGLMVIGMLMLRRIVRI 327

Query: 186 DV 187
            V
Sbjct: 328 RV 329


>gi|187927683|ref|YP_001898170.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|187724573|gb|ACD25738.1| type II secretion system protein [Ralstonia pickettii 12J]
          Length = 325

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 110/182 (60%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  K     P+A+D+I R++RAG   + A+ ++  +  +P+  EF    E  + G+SL
Sbjct: 144 RKRLKKLEAQLPDAVDMIARALRAGHSFASALGMVGQEIKEPMGPEFHTTFEEINYGVSL 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E+++ + + +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ LS E
Sbjct: 204 DEALTNLAKRVPVNDLRYFVIAVLIQRESGGNLAEILDTIGNLVRERLKLYDKIRVLSAE 263

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWI+G LPFC + ++   +P +M VL  DP G  ++G+A   M++G++ MR +I  
Sbjct: 264 GRLSAWILGLLPFCTAGMILLVNPDFMKVLWTDPMGLKMIGLALFNMVMGLIWMRKIIRI 323

Query: 186 DV 187
            V
Sbjct: 324 RV 325


>gi|209545601|ref|YP_002277830.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533278|gb|ACI53215.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 317

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 111/180 (61%), Gaps = 2/180 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLS 64
           ++  AK     P+AL +IVRS+R G+P+S A+ +IVGQ ++ P   EFR + +   +G S
Sbjct: 135 RRYAAKLFQQLPDALGMIVRSLRVGIPLSRAL-IIVGQEAEYPTADEFRMISQDVAVGKS 193

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +     LQE  FF+T++++Q+Q GG L++ LA+ + ++R R   + +  AL+ 
Sbjct: 194 LGDTLHNLAERTGLQEYRFFATIMALQAQTGGTLADVLASFADMIRQRIAARKRGHALAS 253

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           EA+ S +++G +PF +  ++   +P YM V +    GHMLLGV+A  + +G   MR ++ 
Sbjct: 254 EARMSCYVLGGIPFAIGGIMSIINPDYMAVFLTTHMGHMLLGVSALMLGLGFGSMRFIMK 313


>gi|239814536|ref|YP_002943446.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801113|gb|ACS18180.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 330

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 110/187 (58%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H   +R A      P+ALD++ R++RAG   + +V +I  + S+P+  EFR V +   
Sbjct: 144 LNHRRSRRLAHLERQLPDALDLVTRALRAGHSFASSVQMIGDEMSEPIAGEFRMVADEVG 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL ++++ M   +PL ++ +F   + +Q   GGNL+E L NLSR++RDR  + A+V+
Sbjct: 204 FGVSLQQALTNMSERVPLTDLRYFVVSVLIQRDSGGNLTEVLGNLSRLIRDRLKLLARVR 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G +PF +  L+   +P +M+ L  DP G   +      M+IG +++R
Sbjct: 264 VLSAEGRLSAWILGLMPFALVALLNAFNPEFMSPLWTDPIGITAVKYMLGLMVIGAVILR 323

Query: 181 LMINFDV 187
            ++   V
Sbjct: 324 KIVKIRV 330


>gi|167589558|ref|ZP_02381946.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 235

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 116/177 (65%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +G 
Sbjct: 50  LIRRFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRVGA 109

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +AL+
Sbjct: 110 DLKDVLTQAADRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRSRRDIRLKSRALT 169

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            E + +  II ++PF +   ++  +  Y+ +L     GH +L +AAA ++IG++V+R
Sbjct: 170 AEGRITTNIISAVPFVMIGALFLVNRPYIMLLFTTHAGHTMLTIAAALLVIGLLVIR 226


>gi|302343415|ref|YP_003807944.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301640028|gb|ADK85350.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 322

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 114/181 (62%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR + F   FP A++++ R++RAG   S  + ++  +  +PV SEF +  E    G ++ 
Sbjct: 142 KRLSVFESQFPEAVELVGRALRAGHSFSAGLRMVGEELGEPVASEFNKTFEDYSFGKTME 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E+++ +VR + L++V FF++ +S+Q + GGNL+E L N++ I+R+R  ++  V+ALS E 
Sbjct: 202 EALTGLVRRVELEDVKFFASAVSLQRETGGNLTEILDNIAYIIRERFRLQRTVRALSAEG 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + S WI+  +P  +  ++Y+++P Y+N+ + +P G  +L   A   ++GI+V++ +I   
Sbjct: 262 RLSGWILSLMPPALFAMLYWSTPEYINMALGNPIGQTILLSGACLEVLGIVVIKQIIKMR 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|162147494|ref|YP_001601955.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786071|emb|CAP55653.1| putative type II secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 319

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 111/180 (61%), Gaps = 2/180 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLS 64
           ++  AK     P+AL +IVRS+R G+P+S A+ +IVGQ ++ P   EFR + +   +G +
Sbjct: 137 RRYAAKLFQQLPDALGMIVRSLRVGIPLSRAL-IIVGQEAEYPTADEFRMISQDVAVGKN 195

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +     LQE  FF+T++++Q+Q GG L++ LA+ + ++R R   + +  AL+ 
Sbjct: 196 LGDTLHNLAERTGLQEYRFFATIMALQAQTGGTLADVLASFADMIRQRIAARKRGHALAS 255

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           EA+ S +++G +PF +  ++   +P YM V +    GHMLLGV+A  + +G   MR ++ 
Sbjct: 256 EARMSCYVLGGIPFAIGGIMSIINPDYMAVFLTTHMGHMLLGVSALMLGLGFGSMRFIMK 315


>gi|322434107|ref|YP_004216319.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161834|gb|ADW67539.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 320

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 110/180 (61%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF +  P+A+D++ R++RAG  +S A+ V+  +S++P+  EF  V + Q  GL   +
Sbjct: 141 RLGKFEEALPDAIDLMARALRAGHAMSSAIEVVAEESAEPLAGEFAIVFQQQKFGLQFRD 200

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ ++   +P +++SF  T I VQ + GG+L++ L   +R++R+R  ++ +++  + + +
Sbjct: 201 ALLQLGDRVPSKDLSFLITAILVQKETGGDLTDVLDRTTRVIRERIRIQGEIRTYTAQGR 260

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            + WI+ +LP  +  L+   +PGY ++L +DP G +LLG     +LIG  ++  +++  V
Sbjct: 261 LTGWILSALPVVMLCLINVATPGYSHILFHDPTGQLLLGAGGVLILIGGFIISRVVDIKV 320


>gi|194288829|ref|YP_002004736.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222664|emb|CAQ68667.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 325

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL  KR  +     P+A+D+I R++RAG   S A++++  +   P+  EFR   E  + G
Sbjct: 141 HLRAKRLKQLEAQLPDAVDMISRALRAGHSFSGALSMVGQEMKAPIGPEFRTTFEEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ L
Sbjct: 201 VALDEAMTNLAMRVPVADLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SAW++G LPF  + ++   +PG+MNVL  DP G  ++G A   M  G++ MR +
Sbjct: 261 SAEGKLSAWVLGLLPFGTAGMILVINPGFMNVLWEDPLGLRMIGGALVSMTFGVLWMRKI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|91788418|ref|YP_549370.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697643|gb|ABE44472.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 325

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 107/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +     P+ALD++ R++RAG     A+ ++  + +DP+  EFR   +  + G+++
Sbjct: 144 RKRLDRIEHQLPDALDLMGRALRAGHAFPTALKMVGDEMNDPLAGEFRIAFDEVNFGIAM 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  M   +P  ++ +F   + +Q + GGNLSE L ++S I+RDR  +  +V+ LS E
Sbjct: 204 PDALMNMATRVPSTDLRYFVIAVLIQRETGGNLSELLTSISAIIRDRIKLMGQVRVLSAE 263

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            K SAW++  LPF  + ++  T+P ++ VL  DP G  +L  A   M +GI+VMR +I  
Sbjct: 264 GKMSAWVLSLLPFGAAFMIQLTNPKFLEVLYTDPAGRKMLAAAIVMMALGILVMRKIIRI 323

Query: 186 DV 187
            V
Sbjct: 324 RV 325


>gi|87312289|ref|ZP_01094387.1| secretion system protein TadB [Blastopirellula marina DSM 3645]
 gi|87284993|gb|EAQ76929.1| secretion system protein TadB [Blastopirellula marina DSM 3645]
          Length = 320

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 107/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R AKF    P+AL++I R++RAG  +     ++  +S DP+  EF +V E Q+LG+SL
Sbjct: 139 KARLAKFGKQLPDALELISRALRAGHSLGAGFRLVSEESDDPIGREFAKVFEAQNLGVSL 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++I+ M   +P  ++ FF T I +Q Q GG+L+E L  + R++R R  +   +QAL+ E
Sbjct: 199 EDAITDMTERVPNLDLKFFGTAIILQRQTGGDLAEILDKIGRLVRQRLELFGTIQALTGE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  ++  LP  +   ++  +PGY+  L  DP G+ +L VA    LIG  V++ +I+ 
Sbjct: 259 GRISGIVLLGLPPALFVALWRLNPGYVMTLFTDPLGNKMLAVAIVMQLIGAWVIQKIIDI 318

Query: 186 DV 187
            V
Sbjct: 319 KV 320


>gi|299532600|ref|ZP_07045989.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719403|gb|EFI60371.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 329

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 110/174 (63%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +     P ALD+I R++RAG   S ++ +   + ++P+  EFR V +  + G SL 
Sbjct: 149 QRLKRMERQLPEALDLIARALRAGHAFSASLQMAGEELTEPIAGEFRLVHDEINYGTSLH 208

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AKV+ LS + 
Sbjct: 209 QALTNLGERVPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKVRVLSADG 268

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           + SAWI+G +PF ++ L+   +P +M+ L  DP G  +L   AA M+IG++++R
Sbjct: 269 RMSAWILGLMPFGLAALLNLMNPEFMHPLWTDPIGISILKWLAALMVIGLLLLR 322


>gi|260462612|ref|ZP_05810818.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031518|gb|EEW32788.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 324

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 108/181 (59%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
            KR  KF    P+ALD+IVRS+RAG P + A+ ++  +  DP+ +EF  V +    GLSL
Sbjct: 143 NKRIQKFAAQLPDALDMIVRSLRAGHPTTVAIGLVAREMPDPLGTEFGIVSDEITFGLSL 202

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ ++ + +  + +   S  +S+Q++ GGNL+E LANLS +LR+R+ ++ K++ALS E
Sbjct: 203 EQAVRKLSQRVGFEGLHLLSVSLSIQAKTGGNLTEILANLSSVLRERRKLRMKIKALSAE 262

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWII   P  +  ++   +P +   + + P    +  +   + L+G  +M  M+NF
Sbjct: 263 GRMSAWIISLFPVVMFGILLLVAPKFYGEVWDSPLILPVFVIFGLWALLGDFIMYRMVNF 322

Query: 186 D 186
           D
Sbjct: 323 D 323


>gi|73542333|ref|YP_296853.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119746|gb|AAZ62009.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 325

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 106/181 (58%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +     P+A+D+I R++RAG   S A+ ++  +   P+  EFR   E  + G++L 
Sbjct: 145 KRIQQMESQLPDAVDMIARALRAGHSFSGALGMVGQEMKAPIAPEFRTTFEEINYGIALD 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  + AK++ LS E 
Sbjct: 205 EAMTNLAIRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGNMVRERLKLFAKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAW++G LPF    ++   +P +M VL  DP G  ++G A   M++G++ MR +I   
Sbjct: 265 RMSAWVLGLLPFATGGMILVVNPDFMKVLWEDPIGLKMVGAAVGMMMLGVLWMRKIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|170704075|ref|ZP_02894707.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170131017|gb|EDS99712.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 325

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRVTTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|319782177|ref|YP_004141653.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168065|gb|ADV11603.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 322

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 107/181 (59%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
            KR  KF    P+ALD+IVRS+RAG P S A+ ++  +  DP+ +EF  V +    GLS+
Sbjct: 141 NKRIRKFAKQLPDALDMIVRSLRAGHPASVAIGLVAREMPDPLGTEFGIVSDEITFGLSI 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ ++ + +  + +   S  +S+QS+ GGNL+E LANLS ++R+R+ ++ K++ALS E
Sbjct: 201 EQAVRKLSQRVGFEGLQLLSVSLSIQSKTGGNLTEILANLSSVMRERQKLRMKIRALSAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWII   P  +   +   +P Y   + ++P    +  +   + L+G  +M  M+ F
Sbjct: 261 GRVSAWIISLFPIVMFFTLQILAPTYYGAVWSNPLVFPVFLIFGLWALLGDFIMYRMVTF 320

Query: 186 D 186
           D
Sbjct: 321 D 321


>gi|330811032|ref|YP_004355494.1| type II secretion system protein; membrane protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379140|gb|AEA70490.1| putative type II secretion system protein; putative membrane
           protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 328

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A F +  P+ALD + R++RAG P ++ + ++  +   PV  EF       + G  + 
Sbjct: 148 KRFAAFEEGLPDALDAMCRALRAGHPFNETLRLVAEEHKGPVAQEFGMTFSDINYGNDVR 207

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  ++  MP   V    T I +  + GGNL+E L  LSR++R R   + K++ LS E 
Sbjct: 208 RAMLGLLERMPSMTVMMLVTSILIHRETGGNLTEVLERLSRLIRGRFRFQRKIRTLSAEG 267

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAW++ ++PF ++  +  TSP YM VLINDP GH L+  A   MLIGI  ++ +I   
Sbjct: 268 RMSAWVLVAIPFVLAIAIVLTSPSYMPVLINDPIGHKLIIGAFCAMLIGIFWIKKIIRIQ 327

Query: 187 V 187
           V
Sbjct: 328 V 328


>gi|13475421|ref|NP_106985.1| hypothetical protein mlr6484 [Mesorhizobium loti MAFF303099]
 gi|14026173|dbj|BAB52771.1| mlr6484 [Mesorhizobium loti MAFF303099]
          Length = 323

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 109/180 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  KF    P+ALD+IVRS+RAG P + A+A++  +  DP+ +EF  V +    GLSL 
Sbjct: 143 KRIKKFAVQLPDALDMIVRSLRAGHPTTVAIALVAREMPDPLGTEFGIVSDEISFGLSLE 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++ ++   +  + +   S  +S+Q++ GGNL+E L+NLS +LR+R+ ++ K++ALS E 
Sbjct: 203 QAVRKLSERVGFEGLHLLSVSLSIQAKTGGNLTEILSNLSSVLRERRKLRMKIRALSAEG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWII   P  +  ++   +P +   +  +P    +  +  ++ L+G  +M  M+NFD
Sbjct: 263 RMSAWIISLFPLLMLGVLSIAAPSFYGDVWGNPIVVPVFVIFGSWALLGDFIMYRMVNFD 322


>gi|115358175|ref|YP_775313.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115283463|gb|ABI88979.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 325

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|172062963|ref|YP_001810614.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171995480|gb|ACB66398.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 325

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|264678229|ref|YP_003278136.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262208742|gb|ACY32840.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 329

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 108/173 (62%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P ALD+I R++RAG   S ++ +   + ++P+  EFR V +  + G SL +
Sbjct: 150 RLKRMERQLPEALDLIARALRAGHAFSASLQMAGEELTEPIADEFRLVHDEINYGTSLQQ 209

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AKV+ LS + +
Sbjct: 210 ALTNLGERVPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKVRVLSADGR 269

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            SAW +G +PF ++ L+   +P +M+ L  DP G  +L   AA M+IG++++R
Sbjct: 270 MSAWFLGLMPFGLAALLNLMNPEFMHPLWTDPIGITILKWLAALMVIGLLLLR 322


>gi|296156493|ref|ZP_06839331.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893092|gb|EFG72872.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 325

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 104/173 (60%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P+A D+I R++RAG      + ++  +  DP+  EF  V +  + G+S+++++  MV 
Sbjct: 153 QLPDAADLIARALRAGHSFPATLGMVGQELPDPLGGEFALVFDEINYGVSMNDALLNMVS 212

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P++++ +F   + +Q + GGNL+E L ++S I+R+R  +  KV+ LS E + SAW++ 
Sbjct: 213 RVPVEDLRYFVIAVLIQREAGGNLAEILGSISGIIRERLKLLGKVRVLSAEGRLSAWVLA 272

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            LPF +  L+   +PGY++V   DP G  L GVA   ML GI+ MR ++   +
Sbjct: 273 VLPFAILGLLTVLNPGYISVFWKDPAGVQLAGVAITMMLFGILWMRKIVRIHI 325


>gi|78186532|ref|YP_374575.1| TadB protein [Chlorobium luteolum DSM 273]
 gi|78166434|gb|ABB23532.1| TadB protein [Chlorobium luteolum DSM 273]
          Length = 322

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 107/185 (57%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L  +R   F D  P ALD I R++RAG  ++ A+ ++  +  +P+  EF+ V +    G
Sbjct: 138 QLADRRLRAFEDKLPEALDHISRALRAGHSLAPAMGMVGQEFGEPIGYEFKIVFDEIGFG 197

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +   E+I R+   M   +++FF   +++Q + GGNL+E    L+R +R R  ++ K++ L
Sbjct: 198 IPFKEAIGRLAERMQSTDLNFFVISLTIQHETGGNLTELFDGLARTIRHRIKLRGKIRTL 257

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +AS W++GS+PF +  ++   +P Y+++L    RG+ L+ + A  M +G +V++ +
Sbjct: 258 SSEGRASGWVLGSMPFVLMMVLSLINPEYISLLWTTSRGNNLMLIGAGLMSVGFVVLKRI 317

Query: 183 INFDV 187
           +   V
Sbjct: 318 VQIKV 322


>gi|171320622|ref|ZP_02909642.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171094135|gb|EDT39222.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 325

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + ++     + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GADLKDVLTHASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|295700366|ref|YP_003608259.1| type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
 gi|295439579|gb|ADG18748.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
          Length = 325

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 107/173 (61%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P+  D++ R++R+G   + A+ ++  + ++P+  EFR V +  + G+S+SE+++ +  
Sbjct: 153 QLPDVCDMLSRALRSGHAFTGAIDMVGAEFTEPMSGEFRIVFDEINYGVSISEALTNLAT 212

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P++++ +F   + +Q + GGNL+E L  ++ ++RDR  +  KV+ LS E + SAW++G
Sbjct: 213 RVPIRDLRYFVIAVVIQRETGGNLAEVLDGITALIRDRFKLFDKVRVLSAEGRMSAWVLG 272

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            LPF V   +   +PG++NVL  DP G  ++  A+  ML GI+ MR ++   V
Sbjct: 273 LLPFGVGGAMMAINPGFLNVLWRDPAGVRMIAAASVAMLFGILWMRHIVKIRV 325


>gi|145219379|ref|YP_001130088.1| type II secretion system protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205543|gb|ABP36586.1| type II secretion system protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 322

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 106/184 (57%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  +R   F D  P ALD I R++RAG  ++ A+ ++  +  DP+  EF+ V +    G+
Sbjct: 139 LADRRRRAFEDKLPEALDHISRALRAGHSLAPAMGMVGQEFGDPIGYEFKIVFDEIGFGI 198

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              E+I R+   +   +++FF   +++Q + GGNL+E    L+R +R R  ++ K++ LS
Sbjct: 199 PFKEAIGRLAERVQSNDLNFFVISLTIQHETGGNLTELFDGLARTIRHRIKLRGKIRILS 258

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E +AS W++GS+PF +  ++   +P Y+  L   P+G+ ++ + A  M +G +V++ ++
Sbjct: 259 SEGRASGWVLGSMPFVLMAVLSLINPEYIAQLWTTPQGNTMMMIGAGLMSVGFVVLKRIV 318

Query: 184 NFDV 187
              V
Sbjct: 319 QIKV 322


>gi|78062902|ref|YP_372810.1| type II secretion system protein [Burkholderia sp. 383]
 gi|77970787|gb|ABB12166.1| type II secretion system protein [Burkholderia sp. 383]
          Length = 325

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 119/185 (64%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++++   +++PVR+ FR + ++  +
Sbjct: 138 RALVERFRIRFLEAFPDAIDVIVRAVRAGIPVTQAISMVGDGAAEPVRATFRSMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GADLKDVLTQAADRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   G+ +L +AA  + +G++V+R 
Sbjct: 258 LTAEGRITTNIISAVPFVMIGALFLVNRDYVMLLFSTHPGNTMLTIAAGLLTVGLLVIRK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|186474107|ref|YP_001861449.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184196439|gb|ACC74403.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 326

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +     P+A D+I R++RAG     A+ ++  +   P+  EFR   +  + G+S++
Sbjct: 146 KRVVQLERLLPDAADLIARALRAGHSFPAALGMVADELPQPLGGEFRIAFDEINCGVSMN 205

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +V  +P+ +V +F   + +Q + GGNL+E L N++ I+R+R  + AKV+ LS E 
Sbjct: 206 DALMNLVSRVPVDDVRYFVIAVLIQREAGGNLAEILGNIATIIRERLKLLAKVRVLSAEG 265

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF V   +   +PGY  V   D  G  + GVA + M +G++ +R  +   
Sbjct: 266 RLSAWILGLLPFIVIAALSVLNPGYCKVFWEDETGQKIAGVALSMMALGVLWLRKTVRIR 325

Query: 187 V 187
           V
Sbjct: 326 V 326


>gi|94309585|ref|YP_582795.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353437|gb|ABF07526.1| flp pilus assembly protein TadB [Cupriavidus metallidurans CH34]
          Length = 325

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 110/188 (58%), Gaps = 3/188 (1%)

Query: 3   HLIKKRTAKFLD---DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ 59
           H+++ RT +        P+A+D+I R++RAG   + A+ ++  +   P+  EFR   E  
Sbjct: 138 HVMRLRTKRLKQMEVQLPDAVDMISRALRAGHSFAGALGMVGQEIKAPLGPEFRTTFEEI 197

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
           + G++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K+
Sbjct: 198 NYGVALDEAMTNLAMRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKI 257

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + LS E + SAWI+G LPF  + L+   +PG+M VL  DP G  ++G A   M+ G++ M
Sbjct: 258 RVLSAEGRLSAWILGLLPFGTAGLIMVVNPGFMRVLWEDPIGWRMVGAAMTSMIFGVLWM 317

Query: 180 RLMINFDV 187
           R +I   V
Sbjct: 318 RKIIRIRV 325


>gi|254182576|ref|ZP_04889170.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|184213111|gb|EDU10154.1| type II secretion system protein [Burkholderia pseudomallei 1655]
          Length = 330

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 109/181 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+SL 
Sbjct: 150 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVSLQ 209

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ LS E 
Sbjct: 210 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVLSAEG 269

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +I   
Sbjct: 270 KLSALILTLLPFATAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHIIRIR 329

Query: 187 V 187
           V
Sbjct: 330 V 330


>gi|134281818|ref|ZP_01768525.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|167908137|ref|ZP_02495342.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei NCTC
           13177]
 gi|134246880|gb|EBA46967.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 325

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 109/181 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+SL 
Sbjct: 145 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVSLQ 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ LS E 
Sbjct: 205 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +I   
Sbjct: 265 KLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGMLLVGVTIASMAFGILWMRHIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|317154601|ref|YP_004122649.1| type II secretion system F domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944852|gb|ADU63903.1| Type II secretion system F domain protein [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 324

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 115/187 (61%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  +F    P ALD++ R+++AG      + ++  + +DP+  EF + ++  +
Sbjct: 138 LRRLKARRMGRFQAQLPEALDLMSRALKAGHTFGGGMRMVANEFADPIGGEFGKTLDEIN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ +   + ++++ FF   +++Q + GGNL+E +AN++R++R+R  +  KV+
Sbjct: 198 YGMDVDRALANLQLRVDVEDLKFFVVSVNIQRETGGNLAEIIANIARLVRERFALFGKVR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SA ++ +LPF ++ ++YF +P Y+++L  +  G  +   A A M++GI+VMR
Sbjct: 258 VLSAEGRISALLLSALPFFIAGVLYFINPDYISLLWTNELGRSMAWGAVASMIVGIVVMR 317

Query: 181 LMINFDV 187
            M+   V
Sbjct: 318 RMVKIQV 324


>gi|116623252|ref|YP_825408.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226414|gb|ABJ85123.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 321

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 109/182 (59%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           + R A F D FP+ L+ + RS+RAG   S A+ +   + SDP+  E RR  E Q+LG  L
Sbjct: 140 RMRVAAFEDQFPDCLEFVSRSMRAGHAFSVAIEMAHREFSDPLAGELRRAFEEQNLGQPL 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
              + ++ + +P  +V FF + + +Q + GGNL+E L  L++++R+R  ++A+++A+S +
Sbjct: 200 EIVLRKLSQRVPSMDVQFFVSAVLLQKRTGGNLAELLDKLAQLMRERFKLRARIRAVSAQ 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              S  I+ ++P  V+ +++  +P Y    I+DP GH L+       L+G +++R ++ F
Sbjct: 260 GLMSGRILSAIPAGVAVMMFLVNPKYARFFIDDPVGHELMAAGLGLQLLGYLIIRKIVTF 319

Query: 186 DV 187
           DV
Sbjct: 320 DV 321


>gi|217424158|ref|ZP_03455657.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|254192376|ref|ZP_04898815.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|169649134|gb|EDS81827.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|217392623|gb|EEC32646.1| type II secretion system protein [Burkholderia pseudomallei 576]
          Length = 330

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 109/181 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+SL 
Sbjct: 150 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVSLQ 209

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ LS E 
Sbjct: 210 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVLSAEG 269

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +I   
Sbjct: 270 KLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHIIRIR 329

Query: 187 V 187
           V
Sbjct: 330 V 330


>gi|82703470|ref|YP_413036.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411535|gb|ABB75644.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 323

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  K     P  +D++ R+++AG   S A+ +      +P   EFR   +  + G+S+
Sbjct: 142 RKRLEKIERQLPEVIDLMARALKAGHAFSGALQMASTDGPEPAADEFRLTFDEINFGVSV 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P+ ++ +F   + +Q + GGNL+E L  +S ++R R  +  K++ LS E
Sbjct: 202 QDALMNLATRVPITDLRYFVIAVLIQRESGGNLAELLDKISGLIRARLTLLGKIRVLSAE 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWI+  LPF  + ++   +PG++ VL  DP G M++G A   M+IGI VM  +I  
Sbjct: 262 GRLSAWILSCLPFATALMINLVNPGFLTVLWTDPIGVMMVGTALGMMVIGIFVMSRIIKI 321

Query: 186 DV 187
            V
Sbjct: 322 RV 323


>gi|53723214|ref|YP_112199.1| hypothetical protein BPSS2197 [Burkholderia pseudomallei K96243]
 gi|126444529|ref|YP_001064083.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126455490|ref|YP_001076996.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167725255|ref|ZP_02408491.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei DM98]
 gi|167744182|ref|ZP_02416956.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 14]
 gi|167821381|ref|ZP_02453061.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 91]
 gi|167829723|ref|ZP_02461194.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 9]
 gi|226194129|ref|ZP_03789729.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237509857|ref|ZP_04522572.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|242313100|ref|ZP_04812117.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|52213628|emb|CAH39682.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|126224020|gb|ABN87525.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126229258|gb|ABN92671.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|225933822|gb|EEH29809.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002062|gb|EEP51486.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|242136339|gb|EES22742.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
          Length = 325

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 109/181 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+SL 
Sbjct: 145 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVSLQ 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ LS E 
Sbjct: 205 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +I   
Sbjct: 265 KLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|89899610|ref|YP_522081.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89344347|gb|ABD68550.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 322

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 106/173 (61%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
            FP ALD++ R++RAG     AV ++  + +DP+  +FR + +  + G+  +++++ +  
Sbjct: 150 QFPEALDLMSRAMRAGHSFPSAVKMVADEMTDPLGHDFRVLFDEMNYGVPTNDALANLAE 209

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P+ +VS+F   + +Q + GGNL+E L  +S I+R+R  +  +V+ LS E K SA I+ 
Sbjct: 210 RVPVPDVSYFVVAVMIQRESGGNLAELLDKISLIVRERLKLLGEVRTLSAEGKLSAIILT 269

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           +LPF V  +V   +P +M VL  DP G  ++G+A   ML+GI+ MR +I   V
Sbjct: 270 ALPFGVGLVVNLVNPKFMAVLWTDPAGLRMVGLALFMMLLGILWMRSIIRIRV 322


>gi|76818607|ref|YP_336474.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 1710b]
 gi|167851190|ref|ZP_02476698.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei B7210]
 gi|167899820|ref|ZP_02487221.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 7894]
 gi|167916484|ref|ZP_02503575.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 112]
 gi|167924341|ref|ZP_02511432.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei BCC215]
 gi|254187128|ref|ZP_04893643.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254263188|ref|ZP_04954053.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|254296490|ref|ZP_04963946.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|76583080|gb|ABA52554.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 1710b]
 gi|157806462|gb|EDO83632.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934811|gb|EDO90481.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254214190|gb|EET03575.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 325

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 109/181 (60%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+SL 
Sbjct: 145 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVSLQ 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ LS E 
Sbjct: 205 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +I   
Sbjct: 265 KLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|260776711|ref|ZP_05885606.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607934|gb|EEX34199.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 322

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 101/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R + F    P ALDI+ R ++AG PV+ A + +  +   P+  EF+      + G  
Sbjct: 140 ISDRLSAFEGQLPEALDIMRRMLQAGQPVTQAFSEVGEEMPAPIGVEFKNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++ LS 
Sbjct: 200 MRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRARFKLQRKIKTLSA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   + F +PGY+  L  DPRG  L+      + IG + +R +IN
Sbjct: 260 ESRLSAWILVLSPFVLFLFLSFVNPGYVEPLYTDPRGMKLISGGVVSLFIGSLWIRKIIN 319

Query: 185 FDV 187
           F+V
Sbjct: 320 FEV 322


>gi|253701803|ref|YP_003022992.1| type II secretion system protein [Geobacter sp. M21]
 gi|251776653|gb|ACT19234.1| type II secretion system protein [Geobacter sp. M21]
          Length = 320

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 105/182 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++RT +F + FP+AL I  RS+RAG     A+ ++  ++  PV   FR   E Q LGL +
Sbjct: 139 ERRTTRFTEQFPDALSIAARSLRAGHSFPTAIQLVGQEAPSPVGPLFRTAYEQQQLGLRM 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ RM   +   ++ FF+T++++ S +GGNLSE L  L+  +R+R  ++ +VQ  + +
Sbjct: 199 VDALMRMNERIDSLDLRFFTTLVAINSDIGGNLSELLDKLAMTIRERLKIRRQVQVYTAQ 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S +++ +LP     +     P Y   LIN+P G  +L  AAA  ++G +V+R ++  
Sbjct: 259 GRLSGYVLAALPIATFGIFSMLHPNYERALINEPLGLYVLIGAAAMQIVGFLVIRKIVRI 318

Query: 186 DV 187
            +
Sbjct: 319 RI 320


>gi|167566942|ref|ZP_02359858.1| Flp pilus assembly protein TadB [Burkholderia oklahomensis EO147]
 gi|167574011|ref|ZP_02366885.1| Flp pilus assembly protein TadB [Burkholderia oklahomensis C6786]
          Length = 325

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 104/177 (58%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+ L E++ 
Sbjct: 149 KLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVPLQEALL 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  KV+ LS E K SA
Sbjct: 209 NLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKVRVLSAEGKLSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+  LPF  + L+   +P ++ VL  DP G +L+GV    M  GI+ MR +I   V
Sbjct: 269 WILTLLPFGTAALLAIMNPDFIAVLWQDPAGVLLVGVTITSMAFGIVWMRYIIRIRV 325


>gi|193213110|ref|YP_001999063.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
 gi|193086587|gb|ACF11863.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
          Length = 322

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 100/171 (58%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F +  P ALD + RS+RAG  ++ A+ ++  +   P+  EF+ V +    G+   
Sbjct: 142 KRRQAFSEKLPEALDYVTRSLRAGHSLTSAIGIVGKEFPGPIGQEFKIVFDEISFGIPFK 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++ R+   +   +++FF   + +Q + GGNL+E L  L++ +R+R  ++ KV+ LS E 
Sbjct: 202 EAMDRLADRVESVDLNFFVISLEIQHETGGNLTELLEGLAKTIRERFKLRGKVRTLSAEG 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           + SA ++GS+PF ++ ++   +P Y +VL + P+GH L+ V A  M +G  
Sbjct: 262 RISALVLGSMPFILTAILTVINPEYTSVLWSTPQGHTLIMVMAVLMALGFF 312


>gi|114797844|ref|YP_759873.1| putative Flp pilus assembly protein TadB [Hyphomonas neptunium ATCC
           15444]
 gi|114738018|gb|ABI76143.1| putative Flp pilus assembly protein TadB [Hyphomonas neptunium ATCC
           15444]
          Length = 316

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL   R  K     P+AL I+ RS+ AG PV+ AV+++  +  DP+ +EF    +   
Sbjct: 130 IRHLAGARAKKLAAQLPDALQIVCRSLEAGHPVATAVSLVAREMPDPIGTEFGMTADEVS 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL+ ++ RM       +V  F+  + +Q + GGNL+E L + +  +R+R+ M+ KV+
Sbjct: 190 YGMSLTNAVQRMAERAGDPDVELFAATVRLQEKTGGNLTELLKSNTNTIRERQTMRLKVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S E + SA I+ S PF V T ++   P +   +I++P           +M IG +VM 
Sbjct: 250 AASSEGRVSAMILTSAPFIVMTAIHLLRPEFYGSVIHEPLIQYSFAGLLVWMGIGNLVMN 309

Query: 181 LMINFDV 187
            MINF +
Sbjct: 310 RMINFKM 316


>gi|113866737|ref|YP_725226.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113525513|emb|CAJ91858.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 325

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +      +A+D+I R++RAG   S A+ ++  +   P+  EFR   E  + G++L 
Sbjct: 145 KRIKRMEAQLADAVDMISRALRAGHSFSGALGMVGQEMKAPIGPEFRTTFEEINYGVALD 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ LS E 
Sbjct: 205 EAMTNLAIRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SAW++G LPF  + L+   +PG+M VL  DP G  ++G A   M  G++ MR +I   
Sbjct: 265 KMSAWVLGLLPFGTAGLILVVNPGFMKVLWEDPIGLRMIGGALVSMTFGVLWMRKIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|220922535|ref|YP_002497837.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947142|gb|ACL57534.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 314

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M +L ++R A F +  P  L+I+VRS+RAG P+  A  +   Q  DP  SE     +   
Sbjct: 128 MYYLRRRRVAAFGEQLPELLEIMVRSLRAGHPLVVAFTLAAKQMPDPAGSEIGITADEIG 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  ++  + R +  +++ FF+T +++Q+Q GGNL+E LA L+ +LR+R  ++ +V+
Sbjct: 188 YGRDVGAALYNLYRRVGFEDLRFFATAVTIQAQTGGNLAEILARLATLLRERARLRQRVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA  +   PF ++ L+   +P Y   +  +P   + L VA   ++IG +V+ 
Sbjct: 248 ALSAEGRLSALALSLFPFLLAGLITLLNPDYYGSVWGNPLFDLALTVAGGMLIIGNIVLY 307

Query: 181 LMINFDV 187
            ++NF +
Sbjct: 308 RIVNFRI 314


>gi|116748936|ref|YP_845623.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698000|gb|ABK17188.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 321

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 110/182 (60%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KF    P ALD++ R+++AG   S  + ++  +  DP+  EF + ++  + G+S+
Sbjct: 140 KQRMEKFQRQLPEALDLVSRALKAGHAFSGGMKMVADEMDDPIGPEFDKTLDEINFGVSV 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++  +   +   ++S+F   + +Q + GGNL++ +A+++ ++R+R  +  +++ LS E
Sbjct: 200 ADALKNLAARVACPDLSYFVVAVLIQRESGGNLADLIASITHLIRERFKLYGRIRVLSAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASA I+ ++P  V+  +   S  Y+  L +D  G +L+G+A   M+ G++VMR MI  
Sbjct: 260 GRASAIILIAIPIFVAAALLVVSRSYITTLADDRIGRVLIGIAVCMMIFGVVVMRKMIRI 319

Query: 186 DV 187
           DV
Sbjct: 320 DV 321


>gi|121607250|ref|YP_995057.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121551890|gb|ABM56039.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 290

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 106/186 (56%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + + K+R  KF +  P+AL ++   +RAGL +S A+A +V +S  P+  EF  ++  Q L
Sbjct: 105 RQMRKRRLRKFEEQLPDALMMLSGGLRAGLGLSSAMAQLVAESGPPLSQEFSLMLREQRL 164

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G++L +++S +   MP Q     ++ + + ++ GG L+E L   S  +R R  M+AK+ A
Sbjct: 165 GVTLEQALSNLNHRMPTQTTVLITSAMRIANETGGGLAETLERTSATIRSRLRMQAKIGA 224

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K  AW++G+LP  +  ++    P  M++L +   G   L V A F  +G+ V+R 
Sbjct: 225 LTAQGKLQAWVVGALPIALMLILNEMEPQAMSMLWHTRVGWATLAVIALFEFLGVYVIRK 284

Query: 182 MINFDV 187
           +I  DV
Sbjct: 285 IIAIDV 290


>gi|302037433|ref|YP_003797755.1| pilus assembly protein TadB [Candidatus Nitrospira defluvii]
 gi|300605497|emb|CBK41830.1| Pilus assembly protein TadB [Candidatus Nitrospira defluvii]
          Length = 313

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 104/177 (58%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R A F    P+ALD++ RS+RAG      + ++  +   P+ +EFR V+E    G+S++E
Sbjct: 134 RRAHFQRQLPDALDMMARSLRAGHAFLAGMKIVAEEFPAPIGAEFRSVVEEVAFGVSVTE 193

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++ R+   +    ++FF T + +Q + GGNL+E L  +SR+ R R  + AKV+A+S E +
Sbjct: 194 ALQRLTARVDSPALNFFVTSVLIQRESGGNLAEILNTISRMTRKRFELAAKVRAVSAEGR 253

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            SA I+ +LPF +  L+   +P Y+ +L  DP G  ++ V    MLIG +V + M+ 
Sbjct: 254 LSAVILFALPFALGGLLLIINPDYVLLLFRDPIGRAMVTVGGVLMLIGGVVTKRMVT 310


>gi|87199541|ref|YP_496798.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135222|gb|ABD25964.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 328

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 106/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +    F  A+DI  R++RAG PV+ A++++  + +DP+ +EF  V +    G +L
Sbjct: 147 EKRRKRMEQQFAPAVDIFTRALRAGHPVASAISLLSTEMADPIGTEFGLVADEIAYGANL 206

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++S+  +     L+++  F+  +SVQS+ GGNL+E L NL+ ++RDR ++  KV+ALS E
Sbjct: 207 NDSLVALAERWELEDLHMFAVCLSVQSETGGNLAEILGNLASVIRDRASLYQKVRALSSE 266

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASAW++  LP     +++  +P +   +  DP             LIG++ +R M++ 
Sbjct: 267 GRASAWMLSVLPALTMLVLFMINPSFYLEVSGDPLFATSFAGMIGLYLIGVLWLRSMVDL 326

Query: 186 DV 187
            V
Sbjct: 327 KV 328


>gi|220918107|ref|YP_002493411.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955961|gb|ACL66345.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 321

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 105/182 (57%), Gaps = 1/182 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R+ +  +  P ALD++ RS+RAG   + A  V+  +  +PV  EF R  E+Q LGL + 
Sbjct: 140 RRSNRLSEQLPEALDMMARSLRAGHAFTSAFEVVATEMPEPVAVEFARAFESQRLGLPVE 199

Query: 67  ESISRMVRYMPL-QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++I +M    P  +++  F+    +Q + GGNL+E L +++  +R R    +K+ AL+ E
Sbjct: 200 QAIVQMTERAPGNRDLRIFAVSALIQKETGGNLAEILGSIAETIRARYRFYSKLSALTAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +AS  I+G LP  ++ ++   +P YM  L++DP GHM++  AA   L+G+  +  +   
Sbjct: 260 GRASGAILGMLPILMALVLRIMNPAYMGRLVSDPLGHMIMLFAALSWLVGVAWLYSLTKV 319

Query: 186 DV 187
           D+
Sbjct: 320 DL 321


>gi|114764950|ref|ZP_01444123.1| type II/IV secretion system protein, TadC subfamily [Pelagibaca
           bermudensis HTCC2601]
 gi|114542662|gb|EAU45686.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. HTCC2601]
          Length = 321

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 105/182 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P S A+AV+  +  DP+ +EF  + +    G  +
Sbjct: 140 KKRLALIEEQLPDAVELMVRSLRVGHPFSSAIAVVSKEIKDPLATEFGVIADESTYGRDI 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ES+  M   + +Q++ F +  +S+Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 200 GESLKHMAERLDMQDLRFLAVAVSIQQQSGGNLAEILEGLAKVIRARFRLFRRVKAITAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P  V  ++  T P Y + +++ P       + A F+ + +MVMR+++N 
Sbjct: 260 AQWSGKFLSGFPVGVLLVIQLTDPHYYDEVLDHPWFVPACFIVAVFLALNLMVMRMLVNI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|283779213|ref|YP_003369968.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437666|gb|ADB16108.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 321

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
            +R A F    P AL++I R++RAG  ++    ++  +   P+  EF R  E Q+LG+ L
Sbjct: 140 NRRLAHFARQLPEALELISRALRAGHSLASGFKLVADELGGPIAVEFERCYEAQNLGVPL 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E+I  M   +P  ++ FF+T + +Q Q GG+L+E L  +  ++R+R  +  ++QAL+ E
Sbjct: 200 EEAIDEMTVRVPNLDLRFFATAVILQRQTGGDLAEILDKIGHLVRERYKIWGQIQALTGE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  ++ +LP  +  +++  +  Y   L  DP GH +L  A    LIG +V+R ++N 
Sbjct: 260 GRLSGIVLLALPPVLFVVMWRLNQQYCMALFTDPMGHQMLAGAVVMQLIGALVIRKIVNI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|56477521|ref|YP_159110.1| putative Flp pilus assembly protein [Aromatoleum aromaticum EbN1]
 gi|56313564|emb|CAI08209.1| putative Flp pilus assembly protein [Aromatoleum aromaticum EbN1]
          Length = 324

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 99/177 (55%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +F    P ALD++ R++RAG     A+ ++  +  DP+  EFR + +  + G+    ++ 
Sbjct: 148 RFELQLPEALDLMGRALRAGHAFPTAIKMVAEEMKDPIGGEFRILFDEMNYGVPQQTAML 207

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +       ++S+F   + +Q   GGNL+E L N+S+I+R R  +  +++ LS E K SA
Sbjct: 208 NLASRTDSTDLSYFVIAVLIQRDSGGNLAELLDNISKIVRARLKLYGEIRTLSAEGKLSA 267

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+G LPF  + L+   +PG+M VL  DP G   +  A   M++G++ MR +I   V
Sbjct: 268 WILGCLPFATAALINIVNPGFMKVLWEDPAGINFIYGAMGMMVLGVVWMRKIIRIRV 324


>gi|148261009|ref|YP_001235136.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|326404409|ref|YP_004284491.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|146402690|gb|ABQ31217.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|325051271|dbj|BAJ81609.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 319

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 98/178 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R    L+ FP+AL  IVR VR G+PV +A+ V+      P   EF R+ +   +G  L 
Sbjct: 138 RRATALLNQFPDALATIVRCVRVGIPVQEALRVVSQDMPAPTSREFGRIADQVAIGTPLE 197

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ +M     L E  FF+T IS+Q++ GG L++ L  L+ ++R R  MKA+  AL+ EA
Sbjct: 198 LALRQMADRAHLAEYGFFATAISLQARYGGGLAQTLEGLAEVIRKRVAMKARGYALASEA 257

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+G +P   +  +    P Y+ VL     G+++L  A   +  G +VMR +I 
Sbjct: 258 RTSALILGIIPLVAALAIEVIQPAYLRVLFVTHGGNIVLAAAVGLLAGGALVMREIIR 315


>gi|253996762|ref|YP_003048826.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983441|gb|ACT48299.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 322

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 105/182 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR        P+ALD++ R++ AG     A+ ++  +  +P+ SEFR V +  + G+  
Sbjct: 141 QKRINTIEQQLPSALDLMGRAMVAGHAFPSALQMVGTEMPEPIASEFRIVFDEINYGIPT 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           SE++  +++ +P  +VS+F   + +Q + GGNL+E L N+S ++R R  +   V+ LS E
Sbjct: 201 SEALMNLIQRVPSTDVSYFVIAVLIQRETGGNLAELLGNISELIRARLKLLGSVRVLSAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAWI+  LPF +  ++   +P ++++L  DP G  ++ +A   M+ GI VM  +I  
Sbjct: 261 GRLSAWILTLLPFALGAVLQLVNPKFLSILWTDPNGLKMVIIALILMVFGIFVMWRIIKI 320

Query: 186 DV 187
            V
Sbjct: 321 RV 322


>gi|121534345|ref|ZP_01666169.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307115|gb|EAX48033.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 324

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 106/183 (57%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +++RT  F D   +AL +I  S+R G     ++ ++  +   P+ +EF RV+   +LG++
Sbjct: 142 VERRTKAFNDQLGDALILIANSLRTGYSFLQSIEMVSREMLPPIATEFARVLREMNLGVT 201

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             E+++ + + +   ++    T + +Q Q+GGNL+E L N++  +R R  +K +++ L+ 
Sbjct: 202 TEEALNNLAKRVDSDDLDLVVTAVLIQRQVGGNLAEVLENIAGTIRSRIKIKGEIKTLTA 261

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + + S  IIG LP  +  ++Y  +PGYM +L   P G  L+  A    LIG++++R ++N
Sbjct: 262 QGRISGVIIGLLPVALGLVIYALNPGYMQILFTHPLGRALVAGAIVSQLIGVLLIRRIVN 321

Query: 185 FDV 187
            DV
Sbjct: 322 IDV 324


>gi|46580528|ref|YP_011336.1| hypothetical protein DVU2123 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449947|gb|AAS96596.1| membrane protein, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234267|gb|ADP87121.1| Type II secretion system F domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 321

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 108/181 (59%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R A+F    P+ALD++ R++RAG   +  + ++  +  DP+  EF++V++  + G+   
Sbjct: 141 RRMARFQRQLPDALDLVGRALRAGHAFNQGMRMVADEFEDPIGPEFQKVLDEINYGVPAD 200

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  +VR +   ++ FF   +++Q + GGNL+E +  ++R++R+R  +  +V+ LS E 
Sbjct: 201 TALINLVRRVDCPDLKFFVVSVNIQRETGGNLAEIVTGIARLIRERFKLAGRVRVLSAEG 260

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AWI+ +LPF +  ++   +P +M+VL   P G++L+  +   M IG + ++ M    
Sbjct: 261 RLTAWILLALPFGIGIIINMLNPDFMSVLYETPEGNLLMTGSLFQMTIGAIALKRMTTIR 320

Query: 187 V 187
           V
Sbjct: 321 V 321


>gi|120602155|ref|YP_966555.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|120562384|gb|ABM28128.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
          Length = 321

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 108/181 (59%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R A+F    P+ALD++ R++RAG   +  + ++  +  DP+  EF++V++  + G+   
Sbjct: 141 RRMARFQRQLPDALDLVGRALRAGHAFNQGMRMVADEFEDPIGPEFQKVLDEINYGVPAD 200

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  +VR +   ++ FF   +++Q + GGNL+E +  ++R++R+R  +  +V+ LS E 
Sbjct: 201 TALINLVRRVDCPDLKFFVVSVNIQRETGGNLAEIVTGIARLIRERFKLAGRVRVLSAEG 260

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AWI+ +LPF +  ++   +P +M+VL   P G++L+  +   M IG + ++ M    
Sbjct: 261 RLTAWILLALPFGIGIIINMLNPDFMSVLYETPEGNLLMTGSLFQMTIGAIALKRMTTIR 320

Query: 187 V 187
           V
Sbjct: 321 V 321


>gi|86159246|ref|YP_466031.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775757|gb|ABC82594.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 320

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 103/182 (56%), Gaps = 1/182 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR+AK  +  P ALD++ RS+RAG  V+ A  V+  +  +P+  EF R  E Q LGL+L 
Sbjct: 139 KRSAKLSEQLPEALDMMARSLRAGHAVTSAFQVVASEMPEPICVEFARAYEEQRLGLTLE 198

Query: 67  ESISRMVRYMPLQ-EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++ +M    P   ++  F+    +Q + GGNL+E L  +   +R R     K++AL+ E
Sbjct: 199 RAVVQMSERCPGNGDMKIFAVSAVIQRETGGNLAEILDQIGETIRQRYRFYGKLRALTGE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASA I+G+LPF V+  +   +P Y+ VL    RG M++  A+   ++G++ +  +   
Sbjct: 259 GRASAVILGALPFAVAVALSILNPEYLMVLPGTARGQMIILGASVSWVVGLLWLYRLTQV 318

Query: 186 DV 187
           D+
Sbjct: 319 DL 320


>gi|217978830|ref|YP_002362977.1| type II secretion system protein [Methylocella silvestris BL2]
 gi|217504206|gb|ACK51615.1| type II secretion system protein [Methylocella silvestris BL2]
          Length = 319

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 103/179 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K   +F+D FP+A+D + R +RAGLP++ AV  I  ++  P+ + F  + +   +G+ +
Sbjct: 136 RKTERQFMDLFPDAVDTVARMIRAGLPITAAVRTIASEAGAPISTVFAMIADELKIGVPI 195

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++    + + L +  FF+  +++Q   GGNL   L  LS+I+R R+ ++ K +A + E
Sbjct: 196 EQTLDASSKQIGLADFRFFAVAVALQYSTGGNLMATLEALSQIVRKRRALRLKAKAATGE 255

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + +A+ +G +P   S  ++   PGY+  L  DPRG ++L  A   + +  + MR+++ 
Sbjct: 256 IRITAYALGGIPVLTSGALFVLQPGYLAPLWTDPRGPVILMAAGGLLFLAYLSMRMIMR 314


>gi|118581109|ref|YP_902359.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
 gi|118503819|gb|ABL00302.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
          Length = 321

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 103/173 (59%), Gaps = 1/173 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR + F +  P+AL +I RS+RAG  ++ AV ++  ++ +P+   FR   E Q LGL +
Sbjct: 139 KKRYSSFTEQLPDALTMIARSLRAGHSLTSAVELVGSETPEPLGGLFRAAYEQQKLGLRI 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++  M++ M   ++ FF TVI++ ++ GGNLSE L  L+  +R+R  ++ +VQ  + +
Sbjct: 199 TDALGGMLQRMDSLDLRFFVTVITIHAESGGNLSEILDKLAATIRERIKLRRQVQVYTAQ 258

Query: 126 AKASAWIIGSLP-FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
            + S +I+ +LP F    L Y   PGY +V + + +GH  +  A    +IG +
Sbjct: 259 GRMSGYILVALPIFAFFFLQYVMLPGYEDVFMKETKGHYAIAYAIISQIIGFL 311


>gi|149911402|ref|ZP_01900020.1| hypothetical Flp pilus assembly protein TadB [Moritella sp. PE36]
 gi|149805510|gb|EDM65515.1| hypothetical Flp pilus assembly protein TadB [Moritella sp. PE36]
          Length = 321

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 99/183 (54%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I KR  +    FP ALDI+ R ++AG   SD++ ++  +    +  EF+ +    + G  
Sbjct: 139 INKRMERIEQQFPEALDILKRGLQAGYAFSDSIKLVYEELEGELSDEFKLMFNRINFGND 198

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++   V+ +P      F + +S+  + GGNL+E + NLSRI+R R   K +V+ LS 
Sbjct: 199 VHTALLSFVKRVPSTSAMAFCSSVSIHKETGGNLAENIDNLSRIIRQRFTFKRRVKTLSA 258

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + S W++   PF +  ++Y +SP Y ++LIN P G  LL      ML+GI  +  +I 
Sbjct: 259 EGRLSGWVLVLTPFVLFAVLYISSPDYASILINTPEGLNLLKWGGIGMLLGIWWISKLIK 318

Query: 185 FDV 187
            +V
Sbjct: 319 IEV 321


>gi|90411199|ref|ZP_01219212.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
 gi|90328045|gb|EAS44366.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
          Length = 324

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  +KR   F + F  ALD++ R++  G P ++ +  +  +   PV  EF +     +
Sbjct: 138 LKYKAEKRLCLFEEQFVEALDVMKRALLVGYPFTEVMKTVSQEMPAPVSVEFGKTFSELN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ + +  P   V  F++ + +Q + GGNL+E L NLS ++R R  +  KV+
Sbjct: 198 YGVDIKVALANLAQRNPSVSVLAFNSAVIIQKETGGNLAETLENLSEVIRGRFRLLRKVR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SAWI+  +PF +  ++Y ++P Y++ L    RG  LL + A  ML+G++ +R
Sbjct: 258 SLSAEGRMSAWILMCVPFVLVIMIYLSTPDYLDPLFESDRGANLLMITAVCMLVGMIWIR 317

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 318 KILRIEV 324


>gi|261252091|ref|ZP_05944664.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260935482|gb|EEX91471.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 322

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 101/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R A F +  P ALDI+ R ++AG PV+ A   +  +   P+  EF+ +    + G  
Sbjct: 140 ISDRLAAFEEQLPEALDIMRRMLQAGQPVTQAFNEVGLEMPAPIGVEFKNMFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  ++ K++ LS 
Sbjct: 200 MRMAIMQMAERTPTVSMLAFSSAVILQKETGGNLSENLEKVSKVLRSRFKLQRKIKTLSA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   +   +PGY+  L  DPRG  L+      + IG + +R +IN
Sbjct: 260 ESRLSAWILVLSPFVLFLFLSVINPGYVEPLYTDPRGMKLVSGGVVSLFIGSLWIRKIIN 319

Query: 185 FDV 187
           F+V
Sbjct: 320 FEV 322


>gi|197123314|ref|YP_002135265.1| type II secretion system protein [Anaeromyxobacter sp. K]
 gi|196173163|gb|ACG74136.1| type II secretion system protein [Anaeromyxobacter sp. K]
          Length = 320

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 103/182 (56%), Gaps = 1/182 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR+AK  +  P ALD++ RS+RAG  V+ A  V+  +  +PV  EF R  E Q LGL+L 
Sbjct: 139 KRSAKLSEQLPEALDMMARSLRAGHAVTAAFQVVASEMPEPVSVEFARAYEEQRLGLTLE 198

Query: 67  ESISRMVRYMPLQ-EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++ +M    P   ++  F+    +Q + GGNL+E L  +   +R R     K++AL+ E
Sbjct: 199 RAVVQMSERCPGNGDMKIFAVSAVIQRETGGNLAEILDQIGETIRQRYRFYGKLRALTGE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASA I+G+LPF V+  +   +P Y+ VL    +G M++  A+   ++G++ +  +   
Sbjct: 259 GRASAVILGALPFAVAVALSILNPEYLMVLPGTAKGQMIILGASVSWVVGLLWLYRLTQV 318

Query: 186 DV 187
           D+
Sbjct: 319 DL 320


>gi|323499917|ref|ZP_08104876.1| Flp pilus assembly protein TadB [Vibrio sinaloensis DSM 21326]
 gi|323315158|gb|EGA68210.1| Flp pilus assembly protein TadB [Vibrio sinaloensis DSM 21326]
          Length = 322

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 102/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R ++F +  P ALDI+ R ++AG PV+ A   +  +  DP+ +EF+      + G  
Sbjct: 140 ISDRLSQFEEQLPEALDIMRRMLQAGQPVTQAFNEVGNEMPDPIGTEFKNTFNLLNFGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++ LS 
Sbjct: 200 MRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRSRFKLQRKIKTLSA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   +   +P Y+  L  DPRG  L+      + IG M +R +IN
Sbjct: 260 ESRLSAWILVLSPFLLFLFLSIINPTYVEPLYTDPRGMTLVSGGIVSLFIGSMWIRNIIN 319

Query: 185 FDV 187
           F+V
Sbjct: 320 FEV 322


>gi|197117443|ref|YP_002137870.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197086803|gb|ACH38074.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 320

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 104/182 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R+ KF + FP+AL I  RS+RAG     A+ ++  +   PV   F+   E Q LGL +
Sbjct: 139 ERRSIKFTEQFPDALSIAARSLRAGHSFPTAIQLVGQEVPSPVGPLFKTAYEQQQLGLRM 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ RM   +   ++ FF+T++++ S +GGNLSE L  L+  +R+R  ++ +VQ  + +
Sbjct: 199 VDALMRMNERIDSLDLRFFTTLVAINSDIGGNLSELLDKLAMTIRERLKIRRQVQVYTAQ 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S +++ +LP     +    +P Y   LI +P G  +L  AAA  +IG +V+R ++  
Sbjct: 259 GRLSGYVLAALPIATFGIFSVLNPNYERALIREPLGLYVLAGAAAMQIIGFLVIRKIVRI 318

Query: 186 DV 187
            +
Sbjct: 319 RI 320


>gi|323491539|ref|ZP_08096718.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
 gi|323314115|gb|EGA67200.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
          Length = 322

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 99/183 (54%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R A F +  P ALDI+ R ++AG PV+ A   +  +   P+  EF+      + G  
Sbjct: 140 ISDRLAAFEEQLPEALDIMRRMLQAGQPVTQAFNEVGVEMPAPIGIEFKNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++ LS 
Sbjct: 200 MRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRARFKLQRKIKTLSA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   +   +PGY+  L  DPRG  L+      +  G + +R +IN
Sbjct: 260 ESRLSAWILVLSPFVLFIFLSVINPGYVEPLYTDPRGMKLVSGGVVSLFFGSLWIRKIIN 319

Query: 185 FDV 187
           F+V
Sbjct: 320 FEV 322


>gi|328953759|ref|YP_004371093.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454083|gb|AEB09912.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 339

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 108/186 (58%), Gaps = 1/186 (0%)

Query: 3   HLIKK-RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           H+ KK R  KF    P AL ++ RS++AG      + ++  +  +P+  EF +  +  + 
Sbjct: 154 HMKKKYRLKKFEKQLPEALGLMARSLKAGHSFPSTMQLVADEMPNPIGIEFFKTFKEFNY 213

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL +S +++ + + + LQ++ FF T I++Q + GGNL E L  ++ ++RDR  +   ++A
Sbjct: 214 GLDMSSALANLQKRIDLQDLKFFVTAINIQRETGGNLVEILEKIASLIRDRFKLVNHIKA 273

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ E + S  I+  LP  ++ ++YF +  YM +LI  P G M++GVA    L+G +++  
Sbjct: 274 ITSEGRFSGLILTCLPPGMAIILYFLNKKYMLLLITHPWGKMMVGVALTMQLLGYLMIHK 333

Query: 182 MINFDV 187
           ++N  V
Sbjct: 334 IVNIKV 339


>gi|148976657|ref|ZP_01813344.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
 gi|145964008|gb|EDK29266.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
          Length = 321

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  +P+  EF+      +
Sbjct: 135 VQNRVTYRMARFEEQLPEALDIIRRALQAGQPIVQSFNEVGEEMPEPIGVEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAIMQMTERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L +DPRG  ++ +    + IG + +R
Sbjct: 255 TLSAESRLSAWILTLSPFVLFFGLKFVNPEYIEPLYSDPRGISMVSIGVILLAIGALWIR 314

Query: 181 LMINFDV 187
            +IN ++
Sbjct: 315 KIINIEI 321


>gi|322419940|ref|YP_004199163.1| Type II secretion system F domain-containing protein [Geobacter sp.
           M18]
 gi|320126327|gb|ADW13887.1| Type II secretion system F domain protein [Geobacter sp. M18]
          Length = 321

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 105/174 (60%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  KF + FP+AL +I RS+RAG   + A+ ++  + +DPV   F+   E Q LGL 
Sbjct: 139 IRQRLEKFTELFPDALTMIARSLRAGHSFNSAIQLVGEEIADPVGELFKTAYEQQLLGLR 198

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           ++E+++ +   +   ++ FF+T I++ + +GGNLSE L NL++ +R+R  ++ +V+  + 
Sbjct: 199 ITETLTNLNERIESLDLRFFTTAIAINNDVGGNLSEILENLAKTIRERLKIRRQVRVYTA 258

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           + + + +++G+LP     +    +P Y +VL  + +G  +L  A    ++G+ V
Sbjct: 259 QGRMTGYVLGALPVFTFLIFNVLNPKYESVLYKETKGLYVLAFAVVLQVVGLFV 312


>gi|260892928|ref|YP_003239025.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260865069|gb|ACX52175.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 313

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 111/180 (61%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL ++R A+F    P+AL ++  ++RAG  +  A+ V+  +   P+  EF R +    
Sbjct: 127 LRHLRRQRLARFQSQLPDALSLMANTMRAGFGMLQAMDVVRREMPPPISQEFGRTLAELG 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++ R+   +P  ++    T + +Q Q+GGNL+E L N++  +R+R  +K +++
Sbjct: 187 LGMGVEEALERLSHRVPSDDLDLAVTAVIIQRQVGGNLAEILDNIATTIRERVRLKGEIR 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + + SA IIG LP  ++ ++   +P Y+  LI +P G ++LG+ AA  ++G++++R
Sbjct: 247 ALTAQGRISALIIGLLPLALALILSLINPSYLLTLIYEPLGRIMLGLGAAGEIVGVLLLR 306


>gi|260771471|ref|ZP_05880396.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
 gi|260613597|gb|EEX38791.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
          Length = 321

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 102/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R +KF +  P+ALDII R ++AG P++ +   +  +   P+  EF+      + G  
Sbjct: 139 ISDRLSKFEEQLPDALDIIRRMLQAGQPLTQSFNEVGNEMPAPIGVEFKNTFNLLNYGYD 198

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  +  K++ +S 
Sbjct: 199 LRLAIMQMADRTPTVSMLAFSSAVLLQKETGGNLSENLDKVSKVLRARFKLARKIKTISA 258

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +  ++    PGY++ L  DPRG  ++      + +G + MR +IN
Sbjct: 259 ESRMSAWILVLSPFVLFIVMSLIHPGYVSPLYEDPRGVGVISYGIVSLFLGSLWMRHIIN 318

Query: 185 FDV 187
           F+V
Sbjct: 319 FEV 321


>gi|167842455|ref|ZP_02469139.1| Flp pilus assembly protein TadB [Burkholderia thailandensis MSMB43]
          Length = 325

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 105/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P+  D I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 141 HCRTRRLRKLERQLPDTCDTIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  KV+ L
Sbjct: 201 VPLQEALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P ++ VL  DP G +L+G+  A M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAGLLSVMNPDFIAVLWQDPAGILLVGMTIASMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|116626773|ref|YP_828929.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229935|gb|ABJ88644.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 325

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF +  P+A+D+  R++RAG  +   +  I  ++SDPV+ EF++++E   LG  + 
Sbjct: 145 RRLHKFEEMLPDAIDLFTRTMRAGHNIHSGLETIATETSDPVKMEFKKLMEELALGSQVE 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  + + +PL ++ FF T + +Q Q G N+   L NLS ++R+R NM AK++A + + 
Sbjct: 205 PALHGLGKRVPLIDLKFFITSLILQRQTGANMVSVLENLSTLVRERLNMAAKMKAHTAQQ 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SA ++  LP  V    +   P Y+ +L  DP G      A     +GI+V+R + N  
Sbjct: 265 RFSAGLLCCLPLVVGIGFWILKPEYVRLLWTDPVGSKFFTYAIISEFVGILVIRKIANIK 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|315181053|gb|ADT87967.1| Flp pilus assembly protein TadB [Vibrio furnissii NCTC 11218]
          Length = 321

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R +KF +  P+ALDII R ++AG P++ +   +  +   P+  EF+      + G  
Sbjct: 139 ISDRLSKFEEQLPDALDIIRRMLQAGQPLTQSFNEVGNEMPAPIGVEFKNTFNLLNYGYD 198

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  +  K++ +S 
Sbjct: 199 LRLAIMQMADRTPTVSMLAFSSAVLLQKETGGNLSENLDKVSKVLRARFKLARKIKTISA 258

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   +    PGY++ L  DPRG  L+      + +G + MR +IN
Sbjct: 259 ESRMSAWILVLSPFVLFIAMSIIHPGYVSPLYEDPRGVGLISYGIVSLFMGSLWMRHIIN 318

Query: 185 FDV 187
           F+V
Sbjct: 319 FEV 321


>gi|116620535|ref|YP_822691.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223697|gb|ABJ82406.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 323

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   + FP +LD + RS+RAG   S ++ ++  + +DP+  EFR +   Q+LG  L 
Sbjct: 143 KRLATLEEQFPESLDFLARSMRAGHAFSISLEMLGEELADPLGQEFRALFNEQNLGAPLD 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++      +PL +V FF++ + +Q Q GGNLSE LA L+ ++R+R  +K +V+A S   
Sbjct: 203 TALRNFTTRVPLLDVRFFTSSVLLQKQTGGNLSEILARLAYVIRERFRLKGQVKAASAHG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A I+  LP      +   +PGY+  + +D  G  L+G A    ++G   ++ +IN  
Sbjct: 263 RLTATILTLLPVGTMLALLVVAPGYLQGMADDSDGKYLIGGAIVAQVLGNYFIKRIINIK 322

Query: 187 V 187
           V
Sbjct: 323 V 323


>gi|103488239|ref|YP_617800.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98978316|gb|ABF54467.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 333

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 98/174 (56%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
             FP ALDI VR +R+G P+  A+ ++  +  DP+ +EF  V +    GL L E+++RM 
Sbjct: 160 QQFPIALDIFVRGLRSGHPIPAALQLLTVEMEDPIGTEFGIVTDEIAFGLDLREALARMA 219

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
               L ++  F   +SVQ + GGNL+E L NLS+++RDR +M  KV+ALS E + +A I+
Sbjct: 220 ERWGLPDMHMFVVSVSVQMETGGNLAEILENLSKVIRDRASMFMKVRALSSEGRMTAVIL 279

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            +LP      ++ T+P +   +  DP   +  G      L+G   +R MI+  V
Sbjct: 280 TALPILAFVGLFLTNPVFYLDVATDPIFFIGFGGLILLYLVGFFTIRRMIDLKV 333


>gi|218710399|ref|YP_002418020.1| Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
 gi|218323418|emb|CAV19595.1| Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
          Length = 321

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  DP+ +EF+      +
Sbjct: 135 VQNRVSYRMARFEEQLPEALDIIRRALQAGQPLIQSFNEVGEELPDPIGAEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAILQMAERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRSRFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   +P Y+  L NDPRG  ++ V    + IG + ++
Sbjct: 255 TLSAESRLSAWILTLSPFGLFFALKVANPDYIEPLYNDPRGVSMVSVGIVLLAIGALWIK 314

Query: 181 LMINFDV 187
            +I+ ++
Sbjct: 315 RIISIEI 321


>gi|86147460|ref|ZP_01065772.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
 gi|85834753|gb|EAQ52899.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
          Length = 321

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 101/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +  R A+F +  P ALDII R+++AG P+  +   +  +  +P+  EF+      + G  
Sbjct: 139 VTYRMARFEEQLPEALDIIRRALQAGQPLVQSFNEVGEEMPEPIGVEFKNTYNLLNYGYD 198

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++ LS 
Sbjct: 199 LRLAIMQMTERAPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIKTLSA 258

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   + F +P Y+  L  DPRG  ++ +    + IG + +R +IN
Sbjct: 259 ESRLSAWILTLSPFVLFFGLKFVNPEYIEPLYTDPRGISMVSIGVILLAIGALWIRKIIN 318

Query: 185 FDV 187
            ++
Sbjct: 319 IEI 321


>gi|218887823|ref|YP_002437144.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758777|gb|ACL09676.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 321

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 102/173 (58%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +F    P+ALD+I R+++AG   +  + ++  + +DP+  EF++ ++  + G+    
Sbjct: 142 RMGRFQRQLPDALDLIARALKAGHAFNQGMRMVADEFADPIGPEFQKTLDEINFGIPADA 201

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  + R +   ++ FF   +++Q + GGNL+E + N++R++R+R  +  +V+ LS E +
Sbjct: 202 ALYNLTRRVDCPDLKFFVVSVNIQRETGGNLAEIVTNIARLIRERFKLAGRVRVLSAEGR 261

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +AWI+  LPF +  ++   +P +M+ L   P G+MLL  +   M IG + ++
Sbjct: 262 LTAWILFVLPFGIGFIINLLNPDFMSALYATPEGNMLLTASLFQMAIGGIALK 314


>gi|254506705|ref|ZP_05118845.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
 gi|219550286|gb|EED27271.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
          Length = 322

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 102/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R A F +  P ALDI+ R ++AG PV+ A   +  +  DP+ +EF+      + G  
Sbjct: 140 ISDRLASFEEQLPEALDIMRRMLQAGQPVTQAFNEVGNEMPDPIGTEFKNTFNLLNFGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  ++ K++ LS 
Sbjct: 200 MRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSKVLRSRFKLQRKIKTLSA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   + F +P Y+  L  DPRG  L+      + IG + +R +IN
Sbjct: 260 ESRLSAWILVLSPFLLFLFLTFINPSYVEPLYTDPRGMTLVSGGIISLFIGSIWIRNIIN 319

Query: 185 FDV 187
           F+V
Sbjct: 320 FEV 322


>gi|77919351|ref|YP_357166.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
 gi|77545434|gb|ABA88996.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
          Length = 325

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 105/178 (58%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
           A+F D  P ALD++ R++R+G  ++  + ++  +   P+ SEF   ++  +LGL+  E+ 
Sbjct: 148 ARFQDQLPEALDLLARALRSGHAMTSGLEMVAAEMDPPISSEFGAAVDEINLGLTFQEAF 207

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
             +   +P  ++ FF+  + +Q + GGN++E L ++SR++R+R   K +V+AL+ E + S
Sbjct: 208 ENLCERVPSTDLRFFAISVIIQRETGGNVAEILDSISRLIRERIQFKRQVKALTAEGRLS 267

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           A ++  LP  +   ++F +  Y+++L  +P G  +L  A    ++G  +++ ++  ++
Sbjct: 268 AMVLIGLPIALFGYIFFVNHQYLSLLWTEPLGQYMLAGAIVLQILGAFIIKKIVTIEL 325


>gi|83716413|ref|YP_440463.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
 gi|167617238|ref|ZP_02385869.1| Flp pilus assembly protein TadB [Burkholderia thailandensis Bt4]
 gi|257141111|ref|ZP_05589373.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
 gi|83650238|gb|ABC34302.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
          Length = 325

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ +DP+  EFR   +  + G+ L 
Sbjct: 145 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFADPMGGEFRITFDEINYGVPLQ 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  K++ LS E 
Sbjct: 205 EALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  D  G +L+G     M  GI+ MR +I   
Sbjct: 265 KLSALILTLLPFGTAALLAIMNPDFISVLWEDSAGVLLVGATVTSMAFGILWMRHIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|54302282|ref|YP_132275.1| Flp pilus assembly protein TadB [Photobacterium profundum SS9]
 gi|46915704|emb|CAG22475.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum SS9]
          Length = 288

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  +KR   F + F  ALD++ R++  G P ++ +  +  +   P+  EF +     +
Sbjct: 102 LKYKAEKRLCLFEEQFVEALDVMKRALLVGYPFTEVMKTVSQEMPAPISVEFGKTFSELN 161

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ + +  P   V  F++ + +Q + GGNL+E L NLS ++R R  +  KV+
Sbjct: 162 YGVDIKVALANLAQRNPSISVLAFNSAVIIQKETGGNLAETLENLSEVIRGRFRLLRKVR 221

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SAWI+  +PF +  ++Y ++P Y++ L    RG  LL +    M++G++ +R
Sbjct: 222 SLSAEGRMSAWILMCVPFVLVIMIYLSTPDYLDPLFESDRGANLLMITGVCMILGMIWIR 281

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 282 KILRIEV 288


>gi|308050052|ref|YP_003913618.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
 gi|307632242|gb|ADN76544.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
          Length = 324

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K  + FP ALDI+ R ++AG    DA+ +   +   P+  EF+ +    + G    
Sbjct: 144 KRMEKIEEQFPEALDILRRGIQAGYAFPDAIKLTYEEMDGPIAYEFKVMFAEINYGKDTR 203

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      FST + VQ + GGNL+E L NL+RI+R R   + +V+  S + 
Sbjct: 204 RALLHFIERVPSVSAMAFSTAVQVQKETGGNLAENLENLTRIIRKRFRFQRQVKTFSAQG 263

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAW++  +P  +   +Y +SP Y   L +   G+ LL +A   MLIGI  +  +I  +
Sbjct: 264 RMSAWVLVCVPLALFGYLYLSSPTYARELTDTEIGNTLLTIAGIGMLIGIYWISRLIRIE 323

Query: 187 V 187
           V
Sbjct: 324 V 324


>gi|167579123|ref|ZP_02371997.1| Flp pilus assembly protein TadB [Burkholderia thailandensis TXDOH]
          Length = 325

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+A D+I R++RAG   S A++++ G+ +DP+  EFR   +  + G+ L 
Sbjct: 145 RRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFADPMGGEFRITFDEINYGVPLQ 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  K++ LS E 
Sbjct: 205 EALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K SA I+  LPF  + L+   +P +++VL  D  G +L+G     M  GI+ MR +I   
Sbjct: 265 KLSALILTLLPFGTAALLAIMNPDFISVLWEDSAGVLLVGATVTSMAFGILWMRHIIRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|78357407|ref|YP_388856.1| hypothetical protein Dde_2364 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219812|gb|ABB39161.1| membrane protein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 321

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +F    P+ALD+I R+++AG      + ++  + +DPV  EF+  ++  + G+S  
Sbjct: 141 RRMNRFHRQLPDALDLIARALKAGHAFPQGMRMVADEFADPVGPEFQITLDEINFGVSPD 200

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  M R +   ++ FF   +++Q + GGNL+E ++ ++ +LR+R  +  +V+ LS E 
Sbjct: 201 AALHAMTRRVDCADLRFFVVSVNIQRETGGNLAEIVSGIALLLRERFKLHGRVKVLSAEG 260

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +AWI+ +LPF +  +++  +P +M+ L   P G+MLL  +   M  G + ++ +    
Sbjct: 261 RLTAWILFALPFGIGFIIHLLNPDFMSALYTTPEGNMLLNGSLFLMTAGALALKKLTTIR 320

Query: 187 V 187
           V
Sbjct: 321 V 321


>gi|260428144|ref|ZP_05782123.1| type II secretion system protein [Citreicella sp. SE45]
 gi|260422636|gb|EEX15887.1| type II secretion system protein [Citreicella sp. SE45]
          Length = 321

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 105/182 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR +   +  P+A++++VRS+R G P S A++V+  +  DP+ +EF  + +    G  +
Sbjct: 140 RKRLSLIEEQLPDAVELMVRSLRVGHPFSSAISVVSCEIKDPLATEFGIIADESTYGRDI 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ES+  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 200 GESLKHMAERLDMQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRARFRLFRRVKAITAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P  V  ++  T P Y + +++ P       + A F+ + ++VMR+++N 
Sbjct: 260 AQWSGKFLSGFPVAVLLIIQLTDPHYYDEVLDHPWFIPACFIVAIFLALNLIVMRMLVNI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|159043674|ref|YP_001532468.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
 gi|157911434|gb|ABV92867.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
          Length = 322

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R A   +  P+A++++VRS+R G P S A+ ++  + +DP+ +EF  + +    G  +
Sbjct: 141 KQRLAMIEEQLPDAVELMVRSLRVGHPFSSAINIVAKEVADPLGTEFGMIADEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E++  +   M +Q++ F +  +S+QSQ GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 TEALKELAERMDMQDLRFLAVAVSIQSQSGGNLAEILDGLAKVIRARFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   +   PF     +    P Y   + + P       V A F+ I I+ M++M+N 
Sbjct: 261 AKWSGMFLSGFPFLALVGINLMEPDYYADVKDTPAFIPACVVVAVFLTINIIFMKMMVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|323529409|ref|YP_004231561.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386411|gb|ADX58501.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 327

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR        P A D+I R++RAG   S A+ ++  + ++P   EFR V +  + G++L+
Sbjct: 147 KRLRLLERQLPEAADMISRALRAGHSFSSAIGMLGNEFAEPTGGEFRIVFDEINYGVTLN 206

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P++++ FF   + +Q + GGNL+E L  ++ ++R+R  +  +V+ LS E 
Sbjct: 207 EALLNLATRVPVRDLRFFVIAVLIQRETGGNLAEILDGIASLVRERLRLFDQVRVLSAEG 266

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWIIG LPF  +  +   +P +++VL  DP G  ++      M+ G++ MR ++   
Sbjct: 267 RLSAWIIGLLPFAAAGGMNLLNPSFLSVLWEDPAGLKVIEAVLVSMVFGVLWMRRIVRIR 326

Query: 187 V 187
           V
Sbjct: 327 V 327


>gi|163738366|ref|ZP_02145781.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742217|ref|ZP_02149605.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384547|gb|EDQ08928.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388287|gb|EDQ12641.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 322

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 103/182 (56%), Gaps = 2/182 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVANEVEDPLATEFGVIADESAYGRDVG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLP-FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           + S   +   P FC+  ++    PGY + +I+ P       V  A + + + VMR++ N 
Sbjct: 262 QWSGKFLSGFPLFCLGGILA-KDPGYYDSVIDHPWFIPACFVVGAMLTVNLFVMRMLTNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|307726379|ref|YP_003909592.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307586904|gb|ADN60301.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 327

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR        P A D+I R++RAG   S A+ ++  + ++P   EFR V +  + G++L+
Sbjct: 147 KRLRVLERQLPEAADMISRALRAGHSFSSAIGMLGNEFAEPTGGEFRIVFDEINYGVTLN 206

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  +V+ LS E 
Sbjct: 207 EALLNLATRVPVSDLRYFVIAVLIQRETGGNLAEILDGIASLVRERLRLFDQVRVLSAEG 266

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWIIG LPF  +  +   +P +++VL  DP G  L+      M  G++ MR ++   
Sbjct: 267 RLSAWIIGLLPFAAAGAMNLLNPSFLSVLWEDPAGLKLIEAVLVSMAFGVLWMRRIVRIR 326

Query: 187 V 187
           V
Sbjct: 327 V 327


>gi|116687152|ref|YP_840399.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|116652867|gb|ABK13506.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 325

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 105/181 (58%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G+SL 
Sbjct: 145 KRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|84387238|ref|ZP_00990259.1| Flp pilus assembly protein TadB [Vibrio splendidus 12B01]
 gi|84377885|gb|EAP94747.1| Flp pilus assembly protein TadB [Vibrio splendidus 12B01]
          Length = 321

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 100/180 (55%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R A+F +  P ALDII R+++AG P+  +   +  +  DP+  EF+      + G  L  
Sbjct: 142 RMARFEEQLPEALDIIRRALQAGQPLVQSFNEVGEELPDPIGVEFKNTYNLLNYGYDLRL 201

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++ LS E++
Sbjct: 202 AILQMTERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIKTLSAESR 261

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            SAWI+   PF +   +   SP Y+  L  DPRG  ++ V    + IG + ++ +I+ ++
Sbjct: 262 LSAWILTLSPFGLFFALRVASPEYIEPLYKDPRGLSMVSVGIVLLAIGALWIKKIISIEI 321


>gi|251789650|ref|YP_003004371.1| type II secretion system protein [Dickeya zeae Ech1591]
 gi|247538271|gb|ACT06892.1| type II secretion system protein [Dickeya zeae Ech1591]
          Length = 325

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 98/181 (54%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K   +  +  P+A+D I RS RAG+PV++    +    S P+ +EFR +     LG+ 
Sbjct: 143 LQKHLHQLRESLPDAIDAITRSCRAGVPVANTFGQVAAHLSGPLANEFRLIDHWLKLGVP 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR R+ +  KVQ+ + 
Sbjct: 203 LRQVIQTSAGRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRQRRELALKVQSKTS 262

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+ +L P C+  + Y  SP   + L NDP G  +L  A   + +G+++  LM+
Sbjct: 263 EARASAKIVAALFPGCLGYM-YLKSPEDFDFLFNDPVGSTVLVYALCSVTLGMVITHLMV 321

Query: 184 N 184
            
Sbjct: 322 K 322


>gi|85859133|ref|YP_461335.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722224|gb|ABC77167.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 327

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 102/181 (56%), Gaps = 1/181 (0%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF    P+ALD++ R+++AG      + ++  +  DP+  EF +V+E  + G+ + E
Sbjct: 147 RMKKFDAQLPDALDLMARALKAGHAFPGGIQMVAKEFDDPIGIEFAKVVEETNFGVGVEE 206

Query: 68  SISRMV-RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++  +  R+    ++ FF+  + +Q + GGNL+E L +++RI+R+R  +   ++ LS E 
Sbjct: 207 ALRNLANRFDSSSDLKFFAIAVMIQRESGGNLAEILESIARIIRERFKLMGTIRTLSAEG 266

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SA I+ ++PF V+  +   +P Y+ VL  DP G  L   +   M +GI +M+  I   
Sbjct: 267 RLSAIILVAIPFFVAFALSIMNPQYITVLATDPIGKALAFTSLVMMAVGIYIMKKTIQIK 326

Query: 187 V 187
           V
Sbjct: 327 V 327


>gi|292491526|ref|YP_003526965.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580121|gb|ADE14578.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 323

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 101/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  KF +  P ALDI+ R+++AG P  + + V   +  DP+  EFR      + G+++ 
Sbjct: 143 KRIGKFEEQLPEALDIMSRAMKAGYPFVETLHVASEEMRDPLAKEFRTTFADINYGMNIK 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            +   +++ +P   +    T + VQ   GGNL+E L  ++ ++R R   + KV+  + E 
Sbjct: 203 TAFLSLLQRVPSMSLMAVVTGVLVQRDTGGNLAEILEKIAAVVRGRFRFQRKVRTFTAEG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  +PF +S  ++  +P Y+ +L+ +P G  L+ +A   +++G+  MR +I  D
Sbjct: 263 RLSAWILTLVPFVLSAALHVINPEYLPMLVKEPLGRTLILLAFINIMVGVFWMRRIIRID 322

Query: 187 V 187
           V
Sbjct: 323 V 323


>gi|134299963|ref|YP_001113459.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052663|gb|ABO50634.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 323

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 106/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR AKF     +AL I+  S+R+G     A+ ++  +  +P+  EF R  +  +LG   
Sbjct: 142 QKRLAKFNSQISDALVIMSNSLRSGFSFLQAMDMVRKELPNPISKEFGRTFQEMNLGTQA 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M + +   ++    T + +Q Q+GGNL+E + N++  +R+R  +K +++ L+ +
Sbjct: 202 EEALENMAQRVKSDDLDLLITAVLIQRQVGGNLAEVMDNIADTIRERVRVKGQIRTLTAQ 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S ++IG LPF ++T++   SP Y+  L N   G +++G+A    +IG+M ++ ++N 
Sbjct: 262 GRISGFVIGLLPFGLTTVMITISPSYILTLFNSQLGLLMMGMAIISEVIGVMFIKKIVNI 321

Query: 186 DV 187
           +V
Sbjct: 322 EV 323


>gi|225174957|ref|ZP_03728954.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169597|gb|EEG78394.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 322

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 101/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R     +  P AL+II   +RAG     A+AV+  +   P+  EF RV+    LG S+ 
Sbjct: 142 RRMQALNNQLPEALNIISSGLRAGYSFPQAMAVVGREMDAPIADEFNRVLRDNRLGKSMD 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  M      +++    T + +Q Q+GGN++E L  +   +R+R  +K +++AL+ + 
Sbjct: 202 DALLEMTARTDNEDLDLVVTSLLIQRQVGGNMAEVLNKIEHTIRERMRIKGEIRALTAQQ 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SA II  LP  V+ L+   +P YM  L+ +P G M+L +A    ++GIM++R ++  +
Sbjct: 262 RMSAVIIVLLPIAVALLLLVINPEYMLTLVTEPIGIMVLSIAVIMQIVGIMIIRRIVQIE 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|261820218|ref|YP_003258324.1| type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
 gi|261604231|gb|ACX86717.1| Type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
          Length = 326

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 101/181 (55%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     LG+ 
Sbjct: 144 LQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRLGIP 203

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LRDR+ ++ KVQ+ + 
Sbjct: 204 LRQVIQASATRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRDRRELQLKVQSKTS 263

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+ +L P C++ L Y  SP   + L +DP G  +L  A   + +G++V  +M+
Sbjct: 264 EARASAKIVAALFPGCLAYL-YMKSPEDFSFLFSDPVGTSVLIYALCSVSVGMLVTHVMV 322

Query: 184 N 184
            
Sbjct: 323 K 323


>gi|27365113|ref|NP_760641.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|37680836|ref|NP_935445.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|320155496|ref|YP_004187875.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|27361259|gb|AAO10168.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|37199585|dbj|BAC95416.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|319930808|gb|ADV85672.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 321

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  +F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      +
Sbjct: 135 LQKRITDRLNRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGNEMAPPIGIEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  + ++LR R  +  K++
Sbjct: 195 YGYDMRLAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVGKVLRQRFKLTRKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAWI+   PF +   + F +P Y+  L  D RG  L+ +    +  G + +R
Sbjct: 255 TISAESRLSAWILVLSPFVLFVGLMFINPEYVKPLYQDERGMELVTMGIVSLFFGAIWIR 314

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 315 NIINFEV 321


>gi|107028241|ref|YP_625336.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|105897405|gb|ABF80363.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
          Length = 325

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G+SL 
Sbjct: 145 KRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  ++ VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLLVLWEDPAGIRMVGTMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|302391032|ref|YP_003826852.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203109|gb|ADL11787.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 327

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 105/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  KKR  KF +   ++L II  S++AG     A+ ++  +   P+  E  RV++  +
Sbjct: 141 LKYSQKKRLDKFNEQINDSLTIISNSLKAGYSFFQALEMVAKEMPPPISEEITRVLKEMN 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  ++++ +   +   ++    T + +Q Q+GGNLSE L N+S  +R+R  +K ++Q
Sbjct: 201 LGASPQDALTALTDRVESDDLELVVTAVLIQRQVGGNLSEILDNISDTIRERIKIKGEIQ 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +  +++  SP YM  L   P G  ++GV     ++G ++++
Sbjct: 261 TLTAQGRMSGLIIGLLPVGLGGMLFLISPDYMAPLFGHPLGQTMIGVGIISQILGAVLIK 320

Query: 181 LMINFDV 187
            +I+ +V
Sbjct: 321 KIIDIEV 327


>gi|83950070|ref|ZP_00958803.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837969|gb|EAP77265.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
          Length = 322

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 103/186 (55%), Gaps = 8/186 (4%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKRTA+  +  P+A++++VRS+R G P S A++++  + SDP+ +EF  + +    G  L
Sbjct: 141 KKRTARLEEQLPDAIELMVRSLRVGHPFSAAISIVANEVSDPLATEFGIIADEAAYGREL 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E L  LS+++R R  +  +V+A++ E
Sbjct: 201 GEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILDGLSKVIRSRFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA----AFMLIGIMVMRL 181
           AK S   +   P      +    P Y     ++   H     AA     F+++ ++VMR 
Sbjct: 261 AKWSGNFLSGFPLMALIGIQLIDPNYY----DEAMEHAFFIPAAITVGVFLVLNLIVMRG 316

Query: 182 MINFDV 187
           ++N  V
Sbjct: 317 LVNIKV 322


>gi|258627497|ref|ZP_05722278.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|262165915|ref|ZP_06033652.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
 gi|262171239|ref|ZP_06038917.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|258580303|gb|EEW05271.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|261892315|gb|EEY38301.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|262025631|gb|EEY44299.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
          Length = 321

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R ++F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      +
Sbjct: 135 LQKRIADRLSRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGKEMAAPIGLEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  F++ + +Q + GGNLSE L  + ++LR R  +  K++
Sbjct: 195 YGYDMRLAIMQMAERTPTVSMLAFASAVMLQKETGGNLSENLEKVGKVLRQRFKLTRKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L  D RG  ++ V    +  G + +R
Sbjct: 255 TLSAESRLSAWILVLSPFVLFIGLMFINPDYVTPLYQDARGMEMVSVGMVSLFFGAIWIR 314

Query: 181 LMINFDV 187
            +I+F+V
Sbjct: 315 KIISFEV 321


>gi|258621454|ref|ZP_05716488.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
 gi|258586842|gb|EEW11557.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
          Length = 232

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 100/183 (54%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R ++F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      + G  
Sbjct: 50  IADRLSRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGKEMAAPIGLEFKNTFNLLNYGYD 109

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  +I +M    P   +  F++ + +Q + GGNLSE L  + ++LR R  +  K++ LS 
Sbjct: 110 MRLAIMQMAERTPTVSMLAFASAVMLQKETGGNLSENLEKVGKVLRQRFKLTRKIKTLSA 169

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E++ SAWI+   PF +   + F +P Y+  L  D RG  ++ V    +  G + +R +I+
Sbjct: 170 ESRLSAWILVLSPFVLFIGLMFINPDYVTPLYQDARGMEMVSVGMVSLFFGAIWIRKIIS 229

Query: 185 FDV 187
           F+V
Sbjct: 230 FEV 232


>gi|327543263|gb|EGF29696.1| Flp pilus assembly protein TadB [Rhodopirellula baltica WH47]
          Length = 321

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +F +  P AL+++ RS+RAG  ++    ++  +   P+ +EFRR  E Q  G+ L
Sbjct: 140 KRRLKRFGEQIPEALELLGRSLRAGHSLNAGFGLVGDEMEAPLATEFRRCFEEQKFGIPL 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ESI  M   +P  ++ FF+T + +Q Q GG+LSE L  +  ++R+R  +   +QAL+ E
Sbjct: 200 DESIEDMAERVPNMDLRFFATAVILQRQTGGDLSEILDKIGHLVRERLQILGTIQALTGE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  ++ +LP  +  ++   +  Y+ +L  D  G M LG+A    ++G + ++ +I  
Sbjct: 260 GRMSGAVLLALPPVLFLVMLKINAEYVLMLFTDELGRMALGMALVTQVLGALAIKKIITI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|254476377|ref|ZP_05089763.1| type II secretion system protein [Ruegeria sp. R11]
 gi|214030620|gb|EEB71455.1| type II secretion system protein [Ruegeria sp. R11]
          Length = 322

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 103/182 (56%), Gaps = 2/182 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR +   +  P+A++++VRS+R G P + AV ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMSMIEEQLPDAVELMVRSLRVGHPFASAVQIVANEVEDPLATEFGIIADESAYGRDVG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLP-FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           + S   +   P FC+  ++    PGY + +I+ P       V  A + + + VMR++ N 
Sbjct: 262 QWSGKFLSGFPLFCLGGILA-KDPGYYDSVIDHPWFIPACFVVGAMLTVNLFVMRMLTNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|170734861|ref|YP_001773975.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169820899|gb|ACA95480.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 325

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K     P+  D+I R++R+G   +  + ++  +  +P+  EFR   +  + G+SL 
Sbjct: 145 KRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFPEPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|32473986|ref|NP_866980.1| secretion system protein TadB [Rhodopirellula baltica SH 1]
 gi|32444523|emb|CAD74522.1| secretion system protein TadB [Rhodopirellula baltica SH 1]
          Length = 347

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +F +  P AL+++ RS+RAG  ++    ++  +   P+ +EFRR  E Q  G+ L
Sbjct: 166 KRRLKRFGEQIPEALELLGRSLRAGHSLNAGFGLVGDEMEAPLATEFRRCFEEQKFGIPL 225

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ESI  M   +P  ++ FF+T + +Q Q GG+LSE L  +  ++R+R  +   +QAL+ E
Sbjct: 226 DESIEDMAERVPNMDLRFFATAVILQRQTGGDLSEILDKIGHLVRERLQILGTIQALTGE 285

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  ++ +LP  +  ++   +  Y+ +L  D  G M LG+A    ++G + ++ +I  
Sbjct: 286 GRMSGAVLLALPPVLFLVMLKINAEYVLMLFTDELGRMALGMALVTQVLGALAIKKIITI 345

Query: 186 DV 187
            V
Sbjct: 346 KV 347


>gi|156744076|ref|YP_001434205.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235404|gb|ABU60187.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 323

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 91/147 (61%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R   F D  P  LD+I  S+R G  +  ++A + G   +P+R+E RRV +   LGLS+
Sbjct: 142 QRRKQAFSDQLPETLDLITASMRGGFSLVQSLANVAGDVQEPMRTELRRVFQEVQLGLSI 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++  +V+ M   ++    T I + +++GGNL + L N+S  +R+R  ++ +V+ ++  
Sbjct: 202 TQALDNLVQRMESTDLDLVVTAIKIHARVGGNLGQILENISTTMRERAKLRREVRVITSM 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYM 152
            + S+++IG+LPF ++ +++  +P YM
Sbjct: 262 QRISSYVIGALPFALALIIFTINPTYM 288


>gi|323341959|ref|ZP_08082192.1| flp pilus assembly protein [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464384|gb|EFY09577.1| flp pilus assembly protein [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 311

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 100/182 (54%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KF     +AL I+  S+RAG     A+A I     DP+  EF +V     LG ++
Sbjct: 130 KQRIGKFSQQLGDALLILSNSLRAGFTFEQALASIAKDLPDPIGPEFLKVCREVELGENI 189

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +S++ +   M  +E+   +T +S+Q Q+GGNL++ L N+   +R+R  ++  ++AL+ +
Sbjct: 190 EKSLAAVSTRMESEEMKLMNTAVSIQRQVGGNLADVLDNIGEAIRERITIQKNIKALTAQ 249

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              SA +I  LP  V  L+   +  YM  +   P G+ LLGV+A   ++G  +++ + N 
Sbjct: 250 GDVSAKVIAGLPVVVLVLISMVNKEYMEPVFTTPFGYALLGVSATLEIMGYAMIKKITNI 309

Query: 186 DV 187
           ++
Sbjct: 310 EM 311


>gi|163745842|ref|ZP_02153201.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161380587|gb|EDQ04997.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 320

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 102/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   KR +   +  P+A++++VRS+R G P S+A++++  +  DP+ SEF  + +    G
Sbjct: 136 HKAGKRMSMIEEQLPDAVELMVRSLRVGHPFSNAISIVSKEIQDPLASEFGVIADEAAYG 195

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A+
Sbjct: 196 RDLGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVKAI 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EAK S   +   P     ++    P Y + + + P       +   F+++ + VMR++
Sbjct: 256 TAEAKWSGKFLSGFPLAALVVINLGDPHYYDEVRDHPYFIPACFIVGMFLVLNLFVMRIL 315

Query: 183 INFDV 187
            N  V
Sbjct: 316 TNIKV 320


>gi|296122168|ref|YP_003629946.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014508|gb|ADG67747.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 321

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 103/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR  +F    P+A++++ R++R+G  ++  + ++  +   P+   FR   ETQ+LG+ +
Sbjct: 140 KKRFKQFAKQLPDAMELMGRALRSGHSLASGLHLVCDEMPPPISQVFRSAYETQNLGVPV 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++   ++ MP  +  FF T +++Q Q GG+L+E L  +S ++R+R  +   VQAL+ E
Sbjct: 200 ESALKESLKKMPNLDYKFFVTAVAIQRQTGGDLAEILDKISEVIRERFKILGTVQALTGE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  ++ ++P  +   VY+ +P Y+ VL     G  ++ V     ++G + ++ +I+ 
Sbjct: 260 GRLSGAVLMAMPIAIFFAVYYLNPNYVMVLFTTDLGKKMIAVGIVMQILGAVAIKKIIDI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|70734196|ref|YP_257836.1| hypothetical protein PFL_0694 [Pseudomonas fluorescens Pf-5]
 gi|68348495|gb|AAY96101.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 293

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 100/180 (55%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  + ++  P  LD  VRS+++G  ++DAV   +  S+DP++S   R+     LG+
Sbjct: 111 LYQRRLKRMIEQLPALLDHSVRSLKSGRTLADAVLGAIEASNDPLKSAMGRIQRNVQLGV 170

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +L +++S    +    E+  F+  + V  + GGN SE L NL +++R+R+    ++ A++
Sbjct: 171 NLPDAVSDFAEFYEQDELRMFALGLKVNHRYGGNASELLENLIKLIREREQGARQLSAMT 230

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +AW++G+LP  +      T+PGYM  + +D  G  +L  A    + G + +  M+
Sbjct: 231 GETRMTAWVLGTLPLLLVGYFMLTNPGYMLGMWHDSAGQKMLITAVCLQIFGCLALWRML 290


>gi|227114880|ref|ZP_03828536.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 326

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 101/181 (55%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     LG+ 
Sbjct: 144 LQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRLGIP 203

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+ + 
Sbjct: 204 LRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQSKTS 263

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+ +L P C++ L Y  SP   + L +DP G  +L  A   + +G+++  +M+
Sbjct: 264 EARASAKIVAALFPGCLAYL-YMKSPEDFSFLFSDPVGTTVLIYALCSVSVGMLITHVMV 322

Query: 184 N 184
            
Sbjct: 323 K 323


>gi|227326305|ref|ZP_03830329.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 326

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 101/181 (55%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     LG+ 
Sbjct: 144 LQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRLGIP 203

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+ + 
Sbjct: 204 LRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQSKTS 263

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+ +L P C++ L Y  SP   + L +DP G  +L  A   + +G+++  +M+
Sbjct: 264 EARASAKIVAALFPGCLAYL-YMKSPEDFSFLFSDPVGTTVLIYALCSVSVGMLITHVMV 322

Query: 184 N 184
            
Sbjct: 323 K 323


>gi|77456873|ref|YP_346378.1| type II secretion system protein [Pseudomonas fluorescens Pf0-1]
 gi|77380876|gb|ABA72389.1| putative Flp pilus assembly protein TadB [Pseudomonas fluorescens
           Pf0-1]
          Length = 293

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 98/178 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + ++  P  LD  VRS+++G  ++DAV   +  S DP++    RV     LG+SL
Sbjct: 113 QRRLRRMIEQLPQLLDHTVRSLKSGRTLADAVLGAIDASEDPLKHAMGRVQRNVQLGVSL 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  +       E+  F+  + V  + GGN SE L NL R++R+R     +++A++ E
Sbjct: 173 PEAVGDVAELYEKDELRLFAVGLKVNHRYGGNASELLENLIRMIRERDQASRQLRAMTGE 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +AW++G LP  ++     ++P Y+  + ND  G M+L  A    +IG +++  M+
Sbjct: 233 TRITAWVLGLLPVGLAGYFLLSNPKYLIAMWNDHSGQMMLASAFGLQVIGSLLLWRML 290


>gi|50119738|ref|YP_048905.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610264|emb|CAG73707.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 326

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 100/181 (55%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     LG+ 
Sbjct: 144 LQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLAGPLANEFKTIDHWLKLGIP 203

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LRDR+ ++ KVQ+ + 
Sbjct: 204 LRQVIQASATRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRDRRELQLKVQSKTS 263

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+  L P C++ L Y  SP   + L +DP G  +L  A   + +G+++  +M+
Sbjct: 264 EARASAKIVAMLFPGCLAYL-YMKSPDDFSFLFSDPVGTTVLIYALCSVSVGMLITHVMV 322

Query: 184 N 184
            
Sbjct: 323 K 323


>gi|253687072|ref|YP_003016262.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753650|gb|ACT11726.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 326

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 101/181 (55%), Gaps = 2/181 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     LG+ 
Sbjct: 144 LQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRLGIP 203

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+ + 
Sbjct: 204 LRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQSKTS 263

Query: 125 EAKASAWIIGSL-PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           EA+ASA I+ +L P C++ L Y  SP   + L +DP G  +L  A   + +G+++  +M+
Sbjct: 264 EARASAKIVAALFPGCLAYL-YMKSPDDFSFLFSDPVGTSVLIYALCSVSVGMLITHVMV 322

Query: 184 N 184
            
Sbjct: 323 K 323


>gi|197295160|ref|YP_002153701.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944639|emb|CAR57243.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 325

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G+SL 
Sbjct: 145 RRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALMNLATRVPVQDLRYFVIAVLIQRETGGNLAELLDSIAGLIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|167584965|ref|ZP_02377353.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 325

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+  D+I R++R+G   + A+ ++  + SDP+  EFR   +  + G+SL 
Sbjct: 145 RRMRKLERQLPDVCDMIARALRSGHAFTSAIGMVSDEFSDPMGGEFRITFDEINYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P++++ +F   + +Q + GGNL+E L +++ ++R+R  +  K++ LS E 
Sbjct: 205 DALMNLANRVPVRDLRYFVIAVLIQRETGGNLAELLDSIAALIRERFKLFDKIRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAW++G LPF  +  +   +P ++ VL  D  G  ++      M  G++ MR +I   
Sbjct: 265 RMSAWVLGLLPFATAGAMMVLNPEFLAVLWQDSAGIKMVATTLVSMAFGVLWMRRIIRIH 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|294140781|ref|YP_003556759.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
 gi|293327250|dbj|BAJ01981.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
          Length = 325

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 96/181 (53%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR      DFP+ LD+I R+++AG   +DA+ +   +   P+  EF+ +    +    + 
Sbjct: 145 KRMDTIEADFPDGLDVIRRALQAGYSFTDAIKLATEELEGPLAKEFKLMFVNINYTKDIK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   ++ +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+ LS E 
Sbjct: 205 RALLGFIQRVPSVSALAFASAVMVQRETGGNLAENIENLTRVIRQRFKFRRRVKTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +P Y+  L     GH LL   A  M IG   +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYLQTPSYVGELTGTEAGHKLLMWGAVGMTIGGWWISRIIKID 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|197118216|ref|YP_002138643.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197087576|gb|ACH38847.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 316

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 103/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR   F +  P+A+ ++ RS+RAG  ++ AV +I  +  +P+   F+   E Q LG+ +
Sbjct: 135 KKRRRLFAEQLPDAMVMMARSLRAGHSLAAAVELIGLELPEPIGGLFKLAYEQQKLGVRI 194

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++S+  +   +  Q+ +FF TV  + S+ GGNLSE L  L+  LR R  ++ +V+ ++ E
Sbjct: 195 ADSLISLRERVESQDFNFFLTVTRINSESGGNLSEILDKLAETLRSRLQIRRQVEVITAE 254

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S +++ +LP  +   +Y   PGY++V        ++LG A    ++G  ++R ++N 
Sbjct: 255 GRISGYVLVALPVVMFAGLYLLRPGYLDVFFTQRLCQLILGAAVLGQVVGFFIIRKIVNI 314

Query: 186 DV 187
            +
Sbjct: 315 SI 316


>gi|78060307|ref|YP_366882.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
 gi|77964857|gb|ABB06238.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
          Length = 325

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K     P+  D+I R++R+G   +  + ++  +  DP+  EFR   +  + G+SL 
Sbjct: 145 KRMRKLERQLPDICDMISRALRSGHSFTSTLGMVGDEFPDPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P+Q++ +F   + +Q + GGNL+E L  +S ++R+R  +  KV+ LS E 
Sbjct: 205 DALMNLATRVPVQDLRYFVIAVLIQRETGGNLAELLDCISALIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGGMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|325518834|gb|EGC98408.1| flp type pilus assembly protein [Burkholderia sp. TJI49]
          Length = 325

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 101/177 (57%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P+  D+I R++R+G   + A+ ++  +  +P+  EFR   +  + G+SL +++ 
Sbjct: 149 KLQRQLPDVCDMIARALRSGHAFTGALGMVGEEFPEPMGGEFRITFDEINYGVSLHDALM 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E + SA
Sbjct: 209 NLATRVPVQDLRYFVIAVLIQRETGGNLAELLDSIAGLIRERFKLFDKVRVLSAEGRLSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+G LPF  + L+   +  +++VL  DP G  + G     M+ G+  MR +I   V
Sbjct: 269 WILGLLPFGTAALMALLNRDFLSVLWEDPAGVRMTGTMLVSMVFGLFWMRRIIRIRV 325


>gi|99082190|ref|YP_614344.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038470|gb|ABF65082.1| hypothetical protein TM1040_2350 [Ruegeria sp. TM1040]
          Length = 322

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 97/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR AK  +  P+ ++++VRS+R G P S AV ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMAKIEEQLPDGVELMVRSLRVGHPFSSAVQIVAKEVEDPLATEFGIIADECAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ E
Sbjct: 201 GEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P  V      + P Y + +I+ P       +    +   I VMR + N 
Sbjct: 261 AQWSGKFLSGFPLFVLAGTLVSDPHYYDNVIDHPWFMPACFIVGGMLTANIFVMRKLTNI 320

Query: 186 DV 187
            V
Sbjct: 321 QV 322


>gi|258405284|ref|YP_003198026.1| Type II secretion system F domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797511|gb|ACV68448.1| Type II secretion system F domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 323

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 99/176 (56%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F+   P  LD++ RS++AG   +  + +   +  DP+  EF   ++  + G+ + +++ +
Sbjct: 148 FMAQLPEGLDLLARSLKAGHAFTTGMKLAAEEFGDPLGPEFDVALDEINFGVPVPDALRK 207

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           M   +   +++FF   + +Q + GGNL+E + +++ ++R+R     KV+AL+ E   S W
Sbjct: 208 MTYRVDCPDLNFFVVAVIMQRETGGNLAEIIESIATLIRERFKFFGKVKALAAEGVLSMW 267

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           ++  LPF +  ++ F +P Y+ +L  +  GH+++  A   M+IG   MR ++  DV
Sbjct: 268 VLIGLPFAIVGILTFMNPEYITLLFEETMGHIMIAGALIMMIIGYFFMRNIVKIDV 323


>gi|327189774|gb|EGE56918.1| putative tadB pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 317

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 103/180 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   F    P ALD+  RS+ AG P+  A+A++  +  DP+ +EF  + +    G++L 
Sbjct: 137 RRMKAFELKLPEALDVATRSLAAGHPLPAAIALVGREMPDPIGTEFGLLTDELTYGVTLD 196

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  ++AKV+A+S E 
Sbjct: 197 DALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRTMLRAKVRAISSEG 256

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A  +   PF +  ++   SP Y + + +   G  L+    A M IG +++  M+NF+
Sbjct: 257 RITAIFMSIYPFLLYAMIRALSPTYFDPVWDSGHGTTLVCALLAVMAIGNVILYKMVNFE 316


>gi|104779903|ref|YP_606401.1| type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
 gi|95108890|emb|CAK13586.1| Putative type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
          Length = 292

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 99/178 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +++  + ++  P  LD  VRS++AG  +SDAV   V  + +P+RS   RV     LG+ L
Sbjct: 112 RRQLRQIIEQLPGLLDYSVRSLKAGRTLSDAVLGGVEATREPLRSAMLRVRRNVQLGVPL 171

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++S +       E+  F+  + +  + GGN SE + NL +++R+ +    +++A++ E
Sbjct: 172 DDAVSELAELYGQDELRMFALGLRINQRHGGNASELMENLIKLIREHEQGDRQLRAMTGE 231

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +AWI+G+LP  +     F +PGY+  +  D  G M+L  A A   +G +V+  M+
Sbjct: 232 TRITAWILGALPLGMVGYFLFANPGYLMAMWRDSHGQMMLLFAFALQAVGCLVLWRMM 289


>gi|294012232|ref|YP_003545692.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675562|dbj|BAI97080.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 333

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 103/189 (54%), Gaps = 4/189 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  K  + FP ALD  VR +RAG P++ A+ ++  +  DP+ SEF  V++   
Sbjct: 147 LTRLAQRRRKKMEEQFPVALDTFVRGLRAGHPIAAALDLLTKEMRDPIGSEFGIVVDEVT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L +++ RM     + E+  F   +SVQS+ GGNL+E L NLS ++R+R ++  KV+
Sbjct: 207 YGSDLRDALQRMAERWDMNEMHMFVISLSVQSETGGNLAEILENLSTVIRERASLFMKVR 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA--AFMLIGIMV 178
           ALS E + +A ++ +LP      ++  +P +   +  D     ++G        LIG   
Sbjct: 267 ALSSEGRMTAVMLTALPILAFVGLFLVNPAFYLDVAQDS--MFIIGFVGLIVLYLIGFFT 324

Query: 179 MRLMINFDV 187
           +R M++  V
Sbjct: 325 IRRMVDLKV 333


>gi|86360588|ref|YP_472476.1| putative tadB pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284690|gb|ABC93749.1| putative tadB pilus assembly protein [Rhizobium etli CFN 42]
          Length = 317

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 103/180 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF    P ALD+  RS+ AG P+  A+A++  +  DP+ +EF  + +    G++L 
Sbjct: 137 RRMKKFELKLPEALDVANRSLAAGHPLPAAIALVAREMPDPIGTEFGLLSDELTYGVTLD 196

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LR R  +KAKV+A+S E 
Sbjct: 197 DALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRGRTMLKAKVRAISSEG 256

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A  +   PF +  ++   SP Y + L +   G  ++ V    M IG +++  M+NF+
Sbjct: 257 RITAIFMSVYPFLLYAMIKALSPTYFDPLWDSGYGTAVVSVLLVVMAIGNVILYKMVNFE 316


>gi|197106492|ref|YP_002131869.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
 gi|196479912|gb|ACG79440.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
          Length = 319

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 103/187 (55%), Gaps = 2/187 (1%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K +  +R A      P AL+IIVRS+ AG PV  A+A++  + SDPV +EF    +    
Sbjct: 134 KFVAGRRAAALGFQLPQALEIIVRSLEAGHPVPTAIALVGREMSDPVGTEFGMAADEIAY 193

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +L ++I RM       +V  F+  + +Q + GGNL+  L   +  +R+R  M+ K++A
Sbjct: 194 GANLEQAIERMAERCQHPDVDLFAATVRLQERTGGNLTGLLKLNASTIRERHKMRLKIKA 253

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM-LLGVAAAFMLIGIMVMR 180
            S E +ASA I+ + PF    ++   SP +   +I++P     LLG+   ++ IG +VMR
Sbjct: 254 ASAEGRASAMILSAAPFIAVGMIMIISPKFYGDVIHEPAVKWGLLGL-TVWVGIGNLVMR 312

Query: 181 LMINFDV 187
            MI+  +
Sbjct: 313 RMIDMKL 319


>gi|170720031|ref|YP_001747719.1| type II secretion system protein [Pseudomonas putida W619]
 gi|169758034|gb|ACA71350.1| type II secretion system protein [Pseudomonas putida W619]
          Length = 293

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 102/183 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + ++  P  LD  VRS++AG  ++DAV   +  S +P+RS   RV     
Sbjct: 108 LSWLCRRRVHQLVEQLPALLDYSVRSLKAGRTLNDAVLGGIDGSREPLRSTMTRVRRNVQ 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L ++++ +       E+  F+  + +  + GGN SE + NL +++R+R+    +++
Sbjct: 168 LGVPLDDAVNELAELYNQDELRLFAMGLRINQRYGGNTSELMENLIKLIREREQGSRQLK 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A I+G+LP C+       +P Y+  +  D  G M+L +A A  ++G +V+ 
Sbjct: 228 AMTGETRITAMILGALPLCMVGYFLMANPHYLLTMWQDSSGQMMLLLAFALQVVGCLVLW 287

Query: 181 LMI 183
            M+
Sbjct: 288 RMM 290


>gi|170692560|ref|ZP_02883722.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170142216|gb|EDT10382.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 327

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 103/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR        P A D+I R++RAG   S A+ ++  + ++P+  EFR V +  + G++L
Sbjct: 146 RKRLRVLERQLPEAADMISRALRAGHSFSSALGMLGSEFAEPMAGEFRIVFDEINYGVTL 205

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E++  +   +P+ ++ +F   + +Q + GGNL+E L +++ ++R R  +  KV+ LS E
Sbjct: 206 NEALLNLATRVPVGDLRYFVIAVLIQRETGGNLAEILDSIASLVRARLQLFDKVRVLSAE 265

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S WI+  LPF  +  +   +P + +VL  DP G  ++      M++GI+ MR ++  
Sbjct: 266 GRLSGWILALLPFASAGAMQVVNPTFFSVLWEDPAGLQIIETMLVSMVLGILWMRRIVQI 325

Query: 186 DV 187
            V
Sbjct: 326 RV 327


>gi|269926133|ref|YP_003322756.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789793|gb|ACZ41934.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 336

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 107/182 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R +      P A+D++  ++ AG  ++ A+ +   + S+P+  E  +V+  Q LGLS 
Sbjct: 155 KRRLSALERQLPGAIDVLAGALEAGSSLAQAMMLAAREMSNPISDELIKVVRDQELGLSQ 214

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++ RM+   P +++    T I++Q ++GG+L+  L ++S  +R+R  +K +++ L+ +
Sbjct: 215 EEALRRMLERCPSEDLDMMITAINIQYRVGGSLAHVLKSISTTIRERLRIKGEIKVLTAQ 274

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SA+I+ ++PF ++ +++  +  Y+  L     G ++L VA A +++G  +MR +I  
Sbjct: 275 GRISAYIVTAIPFLLTAVIFLLNRSYIMPLFTTNMGRIMLAVALAGIMMGYYMMRRIIAI 334

Query: 186 DV 187
            V
Sbjct: 335 KV 336


>gi|307294431|ref|ZP_07574275.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880582|gb|EFN11799.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 333

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 89/151 (58%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  K  + FP ALD  VR +RAG P++ A+ ++  +  DP+ SEF  V++   
Sbjct: 147 LTRLAQRRRKKMEEQFPVALDTFVRGLRAGHPIAAALDLLTKEMRDPIGSEFGIVVDEVT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L +++ RM     + E+  F   +SVQS+ GGNL+E L NLS ++R+R ++  KV+
Sbjct: 207 YGADLRDALQRMAERWDMNEMHMFVISLSVQSETGGNLAEILENLSAVIRERASLFMKVR 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGY 151
           ALS E + +A ++ +LP      ++  +P +
Sbjct: 267 ALSSEGRMTAVMLTALPILAFVGLFLVNPAF 297


>gi|326797331|ref|YP_004315151.1| type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
 gi|326548095|gb|ADZ93315.1| Type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
          Length = 327

 Score =  104 bits (259), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 98/182 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++ + K   +F  + P A+D IVR V+AG+P ++A  +I      P+  E   + +   L
Sbjct: 141 RNAMGKHLKEFKQNLPQAIDSIVRVVKAGVPATNAFGLIANNLPGPLAKELALIDKWLSL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GLSL +++      +PL E  FF+ ++ +  + GG LS+ L  LS  LR+R+ +  K++A
Sbjct: 201 GLSLRQAMQDSAIRVPLNEYRFFAVILVINQEAGGRLSDTLERLSETLRERQELALKIRA 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + E +ASA I+  L       +YF SP     L++DP G+ +L  A   +L G+ +   
Sbjct: 261 KTSEVRASAVIVAMLAPLSLAYMYFNSPKDFQFLLSDPTGNSVLIYAFGSVLTGLAITHF 320

Query: 182 MI 183
           MI
Sbjct: 321 MI 322


>gi|254461341|ref|ZP_05074757.1| type II secretion system protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206677930|gb|EDZ42417.1| type II secretion system protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 322

 Score =  104 bits (259), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  KKR +   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +   
Sbjct: 136 ISHKAKKRMSMLEEQLPDAVELMVRSLRVGHPFSSAVQIVAKEVQDPLASEMGVIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   +  Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKAMAERLDNQDLRFLAVAVTIQQQSGGNLAEILAGLAQVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   + S P      +    P Y + +++         + AAF+ + ++VMR
Sbjct: 256 AITAEAQWSGKFLSSFPLMALVAIQLGDPNYYDPVLDHEWFIPACFLVAAFLGVNLIVMR 315

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 316 ILVNIKV 322


>gi|168702878|ref|ZP_02735155.1| secretion system protein TadB [Gemmata obscuriglobus UQM 2246]
          Length = 319

 Score =  103 bits (258), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 102/180 (56%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R   F    P+A++++ R++RAG  ++  + V+  +   P+  EF RV E Q+LG+ L E
Sbjct: 140 RLKAFAAQLPDAMELVARALRAGHSLAAGMHVVAEEMPAPICKEFGRVYEEQNLGIPLEE 199

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  M   +P  ++ FF T +++Q Q GG+L+E L  +  I+R+R  +  +V+AL+ E +
Sbjct: 200 ALKGMCDRVPNLDLKFFVTSVAIQRQTGGDLAEILDRIGHIIRERFKILGQVKALTAEGR 259

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            S  ++ +LP  +  ++ +T P Y+ +L  D  G  +   A   MLIG   ++ +++  V
Sbjct: 260 LSGVVLIALPIGLFVMMLWTKPDYVEMLWKDDLGIKMSIGAIVLMLIGSYAIKKIVDIKV 319


>gi|115361040|ref|YP_778177.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115286368|gb|ABI91843.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 325

 Score =  103 bits (258), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 101/177 (57%), Gaps = 1/177 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M+H   +R  K     P+  D+I R++R+G   S A+ ++  +  DP+  EFR   +  +
Sbjct: 140 MRHR-NRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPDPMGGEFRITFDEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+
Sbjct: 199 YGVSLHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
            LS E + SAWI+G LPF  + ++   +  +++VL  DP G  ++GV    M  G++
Sbjct: 259 VLSAEGRLSAWILGLLPFGTAAMMAMMNREFLSVLWQDPAGIKMVGVMLGSMAFGLL 315


>gi|254255260|ref|ZP_04948576.1| Flp pilus assembly protein TadB [Burkholderia dolosa AUO158]
 gi|124900997|gb|EAY71747.1| Flp pilus assembly protein TadB [Burkholderia dolosa AUO158]
          Length = 325

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 101/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+  D+I R++R+G   +  + ++  +  DP+  EFR   +  + G+ L+
Sbjct: 145 RRMRKLQRQLPDVCDMIARALRSGHSFTSTLGMVGDEFPDPMGGEFRVTFDEVNYGVPLN 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALKNLATRVPAQDLRYFVIAVLIQRETGGNLAELLDSIAALIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF    ++   +  +++VL  DP G  ++G     M  G++ +R ++   
Sbjct: 265 RLSAWILGLLPFGTGAVMALVNREFLSVLWQDPAGIRMVGTMLVSMAFGLLWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|152994351|ref|YP_001339186.1| type II secretion system protein [Marinomonas sp. MWYL1]
 gi|150835275|gb|ABR69251.1| type II secretion system protein [Marinomonas sp. MWYL1]
          Length = 329

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 98/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++ + K   +F  + P A+D IVR  RAG+PVS+A  ++      P+  EF  V +   L
Sbjct: 143 RNAMAKHLKEFKQNLPQAIDSIVRIARAGVPVSNAFNLVAENLPGPLAKEFSLVDKWLRL 202

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L +++    + +PL E  FF  ++ +  + GG LS+ L  L+  LR+R+ +  K++A
Sbjct: 203 GVPLRQAMQDSAKRVPLNEYRFFVVILIINQEAGGRLSDTLERLAHTLRERQELALKIRA 262

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + E +ASA I+ SL       +Y  SP     L+ND  G+ +L  A   +L+G+ +   
Sbjct: 263 KTSEVRASAVIVASLAPLSLAYMYLNSPKDFQFLLNDSTGNNVLFYAFGSVLLGLSITHF 322

Query: 182 MIN 184
           MI 
Sbjct: 323 MIK 325


>gi|254441335|ref|ZP_05054828.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251413|gb|EDY75728.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 322

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 101/182 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P S AVA++  +  DP+ +E   + +    G  +
Sbjct: 141 KKRISMIEEQLPDAVELMVRSLRVGHPFSSAVAIVAKEVPDPLGTEMGVISDEAAYGRDM 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ES+ +M   M +Q++ F +  +++Q+  GGNL+E L  LS+++R R  +  +V+A++ E
Sbjct: 201 GESLKQMADRMDMQDMRFLAVAVTIQATAGGNLAEILHGLSQVIRARFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   +   P     ++    P Y + +           V AAF+++ ++VMR ++N 
Sbjct: 261 AKWSGMFLSVFPLGALVMINVLQPTYYDAVKETSVFIPACLVVAAFLVVNVIVMRRLVNI 320

Query: 186 DV 187
            V
Sbjct: 321 QV 322


>gi|126725974|ref|ZP_01741816.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2150]
 gi|126705178|gb|EBA04269.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2150]
          Length = 323

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 101/182 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR     +  P+A++++VRS++ G P S A+A +  +S DP+ +EF  + +    G  +
Sbjct: 142 KKRLGMMEEQLPDAIELMVRSLKVGHPFSSAIAAVAAESPDPIGTEFGVIADEAAYGGEI 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++S+  M   + +Q++ F + V+ +Q++ GGNL+E L  L+ ++R R  +  KV A++ E
Sbjct: 202 TDSLQEMAERLDMQDLRFLAVVVGIQAKSGGNLAEILEGLASVIRSRFRLFRKVAAITAE 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S + + + P      +  T P + + ++        + V A  ++I I+ MR+M N 
Sbjct: 262 AKFSGFFLSAFPILALIGMLITKPDFYDEVMETSMFVPAVIVVAFLLIINIVFMRVMTNI 321

Query: 186 DV 187
            V
Sbjct: 322 KV 323


>gi|149175287|ref|ZP_01853909.1| secretion system protein TadB [Planctomyces maris DSM 8797]
 gi|148845896|gb|EDL60237.1| secretion system protein TadB [Planctomyces maris DSM 8797]
          Length = 323

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 104/181 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF    P+AL+++ R++R+G  +S  ++V+V +   P+ +EF    E Q+LG+ + 
Sbjct: 143 RRFKKFGQQLPDALELVGRALRSGHSLSSGLSVVVQEMPPPISTEFALAYEEQNLGIPIG 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M+  MP  ++ FF T + +Q Q GG+L+E L  +  I+R R  +  +VQAL+ E 
Sbjct: 203 EALKNMLTRMPNLDLKFFVTAVVIQRQAGGDLAEILDKIGYIIRQRFKIMGQVQALTGEG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + S  ++ +LP  +   VY+ +P Y+ +L  D  G  ++       ++G + ++ ++N  
Sbjct: 263 RISGVVLMALPIALFFAVYYLNPDYVMLLFTDELGRKMIAGGIVLQVLGALWIKKIVNIK 322

Query: 187 V 187
           +
Sbjct: 323 I 323


>gi|225181995|ref|ZP_03735427.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167280|gb|EEG76099.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 319

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   KR  KF D   +AL I+  S+RAG     A+  +  +   P+ +EF R ++   
Sbjct: 133 LKNAKMKRLQKFNDQLGDALGIMSNSLRAGFSFLQAMDSLSKELPPPISTEFGRALKEMR 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG    E+++ M   +   ++    T +++Q Q+GGNL+E L N+   + +R  MK +++
Sbjct: 193 LGTPTEEALANMTERIRSDDLDLIVTAVNIQRQVGGNLAEILDNIGNTISERVRMKGEIK 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+  LP  +  ++   +P Y+ +L   P G +L+G A    LIGIM+++
Sbjct: 253 TLTAQGRISGTIVALLPVFLVGVISVMNPSYIGLLFTHPLGLILIGGAVISELIGIMLIK 312

Query: 181 LMINFDV 187
            +IN ++
Sbjct: 313 KVINIEL 319


>gi|209546475|ref|YP_002278393.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537719|gb|ACI57653.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 317

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 105/180 (58%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF    P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G++L 
Sbjct: 137 RRMRKFELKLPEALDVANRSLAAGHPLPAAISLVAREMPDPIGTEFGLLSDELTYGVTLD 196

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  +KAKV+A+S E 
Sbjct: 197 DALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRSMLKAKVKAISSEG 256

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A  +   PF +  ++   SP Y + +     G +++ V  A M IG +++  M+NF+
Sbjct: 257 RITAIFMSMYPFLLYAMIKALSPTYFDPVWESGHGAVVVTVLLAVMAIGNVILYKMVNFE 316


>gi|153834070|ref|ZP_01986737.1| Flp pilus assembly protein TadB [Vibrio harveyi HY01]
 gi|148869625|gb|EDL68615.1| Flp pilus assembly protein TadB [Vibrio harveyi HY01]
          Length = 322

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 101/188 (53%), Gaps = 2/188 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKMIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LSRILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSRILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVM 179
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   + + IG + +
Sbjct: 256 TISAESRMSAWVLVLAPFGLYIIISLVRPDYIELLHTSPMGIKMVIGGMIS-LFIGTLWI 314

Query: 180 RLMINFDV 187
           R ++N +V
Sbjct: 315 RKIVNIEV 322


>gi|148657457|ref|YP_001277662.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148569567|gb|ABQ91712.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 335

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 104/176 (59%), Gaps = 4/176 (2%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +F D  P  LD+I  S+R G  +  ++A +     +P R+E RRV +   LGLS+++++ 
Sbjct: 159 EFNDQLPETLDLITASMRGGFSLVQSLASVASDVQEPTRTELRRVFQEVQLGLSVTQALD 218

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +V+ M   ++    T I + +++GGNL + L N+S  +R+R  ++ +V+ ++   + S+
Sbjct: 219 NLVQRMESADLDLVVTAIKIHARVGGNLGQILENISTTMRERAKLRREVRVITSMQRISS 278

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFM--LIGIMVMRLMIN 184
           ++IG+LPF ++ +++  +P YM  L     G +L     AF+  ++G +++R +++
Sbjct: 279 YVIGALPFALALIIFTINPTYMMRLFQP--GLILCIPIGAFISSVVGFLIIRKIVD 332


>gi|172065280|ref|YP_001815992.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171997522|gb|ACB68439.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 325

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 101/177 (57%), Gaps = 1/177 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M+H   +R  K     P+  D+I R++R+G   S A+ ++  +  DP+  EFR   +  +
Sbjct: 140 MRHR-NRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPDPMGGEFRITFDEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+
Sbjct: 199 YGVSLHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
            LS E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     M +G++
Sbjct: 259 VLSAEGRLSAWILGLLPFGTAAMMAMLNREFLSVLWQDPAGIKMVGAMLGSMALGLL 315


>gi|260463898|ref|ZP_05812094.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030273|gb|EEW31553.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 104/180 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +F    P AL++I R ++AG PV  A+A++  +  DP+ +EF  + +    G  L
Sbjct: 140 KRRLKRFGMQLPEALELITRGLKAGHPVPVAIAMVSREMPDPIGTEFGVIADEVTYGSDL 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++ +   +  +++  F T +S+QS  GGNL E L  L+  +R+R  ++ KV+A+S E
Sbjct: 200 VSALNSLFDRVGHEDLPLFMTAVSIQSSSGGNLREILDGLALTIRERGKLRRKVRAISTE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SA+I+ ++P  +   +    PG+   + ++P+   L+G +  ++++G ++M  M NF
Sbjct: 260 GRLSAYILTAIPALLFAGIMAMMPGFYRDVWDEPKTWYLIGGSVTWLMLGNLMMFKMSNF 319


>gi|116671480|ref|YP_832413.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611589|gb|ABK04313.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 310

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 95/182 (52%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  KR A+F     + L ++   +RAG  +  A+     +S  P   E RRVI    LG 
Sbjct: 127 LAGKRRARFDQQLGDTLQLLAGGLRAGHSILRAIDAAAAESQSPTSEEMRRVITETSLGR 186

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  S++     M  ++  + +  I +  ++GGNL+E L  ++  +R+R  +K  ++AL+
Sbjct: 187 DLLASLTDTSERMKNEDFVWIAQAIQINREVGGNLAEVLDQVNETIRERSEIKGHIKALA 246

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E K SA+I+ ++P  +  ++   +PGYM+ +   P G  ++  +  FM IG + MR +I
Sbjct: 247 AEGKFSAYILIAMPIGIVLMLMAVNPGYMDAMFTHPLGWAMIAASVVFMTIGSLWMRKII 306

Query: 184 NF 185
           + 
Sbjct: 307 DL 308


>gi|320101694|ref|YP_004177285.1| type II secretion system F domain-containing protein [Isosphaera
           pallida ATCC 43644]
 gi|319748976|gb|ADV60736.1| Type II secretion system F domain protein [Isosphaera pallida ATCC
           43644]
          Length = 331

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 104/188 (55%), Gaps = 1/188 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + ++ KKR   F    P AL++  R++RAG  +   + ++  + + P+  EF RV E Q+
Sbjct: 144 LNYMKKKRINDFTAAMPEALELTGRALRAGHGLGSGLKMVADEMTGPIAEEFGRVFEEQN 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++  M   +P  +V FF T + +Q Q GG+L E L  +S ++R R  +K +V 
Sbjct: 204 LGIPMEEALRAMANRIPTMDVRFFVTAVVIQRQTGGDLGEVLDKISHLIRQRFEIKGQVA 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPR-GHMLLGVAAAFMLIGIMVM 179
           AL+ E + S  ++ ++P  +   ++ T+  Y+  L  DP  G  +L  AA   ++G + +
Sbjct: 264 ALTGEGRLSGAVLLAMPPLLLLYLFMTNRPYVMPLFTDPELGQPMLIGAAVLQILGALAI 323

Query: 180 RLMINFDV 187
           R +++  V
Sbjct: 324 RKIVDIKV 331


>gi|85705156|ref|ZP_01036256.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670478|gb|EAQ25339.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 322

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 98/181 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMALLEEQLPDAIELMVRSLRVGHPFSSAIGIVATEVGDPLATEFGIIADEAAYGRDMG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K S   +   P      +    P Y N  +        + V   F+++ ++VMR ++N  
Sbjct: 262 KWSGKFLSGFPIMALIGIQVIKPDYYNEAMEHAFFIPAVLVVGVFLVMNLIVMRALVNIK 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|170700845|ref|ZP_02891834.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170134253|gb|EDT02592.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 325

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 101/177 (57%), Gaps = 1/177 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M+H   +R  K     P+  D+I R++R+G   S A+ ++  +  +P+  EFR   +  +
Sbjct: 140 MRHR-NRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPEPMGGEFRITFDEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+
Sbjct: 199 YGVSLHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
            LS E + SAWI+G LPF  + ++   +  +++VL  DP G  ++GV    M  G++
Sbjct: 259 VLSAEGRLSAWILGLLPFGTAAMMAMVNREFLSVLWQDPAGIKMVGVMLGSMAFGLL 315


>gi|127511577|ref|YP_001092774.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636872|gb|ABO22515.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 283

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 100/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L K+R  KF+   P+AL++I  S+++G  VS+A+  +  +   P++ EF+  +  Q L
Sbjct: 98  QFLHKRRRRKFVHQLPDALNMIASSMQSGANVSNAIEFMAEEMEAPIKQEFQLFLREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  M + +P +E    +  + +  ++GGNL+E L  LS  LR +  M+ K+ A
Sbjct: 158 GVEFNTALDNMFKRIPEEEFQLVTAGMQISREVGGNLAEVLQRLSATLRKKIEMEGKIDA 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +  ++Y   P  M  ++ +P G  L+ +    +  G + +R 
Sbjct: 218 LTSQGKMQGIVMTLLPVFIGVVLYHMEPSAMGRILTEPMGWALIALVIIMLTSGYLSIRK 277

Query: 182 MINFDV 187
           ++  DV
Sbjct: 278 IVAIDV 283


>gi|218663020|ref|ZP_03518950.1| putative tadB pilus assembly protein [Rhizobium etli IE4771]
          Length = 317

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 103/180 (57%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF    P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G++L 
Sbjct: 137 RRMKKFELKLPEALDVANRSLAAGHPLPAAISLVGREMPDPIGTEFGLLSDELTYGVTLD 196

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   + ++++   +  +SVQ+  GGNL E L NLS+ LRDR  ++AKV+A+S E 
Sbjct: 197 DALVNLADRVGVEDLDLLAISLSVQAGTGGNLVEILQNLSKTLRDRTMLRAKVRAISSEG 256

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A  +   PF +  ++   SP Y + + +   G  ++    A M +G +++  M+NF+
Sbjct: 257 RITAIFMSVYPFLLYAMIKALSPTYFDPVWDSGHGTTVVCALLAVMAVGNVILYKMVNFE 316


>gi|51245381|ref|YP_065265.1| TadB [Desulfotalea psychrophila LSv54]
 gi|50876418|emb|CAG36258.1| related to TadB [Desulfotalea psychrophila LSv54]
          Length = 317

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 99/181 (54%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R   F + FP+ALD++  +++AG  +  ++ ++  +   P+  EF  V+E  + G S+
Sbjct: 136 RQRRINFEEHFPDALDLMGYAMKAGHSIMASLKMVSEEMPAPINEEFAIVVEEINFGKSI 195

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++    + +   E+ +F T + VQ + GGNL E L  +S I+R +   + +V+ALS E
Sbjct: 196 DSTLRNFAKRVDSTELRYFVTSVIVQRETGGNLVEILEKISAIIRKKFRFRERVRALSAE 255

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            K SA I+ +LPFC++  V   +  Y+ +LI DP G  L+  A   M  G  ++   +  
Sbjct: 256 GKLSAIILVALPFCIALAVSVLNKEYVAILITDPIGPYLITGAVIMMSFGSFIIYKFVQL 315

Query: 186 D 186
           D
Sbjct: 316 D 316


>gi|77462449|ref|YP_351953.1| putative Flp pilus assembly protein TadB [Rhodobacter sphaeroides
           2.4.1]
 gi|126461327|ref|YP_001042441.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638312|ref|YP_002524574.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
 gi|77386867|gb|ABA78052.1| Putative Flp pilus assembly protein TadB [Rhodobacter sphaeroides
           2.4.1]
 gi|126102991|gb|ABN75669.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159093|gb|ACM00073.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
          Length = 322

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 97/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 AECIRAFAERMESQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   + + P      +    P Y + +   P       V  AF++  ++ M++M+N 
Sbjct: 261 AKWSGTFLSAFPIVALVAISILKPDYYDGVKETPLFIPAALVVGAFLIANVIFMKIMVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|269960463|ref|ZP_06174835.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834540|gb|EEZ88627.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 322

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 101/188 (53%), Gaps = 2/188 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKMIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGNEMSAPLGPEFLNTFNMLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS+ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSQILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVM 179
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   + + IG + +
Sbjct: 256 TISAESRMSAWVLVLAPFGLYVIISLIRPEYIELLHTTPMGVKMIIGGMVS-LFIGTIWI 314

Query: 180 RLMINFDV 187
           R ++N +V
Sbjct: 315 RKIVNIEV 322


>gi|146276357|ref|YP_001166516.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554598|gb|ABP69211.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 322

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 98/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 AECIRAFAERMDSQDLRFLAVAVNIQQQSGGNLAEILEGLAKVIRSRFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   + + P     ++    P Y + +   P       V  AF++  ++ M++M+N 
Sbjct: 261 AKWSGTFLSAFPIVALVMISVLKPDYYDGVKETPLFIPAALVVGAFLVANVIFMKIMVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|332560333|ref|ZP_08414655.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
 gi|332278045|gb|EGJ23360.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
          Length = 322

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 97/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 AECIRAFAERMESQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   + + P      +    P Y + +   P       V  AF++  ++ M++M+N 
Sbjct: 261 AKWSGTFLSAFPIVALVAISILKPDYYDGVKETPLFIPAALVVGAFLIANVIFMKIMVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|325964125|ref|YP_004242031.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470212|gb|ADX73897.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 310

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 95/185 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR A F     + L ++   +RAG  +  A+     +S  P   E RRVI    
Sbjct: 124 LGFLAGKRRAAFDSQLGDTLQLLSGGLRAGHSILRAIDAAAAESQKPTSEEMRRVITETS 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  +++     M  ++  + S  I +  ++GGNL++ L      +R+R  +K  ++
Sbjct: 184 LGRDLLAALNDTAERMQNEDFVWISQAIQINREVGGNLADVLDQTGETIRERSEIKGHIK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+I+ ++PF +  ++   SP YMN + + P G  ++GV+   M IG + MR
Sbjct: 244 ALAAEGKFSAYILIAMPFGIVAMLVAMSPTYMNSMFSHPLGWAMIGVSFVLMTIGALWMR 303

Query: 181 LMINF 185
            +I+ 
Sbjct: 304 KIIDL 308


>gi|212635450|ref|YP_002311975.1| Tight adherence TadB-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556934|gb|ACJ29388.1| Tight adherence TadB-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 325

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 98/181 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K  + FP+ALD++ R+++AG   SDAV ++  +   P+  EF  +    +      
Sbjct: 145 KRMDKIEESFPDALDVLRRALQAGYSFSDAVKLVTEEMEGPLAKEFSLMFANINYSKDTK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      F++ + VQ + GGNL+E + NLSR++R R   + +V+ LS E 
Sbjct: 205 RALLSFIERVPSVSAMAFASAVMVQKETGGNLAENIQNLSRVIRLRFTFRRRVRTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +PGY+  L     GH LL   A  M +G + +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGHKLLMWGAIGMFVGGLWISKIIRID 324

Query: 187 V 187
           +
Sbjct: 325 M 325


>gi|28899185|ref|NP_798790.1| putative tight adherence TadB-like transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836794|ref|ZP_01989461.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|260361576|ref|ZP_05774603.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
 gi|260876733|ref|ZP_05889088.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|260898189|ref|ZP_05906685.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|260900404|ref|ZP_05908799.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|28807409|dbj|BAC60674.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749940|gb|EDM60685.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|308089098|gb|EFO38793.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|308091412|gb|EFO41107.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|308109112|gb|EFO46652.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308114015|gb|EFO51555.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
          Length = 322

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       + G  
Sbjct: 140 IADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++ +S 
Sbjct: 200 LRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIKTISA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVMRLMI 183
           E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   A + IG + +R ++
Sbjct: 260 ESRMSAWVLVLAPFALYVIISLVRPEYIELLHTHPMGIKMVIGGMVA-LFIGTLWIRKIV 318

Query: 184 NFDV 187
           N +V
Sbjct: 319 NIEV 322


>gi|328474277|gb|EGF45082.1| putative tight adherence TadB-like transmembrane protein [Vibrio
           parahaemolyticus 10329]
          Length = 322

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       + G  
Sbjct: 140 IADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++ +S 
Sbjct: 200 LRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIKTISA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVMRLMI 183
           E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   A + IG + +R ++
Sbjct: 260 ESRMSAWVLVLAPFALYVIISLVRPEYIELLHTHPMGIKMVIGGMVA-LFIGTLWIRKIV 318

Query: 184 NFDV 187
           N +V
Sbjct: 319 NIEV 322


>gi|325108940|ref|YP_004270008.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324969208|gb|ADY59986.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 323

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 95/161 (59%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P+AL+++ R++R+G  ++  + V+V +  DP+  EF    E Q+LG+ + +++  +  
Sbjct: 151 QLPDALELVARALRSGHSLASGLQVVVQEMPDPISREFGMAYEEQNLGVPIDQALKNVFH 210

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P  +  FF+T +++Q Q GG+L+E L  +  I+R+R  +  +VQAL+ E + S  ++ 
Sbjct: 211 RVPNLDFKFFATAVAIQRQSGGDLAEILDKIGHIIRERFRIMGQVQALTGEGRISGIVLM 270

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           +LP  +  ++Y+ +P YM +L  +  G  ++  A    ++G
Sbjct: 271 ALPIVLFFVMYYLNPEYMMLLFTEEMGRKMIAGAVVMQILG 311


>gi|260574612|ref|ZP_05842615.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023029|gb|EEW26322.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 322

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 99/182 (54%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P + A+A++  + +DP+ +EF  + +    G  +
Sbjct: 141 KKRIALMEEQLPDAVELMVRSLRVGHPFASAIAIVSKEVADPLGTEFGIIGDEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +ES+      M  Q++ F S  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 TESLKAFAERMDNQDLRFLSVAVTIQQQSGGNLAEILEGLAKVIRARFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   + + P     ++    P Y + +           V   F+ I ++ M++M+N 
Sbjct: 261 AKWSGMFLSAFPIGALVMILMLKPDYFDKVKETSAFVPAALVVGVFLTINVIFMKMMVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|254229336|ref|ZP_04922753.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262393423|ref|YP_003285277.1| flp pilus assembly protein TadB [Vibrio sp. Ex25]
 gi|151938144|gb|EDN56985.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262337017|gb|ACY50812.1| flp pilus assembly protein TadB [Vibrio sp. Ex25]
          Length = 322

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       + G  
Sbjct: 140 IADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFMNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++ +S 
Sbjct: 200 LRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIKTISA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVMRLMI 183
           E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   A + IG + +R ++
Sbjct: 260 ESRMSAWVLVLAPFGLYVIISLVRPEYIELLHTHPMGIKMVIGGMVA-LFIGTLWIRKIV 318

Query: 184 NFDV 187
           N +V
Sbjct: 319 NIEV 322


>gi|116671472|ref|YP_832405.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611581|gb|ABK04305.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 316

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 97/180 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R A+F     + L ++   +RAG  V  A+  +  ++S+P  +EF RV+    
Sbjct: 130 LSFLTQRRRARFEAQLGDTLTMVSGGLRAGHSVLRAIDAVAQEASEPTATEFSRVVNETR 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L +S++ +   M  ++ ++ +  I +  ++GG+L+E    +   +R+R  +K  V+
Sbjct: 190 LGRDLQDSLNDVSLRMKSEDFNWMAQAIEINREVGGDLAEVFDQVGETIRERSQIKGMVK 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E K SA I+ +LP  +  L+   +P Y   L   P G M+LG+A   M IG + +R
Sbjct: 250 ALSAEGKLSAIILMALPVLLFILIGLANPKYSGQLTGHPIGWMMLGIAVVMMTIGGLWIR 309


>gi|319941898|ref|ZP_08016219.1| hypothetical protein HMPREF9464_01438 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804551|gb|EFW01421.1| hypothetical protein HMPREF9464_01438 [Sutterella wadsworthensis
           3_1_45B]
          Length = 292

 Score =  100 bits (249), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 103/175 (58%), Gaps = 8/175 (4%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF-RRVIE---TQHLGLSLSE 67
           FL  FP A+D   RS++AG+PV  A+  I+G++ D    EF RRV++      +GL   E
Sbjct: 116 FLSRFPEAVDNFTRSIQAGIPVDRALK-ILGEAYD---DEFGRRVLKLCREMKVGLPFRE 171

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++      +   +V FF  V+++  + G  LS  LA+LS +LR+R+ +  K++AL+ E++
Sbjct: 172 ALGNFADELDDPDVDFFCEVLALNRETGSALSPMLASLSMMLRERRAIDRKLKALTSESR 231

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           ASA ++  LP  +  L  F +P  +  L+NDP G ++ G A A ML G ++++ M
Sbjct: 232 ASARVLCLLPVFILGLQAFLNPSQLLFLVNDPAGRIVAGCALACMLAGFIIIQRM 286


>gi|269836552|ref|YP_003318780.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785815|gb|ACZ37958.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 326

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 105/182 (57%), Gaps = 1/182 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++RT  F++   + + ++  S+RAG  +   + ++  ++  P+  EFRRV+    LG+  
Sbjct: 146 RRRTNAFVNQLGDTITLMANSLRAGYSLLQTMELVARETPPPMSEEFRRVVREVGLGIPT 205

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++S ++R +P +++    T I+VQ ++GGNL++ L  +   +R+R  +K +++ L+ +
Sbjct: 206 QEAMSHLLRRVPSEDLDLLITAINVQHEVGGNLAQILDVIGETIRERVRIKGEIRVLTAQ 265

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              S +II +LP  ++ L+   +PGY+  ++  P   M +G     + +G + MR ++N 
Sbjct: 266 QSISGYIISALPVGLALLLMVINPGYVMGMMRWPWICMPIG-GVVLIFLGFIAMRKIVNI 324

Query: 186 DV 187
           +V
Sbjct: 325 EV 326


>gi|227819313|ref|YP_002823284.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|227338312|gb|ACP22531.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 317

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 104/179 (58%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF +  P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G++L +
Sbjct: 138 RIRKFAEKLPEALDVANRSLAAGHPLPAAISLVAREMPDPIGTEFGLLSDELTYGVTLDD 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  +KAKV+++S E +
Sbjct: 198 ALMNLNDRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRFMLKAKVKSISAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            +A  +   PF +  ++   +P Y + + +   G +++      M IG +++  M+NF+
Sbjct: 258 ITAIFMSLYPFLLFGMIRTLAPTYFDPVWDSGYGTIIVSSLLVVMAIGNVILYKMVNFE 316


>gi|317122044|ref|YP_004102047.1| type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
 gi|315592024|gb|ADU51320.1| Type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
          Length = 401

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 99/182 (54%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R   F    P+AL ++  ++++G     A  V+  +   P+  EF  +++   + + L
Sbjct: 220 RQRLQAFDAQLPDALTLMANALKSGYSFLQAADVVAREMPAPIAEEFGWLVKETRVNIPL 279

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++++ ++  +P  ++    T + +Q Q+GGNL+  L   +  +R+R  ++ +++ L+ +
Sbjct: 280 EDALANLLDRVPSPDLDLVVTAVLIQKQVGGNLAGVLERTAETIRERVRLQGQIRTLTAQ 339

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S WI+GSLP  +  L+   +P Y+  L+  P G MLLG      + G++V+R +I  
Sbjct: 340 GRLSGWIVGSLPVALLVLLSAMNPAYLQPLLATPVGWMLLGAGVVMEVAGVLVIRALIRV 399

Query: 186 DV 187
           D+
Sbjct: 400 DI 401


>gi|56697923|ref|YP_168294.1| TadC family type II/IV secretion system protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679660|gb|AAV96326.1| type II/IV secretion system protein, TadC subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 322

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 105/188 (55%), Gaps = 12/188 (6%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P++++++VRS+R G P+  A+ ++  +S DP+ +EF  + +    G  +
Sbjct: 141 KKRLSLIEEQLPDSVELMVRSLRVGHPLVSAIQIVAKESEDPIATEFGIIADEAAYGREV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F S  +++Q Q GGNL+E LA L++++R R  +  +V+A++ E
Sbjct: 201 GEALKEMAERLDMQDLRFLSVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM------VM 179
           A+ S   + + P      +    P Y + +++    H L  + A F ++G+M      VM
Sbjct: 261 AQWSGKFLSAFPLGALLFILVKDPNYYDGVMD----HELF-IPACF-VVGVMLTMNLFVM 314

Query: 180 RLMINFDV 187
           R++ N  V
Sbjct: 315 RMLTNIKV 322


>gi|259417689|ref|ZP_05741608.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346595|gb|EEW58409.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 322

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 95/182 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR AK  +  P+ ++++VRS+R G P S AV ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMAKLEEQLPDGVELMVRSLRVGHPFSSAVQIVAKEVDDPLATEFGIIADECSYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ E
Sbjct: 201 GEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P           P Y + +++ P       +    +   I VMR + + 
Sbjct: 261 AQWSGKFLSGFPLFTLGGTLVMDPHYYDSVLDHPWFMPACFIVGGMLTANIFVMRKLTDI 320

Query: 186 DV 187
            V
Sbjct: 321 QV 322


>gi|260431088|ref|ZP_05785059.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414916|gb|EEX08175.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 322

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 100/188 (53%), Gaps = 2/188 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  KKR A   +  P+A++++VRS+R G P   ++ ++  +  DP+ +EF  + +   
Sbjct: 136 VNHKAKKRMALLEEQLPDAVELMVRSLRVGNPFVSSIQIVANEVQDPLGTEFGVIADECA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  + +Q Q GGNL+E LA L++++R R  +  +V 
Sbjct: 196 YGRGVGEALKDMAERLDMQDLRFLAVAVGIQQQSGGNLAEILAGLAKVIRARFRLFRRVN 255

Query: 121 ALSMEAKASAWIIGSLP-FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           A++ EAK S   +   P FC+   +    P Y + +++ P            + + ++VM
Sbjct: 256 AITAEAKWSGKFLSGFPVFCL-VFILVKDPNYYDTVLDHPWFIPACFFVGIMLTLNLIVM 314

Query: 180 RLMINFDV 187
           R++ N  V
Sbjct: 315 RILTNIKV 322


>gi|254510017|ref|ZP_05122084.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221533728|gb|EEE36716.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 322

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 101/186 (54%), Gaps = 8/186 (4%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P   ++ ++  +  DP+ +EF  + +    G  +
Sbjct: 141 KKRMALIEEQLPDAVELMVRSLRVGNPFVSSIQIVANEIEDPLATEFGIISDESAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +S+Q Q GGNL++ LA L++++R R  +  +V A++ E
Sbjct: 201 GEALKDMAERLDMQDLRFLAVAVSIQQQSGGNLADILAGLAKVIRARFRLFRRVNAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPR---GHMLLGVAAAFML-IGIMVMRL 181
           AK S   +   P      +    P Y + ++++P        +G    FML + ++VMR+
Sbjct: 261 AKWSGKFLSGFPVACLVFILVNDPNYYDTVLDEPYFIPACFFVG----FMLTLNLIVMRI 316

Query: 182 MINFDV 187
           + N  V
Sbjct: 317 LTNIKV 322


>gi|255263835|ref|ZP_05343177.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255106170|gb|EET48844.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 322

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 98/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A   +  P+A++++VRS+R G P + AVA++  +  DP+ SE   + +    G  +
Sbjct: 141 KKRLALIEEQLPDAVELMVRSLRVGHPFTSAVAIVAKEVPDPLGSEMGVISDEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 GEALKAMAERLEMQDMRFLAVAVTIQQQAGGNLAEILHGLAQVIRARFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   +   P     ++    P Y + +           V A F++  + VMR+++N 
Sbjct: 261 AKWSGMFLSLFPLGALVMINVIQPNYYDAVSETSVFIPACLVVAGFLVANMFVMRMLVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|296134294|ref|YP_003641541.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032872|gb|ADG83640.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 320

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 101/182 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR A+F     +AL I+  S+RAG     A+ ++  +   P+  EF R +   +LG + 
Sbjct: 139 QKRVARFNAQIGDALIIMANSLRAGFSFLQAMELVSKEMPAPISVEFARALREMNLGTAT 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  +   +  +++    T + +Q Q+GGNLS+ L  +S  +R+R  +K +++ L+ +
Sbjct: 199 EEALQNLCNRVESEDLDLVITAVLIQRQVGGNLSQILEGISHTIRERVRIKGEIKTLTAQ 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  I+G+LP  +  ++   +PGY+ +L +D  G +L+       LIG+ +++ +++ 
Sbjct: 259 GRISGMIVGALPVGMGLILAVINPGYIGILFSDSLGLVLIVAGVILQLIGVALIKKIVDI 318

Query: 186 DV 187
            V
Sbjct: 319 KV 320


>gi|319783870|ref|YP_004143346.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169758|gb|ADV13296.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 321

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 99/171 (57%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P AL++I R ++AG PV  A+A++  +  DP+ SEF  + +    G  L  +++ +  
Sbjct: 149 QLPEALELITRGLKAGHPVPVAIAMVAREMPDPIGSEFGVIADEVTYGSDLVSALNSLFD 208

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +  +++  F T +S+Q+  GGNL E L  L+  +R+R  ++ KV+A++ E + SA+I+ 
Sbjct: 209 RVGQEDLPLFVTAVSIQTSSGGNLREILDGLATTIRERGKLRRKVRAIATEGRMSAYILT 268

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           ++P  +   +    PG+ + +  +P+   LLG +  ++++G ++M  M NF
Sbjct: 269 AVPALLFAAIMALMPGFYSDVWGEPKTWYLLGASITWLMLGNLMMFKMSNF 319


>gi|157375502|ref|YP_001474102.1| Flp pilus assembly protein TadB [Shewanella sediminis HAW-EB3]
 gi|157317876|gb|ABV36974.1| conserved hypothetical Flp pilus assembly protein TadB [Shewanella
           sediminis HAW-EB3]
          Length = 325

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR       FP+ALD++ R+++AG   SDA+ +   +   P+  EF+ +    +    + 
Sbjct: 145 KRMDAIEASFPDALDVVRRALQAGYSFSDAIKLATEELEGPIAKEFKLMFANINYTKDVK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      F++ + VQ + GGNL+E + +LSR++R+R   + +V+ LS E 
Sbjct: 205 RALLGFIERVPSISAMAFASAVMVQKETGGNLAENIESLSRVIRERFTFRRRVKTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +P Y+  L     G  LL   A  M IG   +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYLQTPSYVGELTGTEGGKKLLMWGAIGMTIGGWWISKIIRID 324

Query: 187 V 187
           +
Sbjct: 325 M 325


>gi|84501672|ref|ZP_00999844.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390293|gb|EAQ02852.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 322

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 101/182 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P S A+ ++  + +DP+ SEF  + +    G  +
Sbjct: 141 KKRMSLIEEQLPDAVELMVRSLRVGHPFSSAIQIVSREVADPLGSEFGIIADENAYGRDM 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  +   + LQ++ F +  +++Q Q GGNL+E LA L+ ++R R  +  +V+A++ E
Sbjct: 201 GEALKDLAERIGLQDLRFLAVAVTIQQQSGGNLAEILAGLANVIRARFRLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   + + P      +    P Y + +++ P         A F+ + ++VMR +++ 
Sbjct: 261 AQWSGMFLSAFPIVALIAINVMDPHYYDEVMDHPFFLPACFAVAGFLGVNLIVMRKLVDI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|126737250|ref|ZP_01752985.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721835|gb|EBA18538.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 96/180 (53%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R AK  +  P+A++++VRS+R G P +  V ++  +  DP+ +EF  + +    G  + E
Sbjct: 143 RMAKIEEQLPDAVELMVRSLRVGHPFTSTVQIVSDEIEDPLATEFGIIADESAYGRDIGE 202

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  M   + +Q++ F S  +++Q Q GGNL+E LA L+ ++R R  +  KV+A++ EAK
Sbjct: 203 ALKEMAERLNIQDLRFLSVAVTIQQQSGGNLAEVLAGLAGVIRARFRLFRKVKAITAEAK 262

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            S   + + P      +    P Y + +++ P            + + ++VMR++ +  V
Sbjct: 263 WSGKFLSAFPLLALIAILVKDPNYYDSVMDHPYFIPACFAVGIMLAVNLLVMRILTDIKV 322


>gi|269966899|ref|ZP_06180972.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           alginolyticus 40B]
 gi|269828566|gb|EEZ82827.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           alginolyticus 40B]
          Length = 322

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 96/184 (52%), Gaps = 2/184 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF +  P ALDII R ++AG P++     +  + S P+  EF       + G  
Sbjct: 140 IADRLMKFEEQLPEALDIIKRVLQAGQPITQGFGEVGREVSAPLGPEFMNTFNLLNYGYD 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++ +S 
Sbjct: 200 LRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIKTISA 259

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-HMLLGVAAAFMLIGIMVMRLMI 183
           E++ SAW++   PF +  ++    P Y+ +L   P G  M++G   A + IG + +R ++
Sbjct: 260 ESRMSAWVLVLAPFGLYVIISLVRPEYIELLHTHPMGIKMVIGGMVA-LFIGTLWIRKIV 318

Query: 184 NFDV 187
           N +V
Sbjct: 319 NIEV 322


>gi|254464012|ref|ZP_05077423.1| type II secretion system protein [Rhodobacterales bacterium Y4I]
 gi|206684920|gb|EDZ45402.1| type II secretion system protein [Rhodobacterales bacterium Y4I]
          Length = 322

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 100/182 (54%), Gaps = 2/182 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P + AV ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMAMIEEQLPDAVELMVRSLRVGHPFTSAVQIVANEVEDPLATEFGIISDECAYGRDIG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLP-FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           + S   +   P FC++ ++    P Y + +++ P            +   + VMR++ N 
Sbjct: 262 QWSGKFLSGFPLFCLAGILV-KDPNYYDKVLDHPWFIPACFTVGVMLTANLFVMRMLTNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|294102186|ref|YP_003554044.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617166|gb|ADE57320.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
          Length = 309

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 100/175 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  +F    P  LD++   +RAG     ++     Q   P+    ++V+    LGL L
Sbjct: 128 QRRLQRFERQIPPMLDMVSSGLRAGFSFLQSLQNAGAQIEAPLGDTLQQVVAEISLGLDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            + ++R V  +   ++    T I +Q ++GGNL++ L N++R++RDR+++ A+++AL+ +
Sbjct: 188 EDVLNRWVERVGSLDLELAVTSILIQREIGGNLAKILENIARVMRDRQDVAAQMKALTSQ 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +    I+  LP  ++ ++   SPGY++ L +  +G ++LG A  F  IGI+V++
Sbjct: 248 GRLEGLIVSLLPVAMAVIINLLSPGYLSPLFSTQKGQVMLGTAIFFAFIGILVIQ 302


>gi|163751751|ref|ZP_02158969.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
 gi|161328403|gb|EDP99562.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
          Length = 325

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 96/185 (51%), Gaps = 8/185 (4%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFR----RVIETQHLG 62
           KR       FP+ LD+I R+++AG   +DA+ +   +   P+  EF+     +  T+ + 
Sbjct: 145 KRMDTIEASFPDGLDVIRRALQAGYSFTDAIKLATEELEGPLAKEFKLMFVNINYTKDIK 204

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           L+L   I R+    P      F++ + VQ + GGNL+E + NL+R++R R   + +V+ L
Sbjct: 205 LALLGFIQRV----PSVSALAFASAVMVQRETGGNLAENIENLTRVIRQRFKFRRRVKTL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+  LPF +  ++Y  +P Y+  L     G  LL      M+IG   +  +
Sbjct: 261 SAEGRLSAWILILLPFALFAVIYLQTPAYVGELTGTEAGQKLLMWGGVGMIIGGWWISRI 320

Query: 183 INFDV 187
           I  DV
Sbjct: 321 IKIDV 325


>gi|134291850|ref|YP_001115619.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135039|gb|ABO59364.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 325

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 98/172 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  K     P+  D+I R++R+G   + A+ ++  +  +P+  EFR   +  + G+SL
Sbjct: 144 RRRMLKLERQLPDVCDMIARALRSGHSFTSALGMVGEEFPEPMSGEFRITFDEINYGVSL 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E
Sbjct: 204 HDALVNLATRVPANDLRYFVIAVLIQRETGGNLAELLDSIAALVRERFKLFDKVRVLSAE 263

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
            + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     M  G++
Sbjct: 264 GRLSAWILGLLPFGTAGMMAVLNREFLSVLWQDPAGVKMVGAMLTSMAFGLL 315


>gi|126729094|ref|ZP_01744908.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710084|gb|EBA09136.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 321

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 98/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P + A+ ++  +  DP+ +EF  + +    G  +
Sbjct: 140 KKRLSMIEEQLPDAVELMVRSLRVGHPFTSAITIVSKEIKDPLATEFGIIADESAYGRDI 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 200 GEALKHMAERLDMQDLRFLAVAVAIQQQAGGNLAEILEGLAKVIRARFRLFRRVKAITAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P      +    P Y + +++ P       +    + + ++VMR ++N 
Sbjct: 260 AQWSGKFLSGFPVMALIFIQVAKPDYYDEVLDHPWFIPACFIVGIMLALNMIVMRWLVNI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|149915638|ref|ZP_01904164.1| type II secretion system protein, putative [Roseobacter sp.
           AzwK-3b]
 gi|149810530|gb|EDM70373.1| type II secretion system protein, putative [Roseobacter sp.
           AzwK-3b]
          Length = 322

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 97/181 (53%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P + A++++  + +DP+ +EF  + +    G  + 
Sbjct: 142 KRMAMLEEQLPDAIELMVRSLRVGHPFTSAISIVASEMADPLATEFGIIADEAAYGRDIG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++ EA
Sbjct: 202 EALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILDGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           K S   +   P      +    P Y +  +  P       +   F++  + VMR ++N  
Sbjct: 262 KWSGKFLSGFPVLALIGIQIIDPNYYDKAMLHPYFIPACLIVGTFLVANLFVMRALVNIK 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|167624198|ref|YP_001674492.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354220|gb|ABZ76833.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 325

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 98/181 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K  + FP+ALD++ R+++AG   SDA+ ++  +   P+  EF  +    +      
Sbjct: 145 KRMEKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMEGPLAKEFSLMFANINYSKDTK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+ LS E 
Sbjct: 205 RALLGFIERVPSVSAMAFASAVMVQKETGGNLAENINNLARVIRLRFTFRRRVRTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +PGY+  L     G+ LL   A  M +G M +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGNQLLIWGAIGMFVGGMWISKLIRID 324

Query: 187 V 187
           +
Sbjct: 325 M 325


>gi|157961841|ref|YP_001501875.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846841|gb|ABV87340.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 325

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 98/181 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K  + FP+ALD++ R+++AG   SDA+ ++  +   P+  EF  +    +      
Sbjct: 145 KRMDKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMDGPLAKEFSLMFANINYSKDTK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+ LS E 
Sbjct: 205 RALLGFIERVPSVSAMAFASAVMVQKETGGNLAENINNLARVIRLRFTFRRRVRTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +PGY+  L     G+ LL   A  M +G M +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGNQLLIWGAIGMFVGGMWISKLIRID 324

Query: 187 V 187
           +
Sbjct: 325 M 325


>gi|300856046|ref|YP_003781030.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
 gi|300436161|gb|ADK15928.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 320

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 101/181 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R   F  +    + II  S++AG     A+AV+  ++SDP   EF+++++   LG+S 
Sbjct: 139 KDRIKHFDSELNEGITIISNSLKAGYSFLQAIAVVSEETSDPFSKEFKKLLKEMSLGISE 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  ++  +  +++     VI +Q  +GGNLSE L N+S  +R+R+ +K++++ L+ +
Sbjct: 199 EDALKNLLSRVESEDLRLIVNVILIQKDIGGNLSEVLDNISETIRERQKIKSELKTLTAQ 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  I+  +P  +   +Y  +  Y+ +L     G +++  A     +G++++R +IN 
Sbjct: 259 GRLSGIILMLIPIFLGVTIYLFNKEYILLLFTTSIGLIMVAAAVLSEFLGLLIIRKIINI 318

Query: 186 D 186
           D
Sbjct: 319 D 319


>gi|13471028|ref|NP_102597.1| integral membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021772|dbj|BAB48383.1| probable integral membrane protein [Mesorhizobium loti MAFF303099]
          Length = 301

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 99/171 (57%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P AL++I R ++AG PV  A+A++  +  DP+ +EF  + +    G  L  +++ +  
Sbjct: 129 QLPEALELITRGLKAGHPVPVAIAMVSREMPDPIGTEFGVIADEVTYGSDLVSALNSLFD 188

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +  +++  F T +S+QS  GGNL E L  L+  +R+R  ++ KV+A+S E + SA+I+ 
Sbjct: 189 RVGHEDLPLFITAVSIQSSSGGNLREILDGLALTIRERGKLRRKVRAISTEGRMSAYILT 248

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           ++P  +   +    PG+   + ++P+   L+G +  ++++G ++M  M NF
Sbjct: 249 AIPALLFAAIMALMPGFYRDVWDEPKTWYLIGGSVTWLMLGNLMMFKMSNF 299


>gi|254487450|ref|ZP_05100655.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214044319|gb|EEB84957.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 320

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 86/148 (58%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P ++A+A++  +  DP+ SEF  + +    G  +
Sbjct: 139 KKRMSMIEEQLPDAVELMVRSLRVGHPFTNAIAIVSKEIQDPLASEFGIISDEAAYGRDI 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V A++ E
Sbjct: 199 GEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFKLFRRVNAITAE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMN 153
           AK S   + + P     ++    P Y +
Sbjct: 259 AKWSGKFLSAFPIVALIVIKLGDPHYYD 286


>gi|83943935|ref|ZP_00956392.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83954508|ref|ZP_00963219.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840792|gb|EAP79963.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845182|gb|EAP83062.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 320

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 102/184 (55%), Gaps = 4/184 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR     +  P+A++++VRS+R G P + A++++  +  DP+ SEF  + +    G  +
Sbjct: 139 KKRMDMIEEQLPDAVELMVRSLRVGHPFTSAISIVSKEIQDPLASEFGVIADETAYGRDI 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ E
Sbjct: 199 GEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVRAITAE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAA--FMLIGIMVMRLMI 183
           AK S   + + P     ++    P Y + ++  P    + G  A   F+ + ++VMR + 
Sbjct: 259 AKWSGKFLSAFPILALIVIKLGDPHYYDEVMTHP--LFIPGCIAVVLFLSLNLIVMRKLT 316

Query: 184 NFDV 187
           +  V
Sbjct: 317 DIKV 320


>gi|89068022|ref|ZP_01155439.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046261|gb|EAR52318.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 322

 Score = 97.8 bits (242), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 96/182 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P S A+ ++  + +DP+ +E   + +    G  +
Sbjct: 141 KKRMSMIEEQLPDAVELMVRSLRVGHPFSSAINIVAKEVADPLGTEMGVIADEAAYGRDM 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ES+  M   M +Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 GESLKAMAERMDMQDLRFLAVAVTIQQTSGGNLAEILDGLAKVIRARFRLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S   +   P      +    P Y + ++          V  AF+++ + VMR + N 
Sbjct: 261 AKWSGMFLSGFPLLALVAINLLQPNYYDDVMETAVFIPACLVVGAFLVVNVFVMRHLTNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|149200851|ref|ZP_01877826.1| type II secretion system protein [Roseovarius sp. TM1035]
 gi|149145184|gb|EDM33210.1| type II secretion system protein [Roseovarius sp. TM1035]
          Length = 322

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 85/153 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMALLEEQLPDAIELMVRSLRVGHPFSSAIGIVATEVGDPLATEFGIIADEAAYGRDMG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAQVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           K S   + + P      +    P Y +  +  P
Sbjct: 262 KWSGKFLSAFPLLALVGIQLLKPDYYDEAMEHP 294


>gi|325109818|ref|YP_004270886.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970086|gb|ADY60864.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 319

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 94/180 (52%), Gaps = 3/180 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R     D  P   D++ R++ +G  +S A  ++  Q   P+  EF+   + Q+LGL   
Sbjct: 142 QRINTLRDQLPETFDLMSRAIESGQTISGAFQLVSTQCGGPIAKEFQHCCQQQNLGLPYE 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  + R   + E+  F+  + VQ Q GG+ S+ L NL+  +R+R  +  KV+A++ E 
Sbjct: 202 ITLRDLARRTGVMELQMFAVALIVQRQAGGDPSDVLKNLAEAVRNRIKLAMKVKAITSEG 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +A AW++ +LPF     +Y     Y +VL+  P    ++ V+ A   +GI  +R ++  +
Sbjct: 262 RAQAWVLSALPFVSFGGIYLLDRDYASVLLERPNVMAIMAVSIA---LGIAWIRQIVCIE 318


>gi|222111306|ref|YP_002553570.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221730750|gb|ACM33570.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 279

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L ++R AK ++  P+AL+++  S+R+G  ++ A+ ++  ++  P   E   V+  Q LG
Sbjct: 95  YLKRRREAKLIEQMPDALNMLAGSLRSGASLAIAMDLVATETPPPFSQELSLVLREQKLG 154

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL ++     + + L++V+   + I++   +GGNLSE L  L+  LR +  M+ K++AL
Sbjct: 155 VSLEDAFESFAKRVNLEDVNLLVSAITISKDVGGNLSEVLERLASTLRAKAAMEGKIRAL 214

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + K    ++G LP  +  +++   P  M  L +   G  ++ V A  +++G + ++ +
Sbjct: 215 TSQGKLQGIVVGLLPVFLGFVLFQMEPEAMAPLFSTYYGWAVMAVVAVLLIMGGVFIKKI 274

Query: 183 INFDV 187
           +  DV
Sbjct: 275 VTIDV 279


>gi|170725111|ref|YP_001759137.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810458|gb|ACA85042.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 283

 Score = 97.4 bits (241), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 97/186 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K L K+R  KF+   P+AL++I  S+++G  VS A+  +  +   P++ EF+     Q L
Sbjct: 98  KFLHKRRRRKFVHQLPDALNMIASSMQSGANVSTAIEFMSEEMQAPIKQEFQLFQREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  M + +P  E    +  + +  ++GGNL+E L  LS  LR +  M+ K+ A
Sbjct: 158 GVEFNTALDNMYKRIPEDEFQLVTAGMQISREVGGNLAEVLFRLSSTLRRKIEMEGKIDA 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +  ++Y   P  M  ++ +P G  L+ +    +  G + +R 
Sbjct: 218 LTSQGKMQGIVMTMLPLFIGFVLYHMEPKSMGRILTEPMGWALMALIFIMLTSGYLSIRK 277

Query: 182 MINFDV 187
           ++  DV
Sbjct: 278 IVAIDV 283


>gi|119717341|ref|YP_924306.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538002|gb|ABL82619.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 326

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 100/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   F    P  L ++  S+ AGL ++ +   +  + +DPV +EFRR +    LG+ L 
Sbjct: 146 RRRKAFSAAVPETLQLMSGSLSAGLSLAQSAETVTREGADPVAAEFRRALVETRLGVPLE 205

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +       ++++    I +Q Q+GGNL+E L  ++  +R+R+ ++ +V ALS E 
Sbjct: 206 DALEGVADRFDSADLAWAVMAIRIQRQVGGNLAELLDTVAETMREREYVRRQVAALSAEG 265

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAW++GSLP    T +   +  Y+  L  DPRG +LL  AA ++ +G   M  ++  +
Sbjct: 266 RLSAWVLGSLPVAFLTYLLLVNREYVMPLFEDPRGIVLLAGAALWLAVGAFWMSRLVRVE 325

Query: 187 V 187
           V
Sbjct: 326 V 326


>gi|323702117|ref|ZP_08113785.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
 gi|323532999|gb|EGB22870.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
          Length = 323

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 102/182 (56%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR AKF     +AL I+  S+R+G     A+ ++  +  +P+  EF R  +   LG   
Sbjct: 142 QKRLAKFNAQIGDALVIMANSLRSGFSFLQAMDMVRKELPNPISREFGRAFQEMSLGTPT 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M + +   ++    T + +Q Q+GGNL+E L N++  +R+R  +K ++++++ +
Sbjct: 202 EEALQNMAQRVKSDDLDLVITAVLIQRQVGGNLAEVLDNIADTIRERVRIKGQIRSITAQ 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S  +IG LPF ++ L+   SP Y+  L N   G +++  A    +IG++ ++ +++ 
Sbjct: 262 GRISGMVIGFLPFALAALMLVISPQYIMTLFNSKIGLIMVASAIFSEVIGVVAIKKIVDI 321

Query: 186 DV 187
           +V
Sbjct: 322 EV 323


>gi|319951072|ref|ZP_08024925.1| type II secretion system integral membrane subunit [Dietzia
           cinnamea P4]
 gi|319435232|gb|EFV90499.1| type II secretion system integral membrane subunit [Dietzia
           cinnamea P4]
          Length = 314

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 88/162 (54%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           D   ++L ++  S+RAG  +  A+A +  ++  P   EF R+I    +G  L+ ++    
Sbjct: 141 DQLDDSLQLMASSLRAGHSLLQALASVAREAEQPTSEEFARIINETRVGRELAPALEETA 200

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             M  Q+  + +  I++  ++GGNL+E L  +   +R+R  ++ +VQAL+ E K SA+++
Sbjct: 201 NRMGSQDFVWVTQAIAINREVGGNLAEVLDGVGHTIRERNQIRRQVQALAAEGKLSAYVL 260

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
            +LPF +   ++ ++P Y+ VL   P G  ++      + IG
Sbjct: 261 MALPFGIGGFLFVSNPSYIGVLTQSPLGWGMIAAGVVMLTIG 302


>gi|86137997|ref|ZP_01056573.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
 gi|85825589|gb|EAQ45788.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
          Length = 322

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P +  V ++  +  DP+ +EF  + +    G  + 
Sbjct: 142 KRMALIEEQLPDAVELMVRSLRVGHPFNSTVQIVAHEIEDPLATEFGIIADECAYGRDIG 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + +Q++ F S  +++Q Q GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 202 EALKEMAERLDIQDLRFLSVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVKAITAEA 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + S   + + P           P Y + +++ P            + + + VMR++ N  
Sbjct: 262 QWSGKFLSAFPLLALIGTLLKDPNYYDDVMDHPYFIPACFFVGIMLTVNLFVMRVLTNIK 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|84687273|ref|ZP_01015153.1| Putative Flp pilus assembly protein TadB [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664706|gb|EAQ11190.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2654]
          Length = 322

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 96/186 (51%), Gaps = 8/186 (4%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A F +  P+A++++VRS+R G P S A+ ++  +  DP+ SE   + +    G  +
Sbjct: 141 KKRMAMFEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGSEIGIIADESAYGRDI 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +S+  M   M +Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V+A++ E
Sbjct: 201 GDSLKAMAERMDMQDLRFLAVAVTIQQTSGGNLAEILDGLAKVIRSRFKLFRRVKAITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLIND----PRGHMLLGVAAAFMLIGIMVMRL 181
           AK S   +   P     ++    P Y + +       P   + LG    F++    VM+ 
Sbjct: 261 AKWSGTFLSGFPILAIVMINVIQPNYYDDVKETGFFIPAALVCLG----FLIANYFVMKA 316

Query: 182 MINFDV 187
           + N  V
Sbjct: 317 LTNIKV 322


>gi|220913394|ref|YP_002488703.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860272|gb|ACL40614.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 310

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 93/182 (51%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  KR A F     + L ++   +RAG  +  A+     +S  P   E RRVI    LG 
Sbjct: 127 LAGKRRAAFDGQLGDTLQLLSGGLRAGHSILRAIDAAAAESQKPTSEEMRRVITETSLGR 186

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  +++     M  ++  + S  I +  ++GGNL++ L  ++  +R+R  +K  ++AL+
Sbjct: 187 DLLAALNDTADRMKNEDFVWISQAIQINREVGGNLADVLDQVNETIRERAEIKGHIKALA 246

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E K SA+I+ ++PF +  ++   SP YMN +   P G  ++  +   M +G + MR +I
Sbjct: 247 AEGKFSAYILIAMPFGIVAMLLAVSPTYMNSMFTHPLGWAMIVASFVLMTVGALWMRKII 306

Query: 184 NF 185
           + 
Sbjct: 307 DL 308


>gi|219850072|ref|YP_002464505.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544331|gb|ACL26069.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 332

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 103/191 (53%), Gaps = 8/191 (4%)

Query: 5   IKKRTAKFLDDFPNAL-DIIV---RSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K R A+ +  F N L D+I     ++R G      + ++  ++ DP  +EFRRV++   
Sbjct: 142 VKVRAAQRVKAFNNQLGDVITMMANALRGGYSFLQTLDMVAREAPDPASTEFRRVVQEVG 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  E++  ++R +P  ++    T +S+Q ++GGNL++ L  +   +R+R  +K ++ 
Sbjct: 202 LGRSTEEALQNLLRRVPSDDLDLLVTAVSIQMEVGGNLAQVLDTIGHTIRERVRIKGEIS 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLLGVAAAFML-IGI 176
            L+ + + S+WII  LP  ++  +   +P YM  L      P+    + V + FM+ +G 
Sbjct: 262 TLTAQGRISSWIITGLPIGLAAFITVVNPDYMAPLFTFGLPPQAWCCMPVTSLFMIALGY 321

Query: 177 MVMRLMINFDV 187
             ++ +I+ +V
Sbjct: 322 FAIQKIIDIEV 332


>gi|221633001|ref|YP_002522226.1| type II secretion system protein F domain [Thermomicrobium roseum
           DSM 5159]
 gi|221156079|gb|ACM05206.1| Bacterial type II secretion system protein F domain
           [Thermomicrobium roseum DSM 5159]
          Length = 323

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 104/182 (57%), Gaps = 1/182 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           + R  +F++   + + ++  S+RAG  +   + ++  +S+ P+  EFRRV+    LG+ L
Sbjct: 143 RHRLQRFVNQLGDTIGLMANSLRAGYSLLQTMDLVARESAPPMSEEFRRVVREVGLGVPL 202

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  ++  +P +++    T I++  ++GGNL++ L  +   +R+R  +K +++ L+ +
Sbjct: 203 QDALDHLLERIPSEDLDLLVTAIAINHEVGGNLAQILEIIGETIRERVRIKGEIRVLTAQ 262

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              S +II  LP  ++ L++  +P Y+  L+  P   M +G A   M++G +VMR ++  
Sbjct: 263 QSLSGYIISLLPVGLAILIFLLNPSYLLSLLRWPWICMPIG-AVICMVLGFVVMRRIVAI 321

Query: 186 DV 187
           +V
Sbjct: 322 EV 323


>gi|229588192|ref|YP_002870311.1| hypothetical protein PFLU0644 [Pseudomonas fluorescens SBW25]
 gi|229360058|emb|CAY46912.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 294

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 96/178 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + ++  P  LD  VRS+++G  ++DAV   V    +P+R    RV     +G+SL
Sbjct: 114 QQRVQRMVEQLPQLLDHSVRSLKSGRTLADAVLGGVESIENPLRDAMGRVQRNVRMGVSL 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +S+S    +    E   F+  + V  + GGN SE L NL +++R+R+    +++A++ E
Sbjct: 174 PDSVSDFAEFYEQDEFRLFALGLKVNHRYGGNASELLENLIKMIREREQGARQLKAMTGE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +A+++G LP  +       +PGY+  + +D  G ++L  A A  L G  +M  M+
Sbjct: 234 TRMTAYVLGGLPVLIVGYFLVVNPGYLMNMWHDGTGRIMLFGALAMDLGGTFIMWRML 291


>gi|297618077|ref|YP_003703236.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145914|gb|ADI02671.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 329

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++H   +R   F     +AL I+  ++RAG     A+  +  +   P+ +EF   +    
Sbjct: 143 LQHKKGERLKTFNQQLGDALVIMANALRAGFGFQQAMETVRRELPPPISTEFEWTLREIQ 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  ES+  +   +   ++    T + +Q Q+GGNL++ L N+SR +RDR  +K +++
Sbjct: 203 LGSTTEESLLNLCERVKSDDLDMVVTAVLIQRQVGGNLAQILDNISRTIRDRTRIKGEIR 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +  ++   +PGYM   + +P G  LL  AA   L G+ V++
Sbjct: 263 TLTAQGRLSGIIIGLLPIALLFILLILNPGYMTPFLQNPLGLYLLSGAAVSELAGLYVIK 322

Query: 181 LMINFDV 187
            +++ DV
Sbjct: 323 KIVDIDV 329


>gi|84516637|ref|ZP_01003996.1| putative Flp pilus assembly protein TadB [Loktanella vestfoldensis
           SKA53]
 gi|84509673|gb|EAQ06131.1| putative Flp pilus assembly protein TadB [Loktanella vestfoldensis
           SKA53]
          Length = 320

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 94/174 (54%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           +  P+A+D++VRS+R G P S A+ +   +  DP+ +E   + +    G  + E++  M 
Sbjct: 147 EQLPDAVDLMVRSLRVGHPFSSAINIAAKEVPDPLGTEIGIIADETAYGRDMGETLKAMA 206

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             +  Q++ F +  +++Q   GGNL+E L  LS+++R R  +  +V+A++ EAK S  ++
Sbjct: 207 ERLDNQDLRFLAVAVTIQQSSGGNLAEILDGLSKVIRARFRLFRRVKAITAEAKWSGNLL 266

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            + P      +    P Y + ++  P       V AAF+++ ++VMR + N  V
Sbjct: 267 SAFPILALIGINLVQPNYFDDVMESPMFIPACFVVAAFLVLNLIVMRALTNIKV 320


>gi|323700364|ref|ZP_08112276.1| Type II secretion system F domain [Desulfovibrio sp. ND132]
 gi|323460296|gb|EGB16161.1| Type II secretion system F domain [Desulfovibrio desulfuricans
           ND132]
          Length = 324

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 98/170 (57%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +F    P ALD++ R+++AG      + ++  +   P+  EF + ++  + G+ +
Sbjct: 143 RKRMDRFQKQLPEALDLMARALKAGHTFGGGMRMVADEFDGPIGPEFGKTLDEINYGMDV 202

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++S +   +   ++ FF   +++Q + GGNL+E +A ++ ++R+R  +  K++ LS E
Sbjct: 203 DRALSNLQSRVDCPDLKFFVVSVNIQRETGGNLAEIIAKIAALVRERFALFGKIRVLSAE 262

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
            + SA+I+ +LPF ++ ++Y  +  Y+++L     G  ++  AA  M+IG
Sbjct: 263 GRVSAYILIALPFLLTGILYVVNSDYISLLWTRELGQNMVWGAAISMIIG 312


>gi|78486065|ref|YP_391990.1| type II secretion system protein [Thiomicrospira crunogena XCL-2]
 gi|78364351|gb|ABB42316.1| Flp (type IV) pilus assembly protein, TadC homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 315

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 94/178 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +    FP  LD IVR++++G  +  A+++I  +   P+  E + V     LG+S+
Sbjct: 134 KQRQNRLRQQFPEMLDAIVRALQSGYGIDGALSMIAEEFRAPLGKEVKEVNRQLTLGISM 193

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            + +      + + E  FF   + +Q + GG L+  L  LSR++R R+  +AK++ L+ E
Sbjct: 194 RDILRDFQTRIEIPEAQFFVVTLIIQRETGGQLAPILEELSRLMRRREMFQAKLKTLTAE 253

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           ++ +A  +G  P       YF  P  M   +NDP G  +L ++   M+ G ++++ M+
Sbjct: 254 SRFTAIFLGLAPLGYLGYKYFFDPDSMAFFLNDPTGQDILIISLVLMISGAIILKSML 311


>gi|218677457|ref|ZP_03525354.1| probable pilus assembly protein [Rhizobium etli CIAT 894]
          Length = 67

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 55/67 (82%)

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G++  +M IGI VMR
Sbjct: 1   ALSMEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISGIWMSIGIFVMR 60

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 61  NMVNFDI 67


>gi|219883049|ref|YP_002478213.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219862055|gb|ACL42396.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 309

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 99/185 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR  KF D   ++L ++   +RAG  +  AV  +  Q+  P   EF R++    
Sbjct: 123 LSFLAGKRRKKFADQLDDSLQLLSGGLRAGHSLQRAVDAVSQQAPSPTAEEFSRIMNETR 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L++++ +    M  ++ S+ S  I +  ++GG+L++ L  + R +R+R  ++ +V+
Sbjct: 183 IGRDLTDAMDQTAERMKSEDFSWVSQAIGIHREVGGDLADVLDQVGRTIRERNQIQRQVK 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E K SA+++ +LP  +  ++   SP Y+    + P G  ++      M +G + ++
Sbjct: 243 ALSAEGKMSAYVLMALPVLIIGVLAIISPSYIVSFGSSPLGWGMVAGGILMMTVGGLWLK 302

Query: 181 LMINF 185
            +++F
Sbjct: 303 KIVSF 307


>gi|126733577|ref|ZP_01749324.1| Putative Flp pilus assembly protein TadB [Roseobacter sp. CCS2]
 gi|126716443|gb|EBA13307.1| Putative Flp pilus assembly protein TadB [Roseobacter sp. CCS2]
          Length = 321

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 98/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR     +  P A++++VRS+R G P S A+A++  +  DP+ +E   + +    G  +
Sbjct: 140 KKRMNMLAEQLPEAVELMVRSLRVGHPFSSAIAIVAREVPDPLGTEIGMISDEAAYGRDM 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  M   +  Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V A++ E
Sbjct: 200 GETLKSMAERLDNQDMRFLAVAVTIQQTSGGNLAEILDGLAKVIRARFRLFRRVAAITAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           AK S  ++ + P      +    P Y + ++  P     + +  AF+++ ++VMR +++ 
Sbjct: 260 AKWSGNLLSAFPIFALMGINLVKPDYYDDVMESPLFIPAVLIVVAFLVVNLLVMRALVDI 319

Query: 186 DV 187
            V
Sbjct: 320 KV 321


>gi|149188842|ref|ZP_01867132.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
 gi|148837262|gb|EDL54209.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
          Length = 301

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 100/184 (54%), Gaps = 2/184 (1%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQH 60
           + L  +R  +F   FP+AL++++ +V AG  +  AV+  VGQ+ D  V  EF+ + +   
Sbjct: 115 QWLSNRRRVQFQQTFPDALNVLMSAVTAGESLMQAVS-FVGQNLDNEVGREFKNMGDRLK 173

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  + + R  +  P  E  FF+  I      GG L   LA L R+L D + M+ K  
Sbjct: 174 LGESPDQVLQRAAKRFPYPEFIFFTIAIRANMSRGGQLRGVLARLIRVLVDARTMETKKM 233

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA ++ ++P   + ++Y  +P  +N +++DP+G  +L       L+G+ ++ 
Sbjct: 234 AMTSEARISAKVVAAIPVIFAVILYNVNPDNINYILHDPKGVWVLYYVVGSELVGLFIVW 293

Query: 181 LMIN 184
           L++ 
Sbjct: 294 LLVK 297


>gi|320161468|ref|YP_004174692.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995321|dbj|BAJ64092.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 323

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 100/187 (53%), Gaps = 6/187 (3%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  KF +  P+ L+++V  +RAG     A+  +  +   P+  EFRRV++   LG+ + 
Sbjct: 137 KRLVKFNEQLPDMLNLMVNGLRAGYSTMQAMEAVSKELPPPICDEFRRVVQEMQLGVPMQ 196

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  ++R +P  ++    T I+VQ ++GGNL+E L  +S  +R+R  +K +++ L+ + 
Sbjct: 197 QALDNLLRRIPSDDLDLVVTAINVQREVGGNLAEILDTISFTIRERVRIKGEIRVLTTQV 256

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLI------NDPRGHMLLGVAAAFMLIGIMVMR 180
             S   +  +P  V  ++Y  +  YM          N P G++ L  AA  ++ G +VM 
Sbjct: 257 MYSGRFLAMMPIFVMGVLYLLNRPYMMEFFKPENNANLPCGYIALVCAAILIISGYVVMN 316

Query: 181 LMINFDV 187
            + + +V
Sbjct: 317 KIGDIEV 323


>gi|328952511|ref|YP_004369845.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452835|gb|AEB08664.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 317

 Score = 94.4 bits (233), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 1/182 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K +   P+A+D IVRS++ G  V  A   +      P+ ++FR + E   +GL   
Sbjct: 136 RREEKLVAQLPDAIDTIVRSLKVGQSVDAATLEVARGFPPPIGADFRAINEEMAMGLPFE 195

Query: 67  ESISRMVRYMP-LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             I    R  P L +V        +Q + GG L++ LA L+  +R R + + +V+A + E
Sbjct: 196 TVIKNFQRRYPRLPDVRILCATFVIQRETGGKLTDILAGLASTIRARLHFQRRVRASTAE 255

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + +A+I+G LP   + + +   P YM V  + P G  LL V       G +VMR M+  
Sbjct: 256 GRTTAFILGILPLGFAAVTWLLRPEYMRVFRDHPLGRKLLVVVILMEAAGFLVMRAMLRV 315

Query: 186 DV 187
            V
Sbjct: 316 KV 317


>gi|149188859|ref|ZP_01867149.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
 gi|148837279|gb|EDL54226.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
          Length = 300

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 99/182 (54%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R   F + FP+AL+I++ +V AG  +  A++ +    ++P+  EF+ + +   L
Sbjct: 114 RFLVGRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGEAMNNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTIRANIARGGQLKGVLARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P   + ++ + +P  ++ ++NDP+G  +L       LIG+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFTVILNYVNPANVDFVLNDPQGQYVLFYVLGSELIGLSIVWL 293

Query: 182 MI 183
           ++
Sbjct: 294 LV 295


>gi|163801673|ref|ZP_02195571.1| hypothetical Flp pilus assembly protein TadB [Vibrio sp. AND4]
 gi|159174590|gb|EDP59392.1| hypothetical Flp pilus assembly protein TadB [Vibrio sp. AND4]
          Length = 300

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 99/182 (54%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L+KKR   F + FP+AL+I++ ++ AG  +  A++ +    +DP+  EF+ + +   L
Sbjct: 114 RYLVKKRRTNFENTFPDALNILMSAITAGDSLMQAISYVGDVMNDPIGVEFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +    + R  +  P  E  FF+  +      GG L   LA L R+L D + +  K  A
Sbjct: 174 GETPEVVLQRSCKNYPYPEFLFFAVTLRANIARGGQLKGVLARLIRVLVDARTLDKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N +++DP G ++L        +G++++ L
Sbjct: 234 MTSEARISAKIVAAIPVIFMIILNYINPDNLNFVLHDPSGRIVLFYVLGSEFLGLLIVWL 293

Query: 182 MI 183
           ++
Sbjct: 294 LV 295


>gi|309792340|ref|ZP_07686810.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225655|gb|EFO79413.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 325

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 81/147 (55%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR   F D   + + ++  ++R G      + ++   +  P+  EFRRV++   LG + 
Sbjct: 140 KKRIKSFNDQLGDTITMMANALRGGFSFLQTLDMVARDAPAPMSGEFRRVVQEVGLGRTT 199

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  ++R MP +++    T +++Q ++GGNL++ L  +   +R+R  +K ++Q L+ +
Sbjct: 200 EEALQSLLRRMPSEDLDLLITAVNIQMEVGGNLAQILDTIGHTIRERVRIKGEIQTLTAQ 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYM 152
            + S W+I  LP  ++  +   +P YM
Sbjct: 260 GRISGWVITGLPIGLAIFITMINPEYM 286


>gi|269126092|ref|YP_003299462.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311050|gb|ACY97424.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 660

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++R   F D  P+AL ++  S+R+G  V+ +V  + G    P+  E  R +    
Sbjct: 474 LRGRAERRLTAFADQLPDALQLVAGSLRSGFSVAQSVERLAGLELQPMGQEMARAVAQTR 533

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+S  +++  +   M  +++ +    I +Q ++GGNLSE +   +  +R+R  ++ +++
Sbjct: 534 LGVSTEDALRSVADRMNCRDLHWVVLAIQIQREVGGNLSEVIETTAETMRERTRLRRQIR 593

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA+++ +LP     L+  + P YM  L   P G  ++ +A   + +G + + 
Sbjct: 594 ALSAEGRLSAYVLIALPVITGGLLTVSRPDYMRPLYTTPMGIGMICLAVFLVALGWLWLS 653

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 654 KVVKVEV 660


>gi|119773847|ref|YP_926587.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
 gi|119766347|gb|ABL98917.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
          Length = 283

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 99/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L ++R  +F+   P+AL++I  S++AG  V++A+  +  +   P++ EF+  +  Q L
Sbjct: 98  RYLHQRRRRRFVHQLPDALNMIAASMQAGANVTNAIEFMADEMDAPIKQEFQLFLREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  + + +P  E       + +   +GGNL+E L  LS  LR +  M+ K+ +
Sbjct: 158 GVEFNTALDNVYKRIPESEFQLVVAGMQISRDVGGNLAEVLVRLSETLRKKIEMEGKITS 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +   +Y   P  M  ++ +P G  ++ V++  +  G M ++ 
Sbjct: 218 LTSQGKMQGIVMTLLPVAIGFTLYHMEPVSMGRILTEPVGWAVIAVSSLLLFGGYMTIKK 277

Query: 182 MINFDV 187
           +I  DV
Sbjct: 278 IITIDV 283


>gi|300692335|ref|YP_003753330.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum PSI07]
 gi|299079395|emb|CBJ52066.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum PSI07]
          Length = 325

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 92/177 (51%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P A D++ R++RAG     A+ +   +   P+ SEF  V    + G+ + E+++
Sbjct: 149 KLEAQLPEATDLLARALRAGHSFPSALDMAGSELPAPIASEFALVFSEINYGVPMGEALA 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
              R +P++++ F    + +Q + GGNL+E L N+  ++R R  +  K++ LS E +   
Sbjct: 209 AFSRRVPIEDLRFLVIAVLIQRESGGNLAEILDNIGTLIRKRLQLLDKIRVLSAEGRLGG 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+  +P  +  L+YF +P  ++ L   P G  LL  A     +G++ +R ++   V
Sbjct: 269 WILSLMPPVLGVLMYFLNPTLVSSLWTHPLGIQLLWAAIIMTGVGMLWIRHLVRIHV 325


>gi|159901126|ref|YP_001547373.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894165|gb|ABX07245.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 329

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 106/184 (57%), Gaps = 4/184 (2%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R   F +   + + ++  S+R+G  +  ++ ++  ++  P+  EFRRV++   LGLSL +
Sbjct: 146 RLKAFNNQLGDTVGLLANSLRSGYSLLQSMDLVSREAPPPISVEFRRVVQEVGLGLSLED 205

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++ ++R +P  ++    + I++Q+++GGNL+E L  ++  +R+R  +K +++ L+ +A+
Sbjct: 206 GMNNLLRRVPSDDLDLMVSAINIQAEVGGNLAEILDTIAHTIRERVRIKGQIRVLTSQAR 265

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLLGVAAAFMLI-GIMVMRLMI 183
            S +++  LP  ++ ++   +P YM  L+     P     + V +A M+I G   ++ ++
Sbjct: 266 YSGYVVTFLPISIAVIITMLNPDYMAPLMTIGMPPDAWCCMPVCSAMMMIGGFFAIKSIV 325

Query: 184 NFDV 187
           N ++
Sbjct: 326 NIEI 329


>gi|296158516|ref|ZP_06841346.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891084|gb|EFG70872.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 282

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K + KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    
Sbjct: 96  LKRMRKKRIEALEKQLPDALLMMSGALRAGASFPSALEAVVHETTPPISQEFDLLMREIR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + + +P+ ++   +  +++  ++GGNL+EAL +++R LR++  M+ K++
Sbjct: 156 LGIDLDIAMRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F  P  M  L N+P G   L V      +G + + 
Sbjct: 216 ALTSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFNEPVGWATLAVIGVMEFLGYVWIT 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 KITNIDV 282


>gi|319940444|ref|ZP_08014789.1| hypothetical protein HMPREF9464_00008 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806070|gb|EFW02819.1| hypothetical protein HMPREF9464_00008 [Sutterella wadsworthensis
           3_1_45B]
          Length = 326

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 84/176 (47%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
           T +     P A+D I R  RAG+P   A  +        +  E R +     LG+ L + 
Sbjct: 148 TEELGKSLPEAIDSIARICRAGVPAQTAFGLAAQNLRGALSEELRTIDRWLRLGVPLKQV 207

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           +      +PL E  FF+ ++ +  + GG L++ L  L+  LR+R  +  KVQA + EA+A
Sbjct: 208 LQESAHRVPLPEYRFFAVIVIISQESGGRLADTLERLAATLRERAELALKVQAKTSEARA 267

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           S  I+  L   V    Y  +P     L+ DP G  +LG AAA +  G+ V  LM+ 
Sbjct: 268 SIKIVACLVPGVLIYQYIQAPQDFQFLVTDPTGLKVLGYAAASVAAGLFVTWLMVR 323


>gi|163733538|ref|ZP_02140981.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393326|gb|EDQ17652.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
          Length = 320

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 100/188 (53%), Gaps = 14/188 (7%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +    G  + 
Sbjct: 140 KRLAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVSKEVQDPLASEMGVIADESAYGRDVG 199

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  M   + +Q++ F +  +++Q   GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 200 DALKEMAERLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVKAITAEA 259

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH-------MLLGVAAAFMLIGIMVM 179
           K S   + + P     ++    P Y + +    R H        L+GV   F+ + + VM
Sbjct: 260 KWSGKFLSAFPVVALIVINVGDPNYYDAV----RDHAYFIPACFLVGV---FLALNLFVM 312

Query: 180 RLMINFDV 187
           R++ +  V
Sbjct: 313 RILTDIKV 320


>gi|325275752|ref|ZP_08141630.1| type II secretion system protein [Pseudomonas sp. TJI-51]
 gi|324099112|gb|EGB97080.1| type II secretion system protein [Pseudomonas sp. TJI-51]
          Length = 293

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 97/178 (54%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++     ++  P  LD  VRS++AG  ++DAV   +  S +P+R+   RV     LG+ L
Sbjct: 113 RRHMRHVVEQLPGLLDYSVRSLKAGRTLNDAVLGAIDSSREPLRTTLARVRRNVQLGVPL 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++++ +       E+  F+  + +  + GGN SE + NL +++R+R+    +++A++ E
Sbjct: 173 EDAMTELAELHQQDELRLFALGLRINQRHGGNASELMENLIKLIREREQGARQLKAMTGE 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +A I+G+LP  +       +P Y+  +  D  G ++L +A A  ++G +V+  M+
Sbjct: 233 TRITAIILGALPLAMVGYFLLANPHYLLAMWRDSSGQLMLLLAFALQVLGCLVLWRMM 290


>gi|108759913|ref|YP_632817.1| type II secretion system protein F domain [Myxococcus xanthus DK
           1622]
 gi|108463793|gb|ABF88978.1| type II secretion system protein F domain protein [Myxococcus
           xanthus DK 1622]
          Length = 281

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 99/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           KH  K+R  KF     +AL  +  + +AGL    A+  +  ++  P+  EF   ++   L
Sbjct: 96  KHYRKRRIKKFNVQLVDALQAMANAFKAGLTFPQAIEHVAREAMPPLSQEFGLFVKEVKL 155

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L E++  M R +   ++       ++  QLGGN++E    +S ++R+R  ++ K+ A
Sbjct: 156 GVPLEEALINMGRRVGSDDLELVVVSTNIARQLGGNMAEMFETISTVIRERFRLEGKIDA 215

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K   WI+ ++P  +  ++ +  P  M  +++   G +L+ + A   ++GI+++R 
Sbjct: 216 LTSQGKLQGWIVAAMPGVLGMVLNYMRPDLMEPMMDHIFGWILVIIIAIMEVMGILIIRR 275

Query: 182 MINFDV 187
           ++N D+
Sbjct: 276 IVNIDI 281


>gi|170724974|ref|YP_001759000.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810321|gb|ACA84905.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 302

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHL 61
           +L++KR   F + FP+AL+I++ +V +G  +  A+A  VGQS D  +  EFR + E   L
Sbjct: 118 YLMRKRKNAFDETFPDALNIMMSAVSSGESIMQAIAY-VGQSLDNQIGLEFRDMGERLKL 176

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    +   R  +  P     FF   I      GG L   +A L R+L D + +  K  A
Sbjct: 177 GEPPEQVFKRACKRFPYPTFLFFIVTIRANMSRGGQLKSVMARLIRVLMDARTLDKKKAA 236

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ SLPF    L+ + SP  ++ ++ DP G  +L        +G+ ++ L
Sbjct: 237 MTSEARLSAKIVASLPFFFMILLSYLSPQNLDFVLTDPSGRYILYYVVGSEALGMFIIWL 296

Query: 182 MI 183
           +I
Sbjct: 297 LI 298


>gi|299067811|emb|CBJ39022.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CMR15]
          Length = 325

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +  +  P A D++ R++RAG  +  A+ +   +   P+ +E   V    + G+ + 
Sbjct: 145 KRLLRLEEQLPEAADLLSRALRAGHSLPSALDMAGSELPAPIGAELALVFSEINYGVPMG 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P++++ +    + +Q + GGNL+E L N+  ++R R  +  KV+ LS E 
Sbjct: 205 DALTGLTDRVPIEDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +   WI+  LP  V  +VY  +P  ++ L  DP G  +L  A     +G++ +R ++   
Sbjct: 265 RMGGWILTLLPPVVGVIVYELNPDLISTLWKDPTGLKMLWYAITMTCVGVIWIRQIVRIH 324

Query: 187 V 187
           +
Sbjct: 325 I 325


>gi|17545370|ref|NP_518772.1| tight adherence TadB-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427662|emb|CAD14181.1| probable pilus assembly tadb transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 325

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 96/181 (53%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  +  +  P A D++ R++RAG  +  A+ +   +   P+ +E   V    + G+ ++
Sbjct: 145 KRLLRLEEQLPEAADLLSRALRAGHSLPSALDMAGSELPAPIGAELALVFSEINYGVPMN 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +   +P++++ +    + +Q + GGNL+E L N+  ++R R  +  KV+ LS E 
Sbjct: 205 DALAGLTDRVPIEDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +   WI+  LP  V  +VY  +P  ++ L  DP G  +L  A     +G++ +R ++   
Sbjct: 265 RMGGWILTLLPPVVGVIVYELNPDLISTLWKDPTGLKMLWYAITMTCVGVIWIRQIVRIH 324

Query: 187 V 187
           +
Sbjct: 325 I 325


>gi|110679392|ref|YP_682399.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455508|gb|ABG31713.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 320

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 100/188 (53%), Gaps = 14/188 (7%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +    G  + 
Sbjct: 140 KRLAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVSKEVQDPLASEMGVIADESAYGRDVG 199

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  M   + +Q++ F +  +++Q   GGNL+E LA L++++R R  +  +V+A++ EA
Sbjct: 200 DALKEMAERLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVKAITAEA 259

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH-------MLLGVAAAFMLIGIMVM 179
           K S   + + P     ++    P Y + +    R H        L+G+   F+ + + VM
Sbjct: 260 KWSGKFLSAFPVVALIVINVGDPNYYDAV----RDHAYFIPACFLVGI---FLALNLFVM 312

Query: 180 RLMINFDV 187
           R++ +  V
Sbjct: 313 RVLTDIKV 320


>gi|90406746|ref|ZP_01214939.1| MaoC protein [Psychromonas sp. CNPT3]
 gi|90312199|gb|EAS40291.1| MaoC protein [Psychromonas sp. CNPT3]
          Length = 308

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 94/176 (53%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           ++  +F   FP  ++ I R+V AG+ V  A+A +       +  EF  + +   +G+SL 
Sbjct: 127 QQIKEFEHSFPQVIEQISRAVAAGISVPQAIAQVPEYQQGLLAHEFSLLRDRLEIGISLK 186

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++ +    +P     FFS  + +  + GG L E L +LSR L +   +K K+++L+ E 
Sbjct: 187 QALQQSTYRLPYSGFHFFSVALILNQENGGQLREVLHSLSRTLHNNHAIKMKIKSLTAEP 246

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + +A ++  LP C+ +++YF SP    VL + P G+ +L      M +G+ ++ ++
Sbjct: 247 RMTALVLACLPLCLISVMYFKSPASFAVLTDTPTGNDVLMYVIGSMALGLGIINVL 302


>gi|312139258|ref|YP_004006594.1| type ii secretion system integral membrane subunit [Rhodococcus
           equi 103S]
 gi|311888597|emb|CBH47909.1| putative type II secretion system integral membrane subunit
           [Rhodococcus equi 103S]
          Length = 622

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 104/184 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R A F D   ++L ++  ++RAG  +  A+  +  ++  P   EF R++    
Sbjct: 436 LRVMAGRRRAAFADQLDDSLQLLASNLRAGHSMLRALDSLSREAEVPTSEEFARIVNETR 495

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L+ES+  + R M   + ++ +  I++  ++GG+L+E L  +   +R+R  ++ +V+
Sbjct: 496 VGRDLNESLDDVARRMRSDDFNWIAQAIAINREVGGDLAEVLDQVGNTIRERNQIRRQVK 555

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+++ +LPF ++  +  ++P Y++ L     G++++ V    + +G + M 
Sbjct: 556 ALAAEGKLSAYVLMALPFGLTAFLLVSNPDYLSKLTGSAIGYVMIAVGLVMLTVGGLWMN 615

Query: 181 LMIN 184
            +++
Sbjct: 616 KVVS 619


>gi|325673437|ref|ZP_08153128.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
 gi|325555458|gb|EGD25129.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
          Length = 623

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 104/184 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R A F D   ++L ++  ++RAG  +  A+  +  ++  P   EF R++    
Sbjct: 437 LRVMAGRRRAAFADQLDDSLQLLASNLRAGHSMLRALDSLSREAEVPTSEEFARIVNETR 496

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L+ES+  + R M   + ++ +  I++  ++GG+L+E L  +   +R+R  ++ +V+
Sbjct: 497 VGRDLNESLDDVARRMRSDDFNWIAQAIAINREVGGDLAEVLDQVGNTIRERNQIRRQVK 556

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+++ +LPF ++  +  ++P Y++ L     G++++ V    + +G + M 
Sbjct: 557 ALAAEGKLSAYVLMALPFGLTAFLLVSNPDYLSKLTGSAIGYVMIAVGLVMLTVGGLWMN 616

Query: 181 LMIN 184
            +++
Sbjct: 617 KVVS 620


>gi|300704934|ref|YP_003746537.1| tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072598|emb|CBJ43948.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CFBP2957]
          Length = 325

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 94/172 (54%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P A D+I R++RAG  +  A+ +   +   PV  E   V    + G+S++++++ ++  
Sbjct: 154 LPEATDLISRALRAGHSLPSALEMAGDELPQPVGPELAIVFGQINYGVSMNDALAGLIDR 213

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
           +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI+ +
Sbjct: 214 VPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWILTA 273

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 274 LPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|283769335|ref|ZP_06342234.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
 gi|283103992|gb|EFC05376.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
          Length = 294

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 93/179 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR A F    P AL II   +R+G     A+A +     +P+  E +RVI   + G  L
Sbjct: 113 KKRLALFNKQLPEALVIIGNCLRSGFTFRHALARVSEDLPNPISEELKRVIREVNYGRKL 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ES+  +       E+   ++ +++Q + GGNL+E +  ++  + DR N++ +++ L+ +
Sbjct: 173 EESLGELASRTNSAELEMINSAVTIQQRSGGNLAEIVEKVTETINDRINIRNQIRVLTTQ 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + S  +IG LP  +  ++ + SP YMN       G ++L V+      G ++++ ++N
Sbjct: 233 GRYSGMLIGLLPVFLLIILTWISPNYMNSFFKTSIGKVMLVVSVILETTGFLLIQKIVN 291


>gi|317123666|ref|YP_004097778.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315587754|gb|ADU47051.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 652

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 96/172 (55%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P +L ++  S+R+G  +  A+  I   + DP+  EF R +    +G  +++++ RM   
Sbjct: 481 LPQSLMLVSTSLRSGFGLPQALDSIAKDAPDPLAKEFSRGLAETRIGTDIADALERMADR 540

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
           M  + +      I +Q ++GGNL+E L   +R LR+R+++  +V+ALS E + SA+I+ +
Sbjct: 541 MGSRSMRMAVMAIRIQREVGGNLAETLETTARTLRERESLHRQVRALSAEGRLSAYILIA 600

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           LP  +   + + + GY+++L   P G M+L      ++ GI  MR ++  +V
Sbjct: 601 LPIGLFFYMMWVNYGYISLLWTHPLGLMMLVGGIVLLIGGIFWMRQVVKIEV 652


>gi|163846104|ref|YP_001634148.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523839|ref|YP_002568309.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
 gi|163667393|gb|ABY33759.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447718|gb|ACM51984.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
          Length = 332

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 99/185 (53%), Gaps = 4/185 (2%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R   F +   + + ++  ++R G      + ++  ++  P  +EFRRV++   LG S  
Sbjct: 148 QRIKAFNNQLGDVITMMANALRGGYSFLQTLDMVSREAPPPAATEFRRVVQEVGLGRSTE 207

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  ++R MP  ++    T +++Q ++GGNL++ L  +   +R+R  +K ++  L+ + 
Sbjct: 208 EALQNLLRRMPSDDLDLLITAVTIQMEVGGNLAQILDTIGHTIRERVRIKGEISTLTAQG 267

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLLGVAAAFML-IGIMVMRLM 182
           + S+WII  LP  ++  +   +P YM  L      P+    + VA+ FM+ +G   ++ +
Sbjct: 268 RISSWIITGLPIGLAMFITVVNPDYMAPLFTFGFPPQAWCCMPVASLFMIAMGYFAIQKI 327

Query: 183 INFDV 187
           I+ +V
Sbjct: 328 IDIEV 332


>gi|83749634|ref|ZP_00946617.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|207744162|ref|YP_002260554.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
 gi|83723695|gb|EAP70890.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|206595566|emb|CAQ62493.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
          Length = 325

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 94/173 (54%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P A D+I R++RAG  +  A+ +   +   P+  E   V    + G+S++++++ ++ 
Sbjct: 153 QLPEATDLISRALRAGHSLPSALEMAGDELPQPIGPELAIVFGQINYGVSMNDALAGLID 212

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI+ 
Sbjct: 213 RVPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWILT 272

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           +LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 273 ALPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|87308907|ref|ZP_01091045.1| putative membrane protein [Blastopirellula marina DSM 3645]
 gi|87288250|gb|EAQ80146.1| putative membrane protein [Blastopirellula marina DSM 3645]
          Length = 310

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 82/160 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
            +R   F D FP+AL++I R+VRAG     A+ ++   S DP+  EFRR  +   +GLS 
Sbjct: 129 NRRLRAFQDQFPSALELIARAVRAGESFEQAIQLVGESSEDPIGVEFRRCAKQLDVGLSA 188

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  M   + L +V  F+T ISV  + GG L E L  L+ ++RDR     ++++++  
Sbjct: 189 PKAMEGMADRVELMDVKIFATTISVHRESGGALPETLDRLAAVIRDRMAYHRQLRSITSS 248

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
            + SA II  L   +        P Y +     P G  LL
Sbjct: 249 GRMSATIIALLAPLLLVFFLLFQPEYFSEFFAHPWGRYLL 288


>gi|207728102|ref|YP_002256496.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
 gi|206591347|emb|CAQ56959.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
          Length = 325

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 94/173 (54%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P A D+I R++RAG  +  A+ +   +   P+  E   V    + G+S++++++ ++ 
Sbjct: 153 QLPEATDLISRALRAGHSLPSALEMAGDELPQPIGPELAIVFGQINYGVSMNDALAGLID 212

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI+ 
Sbjct: 213 RVPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWILT 272

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           +LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 273 ALPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|311743552|ref|ZP_07717358.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
 gi|311312682|gb|EFQ82593.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
          Length = 314

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 98/190 (51%), Gaps = 4/190 (2%)

Query: 2   KHLIKKRTAKFLDDFPNALD----IIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE 57
           K  +K RTAK   +F   LD    ++  S+RAG     A+      +  P++ E  R++ 
Sbjct: 125 KMWVKMRTAKRRREFNAQLDGMLQMLASSMRAGQSFQQAMGSCARDADSPMQDELTRILN 184

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              LG  +  S++     M  ++  + +  + +  + GGNL+E +  +++++RDR  ++ 
Sbjct: 185 ENRLGRDIIASMNDTAERMECEDFVWLAEAVELTRESGGNLNEIIDRVAQMIRDRSEIRE 244

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           KV A + E + S++I+ SLP  ++    F +PGY++ L +   G  L+G +     I  +
Sbjct: 245 KVHAYASEGRFSSYILMSLPLLIAVAYSFITPGYLDPLFSTGLGLALVGGSVVMYTIAFL 304

Query: 178 VMRLMINFDV 187
            MR++++  V
Sbjct: 305 WMRIIVDIKV 314


>gi|329905443|ref|ZP_08274133.1| type II secretion system protein [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547600|gb|EGF32398.1| type II secretion system protein [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 161

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 89/161 (55%)

Query: 27  VRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFST 86
           +RAG+ ++ A   +V +S  P+  EF  ++  Q LG++L +S++ + R +P    +   +
Sbjct: 1   MRAGVGLNAATQQLVAESQPPLAQEFSLMLREQRLGVTLEQSLTNLSRRIPTTTTTLVVS 60

Query: 87  VISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYF 146
            + + ++ GG L+EAL   S  +R R  M+ K+ AL+ + K  AW++G LP  +  ++  
Sbjct: 61  AMRIAAETGGGLAEALERTSHTVRSRLQMEGKIGALTAQGKLQAWVVGMLPLSLMAVLNK 120

Query: 147 TSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             P  M+ L +   G   L V A   ++G++++R ++  DV
Sbjct: 121 MEPESMSYLWHSQVGWATLAVIAFLEIMGVVLIRKIVAIDV 161


>gi|90412172|ref|ZP_01220178.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
 gi|90326896|gb|EAS43281.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
          Length = 302

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 90/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LIKKR  +F   FP+AL+I++ +V AG  V  +++ +     + V   F+ + E   LG 
Sbjct: 119 LIKKRQNEFEQAFPDALNIMMSAVTAGESVMQSISYVGKTLDNKVGDLFQDMGERLKLGE 178

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              +   R  ++ P     FF   I      GG L   +A L R+L D + +  K  A++
Sbjct: 179 PPEQVFKRASKHYPYPTFLFFVVTIRANMSRGGQLKAVMARLIRVLVDSRTLDKKKSAMT 238

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA I+ SLPF    ++ F SP  +N ++ DP G  +L        +G+ ++ L+I
Sbjct: 239 SEARLSAKIVASLPFIFMVILSFISPQNLNYVLTDPNGRYVLYYVVGSETLGLFIIWLLI 298


>gi|293604634|ref|ZP_06687036.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
 gi|292816965|gb|EFF76044.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
          Length = 272

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 101/185 (54%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L ++R  +F    P AL ++  ++RAG+ ++  +  +V QS  P+  EF  ++  Q LG
Sbjct: 88  QLRRRRAHRFEQQLPMALLMLAAAMRAGVALTTGLRHVVEQSGAPLAQEFGLMLREQRLG 147

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +    ++  +   MP    S     + + SQ GGNL+EAL ++++ LR R  ++AK+QAL
Sbjct: 148 VPWDAALENLQTRMPGDSTSLVVAAMRIASQTGGNLAEALESIAQTLRARLQLQAKLQAL 207

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + +  AWI+G+LP  +  ++    P  M +L + P G  +L +       G++++R +
Sbjct: 208 TSQGRLQAWIVGALPLLLLAVLDQLEPDIMGLLWHTPIGWGVLAILVVLETAGVLLIRRI 267

Query: 183 INFDV 187
           +  ++
Sbjct: 268 VRIEL 272


>gi|84685157|ref|ZP_01013056.1| Putative Flp pilus assembly protein TadB [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666889|gb|EAQ13360.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2654]
          Length = 316

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR        P+ALD++ R +  G P++  +  +     DP+ +EFR + +    G SL+
Sbjct: 136 KRADALTRQLPDALDLMKRGLSVGHPLNVTIRNVATTLPDPIAAEFRILADQVAYGDSLT 195

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  + R + +++  + S  + +Q   GGNL   L  L+R++R R  M+ +V A+S E 
Sbjct: 196 DAVDDLARRIDIEDFHYLSAAVQIQHATGGNLGAMLETLARVIRGRFAMRRRVSAVSSEG 255

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A I+ ++P  +      T+P Y   + +DP    + G   A +L   +++R +++F 
Sbjct: 256 RITAIILSAMPVLMYVGTSLTAPEYYASVKDDPAFWPMCGAILALVLGNALMLRKLVSFR 315

Query: 187 V 187
           V
Sbjct: 316 V 316


>gi|149909166|ref|ZP_01897823.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
 gi|149807690|gb|EDM67636.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
          Length = 311

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 94/180 (52%), Gaps = 1/180 (0%)

Query: 4   LIKKRTAKFLDD-FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L++ R  +  D  F   L  + R+V AG+ V  A+A I       +  EF  + +   +G
Sbjct: 127 LMRTRQHREFDAAFTQVLGQMSRAVSAGISVPQAIAQIADYQQGMLGREFSLIRDKLEIG 186

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L +++++    +P     FFS  + +  + GG L E L +LSR + D   +K K+++L
Sbjct: 187 IGLKQALNQASIRLPYVSFHFFSVALILNEENGGQLREVLHSLSRTVHDNAAIKMKIRSL 246

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A I+ SLP  +  ++YF +P     L   PRGH++LG     M +G+ ++ L+
Sbjct: 247 TAEPRMTAAILASLPILLIGVMYFKNPSAFITLTQSPRGHLVLGYVVTSMALGMAIIHLL 306


>gi|303241710|ref|ZP_07328207.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590711|gb|EFL60462.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 327

 Score = 90.5 bits (223), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 101/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKR     D   +A+ +I  S++AG     AV ++  + + P+  EF ++ +  + G +
Sbjct: 145 IKKRLRILNDQLNDAIVLISNSLKAGYSFFQAVDIVSKEMTGPMAEEFAQLQKEVNFGTT 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             +++  +V  +   ++    T + +Q Q+GGNLSE L N+S  +R+R  +K +V+ ++ 
Sbjct: 205 TEKALENLVTRVTSDDLELVVTAVLIQRQVGGNLSEVLDNISTTIRERIRIKGEVKTVTA 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + + S  II +LP  +  +++  +  ++ VL  DP G ++LG +    +IGI  +  +++
Sbjct: 265 QGRMSGMIIAALPPALGFILFLINKSHVMVLFTDPIGLIILGFSVFMEIIGIYFISRIVS 324

Query: 185 FDV 187
            +V
Sbjct: 325 IEV 327


>gi|32471257|ref|NP_864250.1| hypothetical protein RB1148 [Rhodopirellula baltica SH 1]
 gi|32396959|emb|CAD71929.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 314

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 91/179 (50%), Gaps = 3/179 (1%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P    +I R+VR+G  V+ A+ +I      P+R EF    E Q LG+    
Sbjct: 138 RNQQLSRQLPEVFQLISRAVRSGQTVTSALQMIAEDCPSPIREEFALCYEQQELGMWREL 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +  ++     + E+  F   + VQ++ GG+L E L NLS+++  R  ++ +++AL+ E +
Sbjct: 198 AFRKLAERNQVMELRIFVVALLVQNRSGGDLVELLDNLSKMVTKRLRLRDRIKALTAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             A ++  LPF     +   SP Y   L+  PR  +  GV+     IG +++R ++NF+
Sbjct: 258 MQALVLVVLPFVALGAIVLFSPEYAETLLERPRLLVATGVSQG---IGALLIRRIVNFE 313


>gi|84498180|ref|ZP_00996977.1| putative membrane protein [Janibacter sp. HTCC2649]
 gi|84381680|gb|EAP97563.1| putative membrane protein [Janibacter sp. HTCC2649]
          Length = 654

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  KF    P+ L ++  ++ +G  ++ A+  +   S+ P   EF R +    
Sbjct: 468 LRMLAGRRAKKFEQMLPDILMLVATTLASGFSLTQALDAVARDSAQPAGKEFSRTLAETR 527

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  +S+++  M   M  + + + +  I +Q  +GGNL++ L   +  LR+R+++K +V 
Sbjct: 528 IGADVSDALENMSVRMDSEAMRWTTMAIRIQRDVGGNLADTLRTTAHTLRERESLKRQVN 587

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SA+I+  LP  +   + +++P Y ++L     G ++L  +   M+IG + MR
Sbjct: 588 SLSAEGRLSAYILLGLPILLFVYMAWSNPAYTSLLWTRTVGILMLLGSGVSMVIGTLWMR 647

Query: 181 LMINFDV 187
            +I  +V
Sbjct: 648 KVIQIEV 654


>gi|156975615|ref|YP_001446522.1| Flp pilus assembly protein TadB [Vibrio harveyi ATCC BAA-1116]
 gi|156527209|gb|ABU72295.1| hypothetical protein VIBHAR_03348 [Vibrio harveyi ATCC BAA-1116]
          Length = 301

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 94/180 (52%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  KR   F   FP+AL+I++ +V AG  +  A + +       V  EF+ + +   LG 
Sbjct: 117 LQNKRRLDFEKKFPDALNILMSAVTAGESLMHAFSFVGENMEGEVGREFKEMGDRLKLGE 176

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +  + + R  +  P  E  FF+  I      GG L   LA L RIL D + +++K  A++
Sbjct: 177 NAEKVLLRSCKAFPYPEYIFFTITIRANINRGGQLKNVLARLIRILVDARTLESKRMAMT 236

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA ++ ++P   + +V    P +++ ++NDP+G M+L       ++G+ V+ L++
Sbjct: 237 SEARISAKVVAAIPIAFAFMVNQIDPSHIDFILNDPQGRMVLYYVVGSEVLGLFVVWLLV 296


>gi|148253056|ref|YP_001237641.1| putative Type II secretion system protein [Bradyrhizobium sp.
           BTAi1]
 gi|146405229|gb|ABQ33735.1| putative Type II secretion system protein precursor [Bradyrhizobium
           sp. BTAi1]
          Length = 329

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 92/159 (57%), Gaps = 1/159 (0%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +K+T + F+D FP+A+D + R +RAGLP++ A+  +    S PV   F  + +   +G+ 
Sbjct: 145 QKQTERMFVDLFPDAVDTVARMLRAGLPITVAMRTVAVDGSPPVSRVFGLIADELRIGVP 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L E++    R + L +  FF+  +++Q   GGNL+  L +LS I+R R+  + K +A + 
Sbjct: 205 LEEALDTNSREIGLPDFRFFAVAMTLQFATGGNLTATLESLSDIIRKRRAARLKAKAATG 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           E + +A+ +G++P   +  +    P Y+  L  DPRGH+
Sbjct: 265 EIRLTAYTLGAIPILTTGALLVVQPRYLTPLWTDPRGHL 303


>gi|327539549|gb|EGF26159.1| type II secretion system protein [Rhodopirellula baltica WH47]
          Length = 314

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 91/179 (50%), Gaps = 3/179 (1%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P    +I R+VR+G  V+ A+ +I      P+R EF    E Q LG+    
Sbjct: 138 RNQQLSRQLPEVFQLISRAVRSGQTVTSALQMIAEDCPSPIREEFALCYEQQELGMWREL 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +  ++     + E+  F   + VQ++ GG+L E L NLS+++  R  ++ +++AL+ E +
Sbjct: 198 AFRKLAERNQVMELRIFVVALLVQNRSGGDLVELLDNLSKMVTKRLRLRDRIKALTAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             A ++  LPF     +   SP Y   L+  PR  +  GV+     IG +++R ++NF+
Sbjct: 258 MQALVLVVLPFVALGAIVLFSPEYAETLLERPRLLVATGVSQG---IGALLIRRIVNFE 313


>gi|225872757|ref|YP_002754214.1| bacterial type II secretion system protein F domain protein
           [Acidobacterium capsulatum ATCC 51196]
 gi|225792618|gb|ACO32708.1| bacterial type II secretion system protein F domain protein
           [Acidobacterium capsulatum ATCC 51196]
          Length = 323

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 97/181 (53%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  KF    P+++D++ R++RAG  V+ A+ V+  Q  +PV SEF  V   Q+ GL   
Sbjct: 143 QRLKKFNAALPDSIDLLGRALRAGHSVASAIEVVSEQGQEPVASEFGEVFRAQNFGLPFR 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++ ++   +P  ++ F  T + VQ + GGNL+E L   + ++R+R  ++ +V+  + + 
Sbjct: 203 DAMLQLAERVPSSDLRFLVTAMMVQKETGGNLTEILDRTTYVIRERLRIQGEVKTKTAQG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +  I+  LP  +  L+   +P Y   L  DP G  +L   A  + +G   +  ++  +
Sbjct: 263 RLTGVILALLPIILGILINVINPDYAKPLFTDPLGKKMLYAGAGLISVGAFFINKIVKIE 322

Query: 187 V 187
           V
Sbjct: 323 V 323


>gi|54309664|ref|YP_130684.1| Flp pilus assembly protein TadB [Photobacterium profundum SS9]
 gi|46914102|emb|CAG20882.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum SS9]
          Length = 302

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 90/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L+KKR  +F   FP+AL+I++ +V AG  +  +++ +     + V + F+ + E   LG 
Sbjct: 119 LLKKRRDEFEQTFPDALNIMMSAVTAGESIMQSISYVGKTLDNKVGAVFQDMGERLKLGE 178

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              +   R  ++ P     FF   I      GG L   +A L R+L D + +  K  A++
Sbjct: 179 PPEQVFKRASKHYPYPTFLFFVVTIRANMSRGGQLKPVMARLIRVLVDSRTLDKKKSAMT 238

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA I+ SLPF     + F SP  +N ++ DP G  +L        +G+ ++ L+I
Sbjct: 239 SEARLSAKIVASLPFIFMVFLSFISPQNLNYVLTDPSGRYVLYYVVGSETLGLFIIWLLI 298


>gi|317403409|gb|EFV83922.1| hypothetical protein HMPREF0005_02048 [Achromobacter xylosoxidans
           C54]
          Length = 281

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 92/176 (52%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F    P AL ++  ++RAG+ +  A+  +V Q   P+  EF  ++  Q LG+   E+++R
Sbjct: 106 FEQQLPMALLMLASALRAGVALMPALRQVVAQGGAPLAQEFGLMLREQRLGVPWDEALAR 165

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           +   M  +  +     +    Q GGNL+EAL ++++ L  R  ++A+++ L+ + +  AW
Sbjct: 166 LNTRMTAESTTLMVAAMRTAVQTGGNLAEALDSIAQTLFARLQLQARLRTLTAQGRMQAW 225

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           I+G+LP  +   +    P  M  L + P G  +L V       G++++R ++  D+
Sbjct: 226 IVGALPVLLLIALDRLEPDIMMPLWHTPAGWTVLAVLGGLETAGVLLIRRIVRIDI 281


>gi|113867006|ref|YP_725495.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113525782|emb|CAJ92127.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 282

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 97/186 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K + +KR     D  P+AL ++  ++RAG     A+  +V +S  P+  EF  ++    L
Sbjct: 97  KKMQRKRLMAIEDQMPDALLMMSSALRAGASFPMALESVVAESRPPISQEFDLLMREVRL 156

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L +++  M + +P+ +    +  I++  ++GGNL+E L +++R LR++  M+ K++A
Sbjct: 157 GVDLMDALRNMEKRIPVPDFLMVTAAITISREVGGNLAETLESVARTLREKHQMEGKIRA 216

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +  ++    P  M  L + P G   L V A   L+G   +  
Sbjct: 217 LTAQGKMQGLVMTGLPLFLIVVLNHMEPVAMAPLFSSPIGWGTLSVIAVMELLGYKAISK 276

Query: 182 MINFDV 187
           + + DV
Sbjct: 277 ITHIDV 282


>gi|237798378|ref|ZP_04586839.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331021230|gb|EGI01287.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 294

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 92/171 (53%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRM 72
           ++  P  LD  VRS+++G  ++DAV   +  ++ P++    R+     LG+SL ++    
Sbjct: 121 IEQLPQLLDHSVRSLKSGRTLADAVLFGITAANQPLKEGMSRIERNVQLGVSLPDAARDF 180

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
                  E   F+  + V  + GGN SE + NL R++RDR+    +++A++ E + +A +
Sbjct: 181 AELYESDEFHLFALGLRVNHRYGGNASELMENLIRLIRDREQASRQLRAMTGETRMTALV 240

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           +G LP  ++      +P Y+  + ND  G +LL +A A  L+G +++  M+
Sbjct: 241 LGLLPVGMAGYFMAVNPAYLMHMWNDGSGRILLSMAFALQLLGCLMLWRML 291


>gi|319788659|ref|YP_004148134.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467171|gb|ADV28903.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 282

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 94/182 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  +  +  P+AL ++  S+RAG+  S A+ V+V     P+  E   V+  QH+G+  
Sbjct: 101 RRRLDRIQEQLPDALQMLASSLRAGVGFSPAMEVLVQDGQPPLAQELALVLRQQHMGVRA 160

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++    + +P+ +   F + +++  ++GGNL+E LA L+  LR R  M+ KV+AL+ +
Sbjct: 161 DEALESFSKRVPIVDAELFVSAVNISREVGGNLAETLATLAETLRRRLIMEKKVKALTAQ 220

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            K    ++  LP  +   +       M  + +   G +++GV      +G  + + ++  
Sbjct: 221 GKLQGIVMALLPVFLVGYLSLMYAETMAPMFHSWHGWLVIGVCVVMEYLGYRMCKKIMTI 280

Query: 186 DV 187
           DV
Sbjct: 281 DV 282


>gi|297581612|ref|ZP_06943534.1| flp pilus assembly protein TadB [Vibrio cholerae RC385]
 gi|297534019|gb|EFH72858.1| flp pilus assembly protein TadB [Vibrio cholerae RC385]
          Length = 299

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 95/181 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L +KR  +F D+ P+ +D ++R++R G P+      I  Q        F ++++   +
Sbjct: 114 QQLQQKRMERFRDELPDIIDGLIRALRVGAPMLAVFQDIANQHQGVTSRLFHQIVDELRV 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G ++++ +    + MP+ E  F + V+S+Q + GG L+  L  L   LR R  + A +Q 
Sbjct: 174 GRTMADVMKLAAQRMPIAEFRFLTIVLSLQQETGGRLANVLERLGNTLRSRAELNASIQT 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ E++ SA ++ +LP  V  +++ T   + N L+    G +++      +L G+ ++R 
Sbjct: 234 ITSESRNSAKVLAALPVLVMLVLFSTGREHFNFLMATTGGQIVMIYITISILFGLFLIRR 293

Query: 182 M 182
           M
Sbjct: 294 M 294


>gi|284991839|ref|YP_003410393.1| Type II secretion system F domain-containing protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284065084|gb|ADB76022.1| Type II secretion system F domain protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 310

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 88/169 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R A F D   ++L ++  S+RAG  +  AV  +  +++ P   EF R++    +G  L 
Sbjct: 130 RRQAAFADQLDDSLQLMASSLRAGHSLLRAVDAVSTEAAAPTSEEFARIVNETRVGRDLG 189

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   M   +  + +  I +  ++GGNL+E L  +   +R+R  ++ +V+ALS E 
Sbjct: 190 DALDEVAERMDSDDFRWVAQAIGIHREVGGNLAEVLDTVGHTIRERNAIRRQVKALSAEG 249

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K SA ++ +LPF +   +  T+P Y+        G++++      + +G
Sbjct: 250 KLSAVVLMALPFGIVGFLSVTNPAYLAGFTEGLAGYLMIAAVVVLLTVG 298


>gi|330959998|gb|EGH60258.1| hypothetical protein PMA4326_15684 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 294

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 93/179 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           + R  + ++  P  LD  VRS+++G  +SDAV   +  +  P++    R+     LG+SL
Sbjct: 114 RVRVRRMIEQLPQLLDHSVRSLKSGRTLSDAVLYGIAAADQPLKDGMSRIERNVQLGVSL 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++           E   F+  + V  + GGN SE + NL R++R+R+    +++A++ E
Sbjct: 174 PDAARDFAELYESDEFHLFALGLRVNHRYGGNASELMENLIRLIREREQAGRQLRAMTGE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + +A ++G LP  ++      +P Y+  + ND  G ++L +A    L+G +++  M+ 
Sbjct: 234 TRMTALVLGLLPVGMAGYFMVVNPDYLLHMWNDGSGRIMLSMAFGLQLLGCLMLWRMLR 292


>gi|187921508|ref|YP_001890540.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719946|gb|ACD21169.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 282

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 95/182 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    LG+ +
Sbjct: 101 KKRIGTLEKQLPDALLMMSGALRAGASFPSALEAVVHETTPPISQEFDLLMREIRLGIDM 160

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++AL+ +
Sbjct: 161 DIAMRNVEKRIPIPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIKALTSQ 220

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +    ++  LP  +  ++ F  P  M  L  +P G   L V      +G + +  + N 
Sbjct: 221 GRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTEPVGWATLAVIGVMEFLGYVSISKITNI 280

Query: 186 DV 187
           DV
Sbjct: 281 DV 282


>gi|156741662|ref|YP_001431791.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232990|gb|ABU57773.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 327

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 102/186 (54%), Gaps = 4/186 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KF     + ++++  S+R+G  +  ++ ++  ++ +P  SE+RRV++   LGL  
Sbjct: 142 KQRVTKFNAQLGDTINMLANSLRSGYSLLQSMELVSREAPEPTASEYRRVVQEVGLGLRT 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +++ +P +++    T + +Q + GGNL++ L  +   +R+R  +K ++  L+ +
Sbjct: 202 EDALDNLLKRVPSEDLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIAVLTAQ 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLLGVAAAFML-IGIMVMRL 181
            + SA++I  LP  ++  +   +P YM+ + +    P     L VA   M+ IG   +  
Sbjct: 262 GRISAYVITGLPIGLAIFITVINPNYMSPMFSFGMPPEHWCCLPVAGIVMIVIGFFAIMK 321

Query: 182 MINFDV 187
           +++ +V
Sbjct: 322 IVDIEV 327


>gi|319943384|ref|ZP_08017666.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
 gi|319743199|gb|EFV95604.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
          Length = 291

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL  +R   F    P+A+ +I  +VRAG  ++ A+  +  +   P   EF  ++    
Sbjct: 105 IRHLGAQRRKLFARQLPDAMMLIAGAVRAGASMTLALRQMASELPAPGGQEFELMLRELR 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG++L +++  + R M   ++  F   + + ++ GGNL+E L  L+  +R +  ++ K+ 
Sbjct: 165 LGVTLDDALLNLERRMGCDDLRLFGAAVRIANESGGNLAETLERLADTIRKKMALEDKIM 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +   W++  LP  V   ++   P  M  L++  +G ++  V A   ++G++ +R
Sbjct: 225 ALTAQGRMQGWVMVLLPLGVGAALFAIEPTAMAPLLHSWQGWIVCSVVAVLEIVGLLFIR 284

Query: 181 LMINFDV 187
            ++  D+
Sbjct: 285 RIMAIDI 291


>gi|313902405|ref|ZP_07835808.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
 gi|313467336|gb|EFR62847.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
          Length = 367

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 97/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R   F    P+AL ++  ++++G     A  V+  +   P+  EF  +++   + + L
Sbjct: 186 QQRLRAFDGQLPDALTLMANALKSGYSFLQAADVVAREMPPPIADEFAWLVKETRVNIPL 245

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++++ ++  +P  ++    T + +Q Q+GGNL+  L   +  +R+R  ++ +++ L+ +
Sbjct: 246 EDALANLLDRVPSADLDLVVTAVLIQKQVGGNLAGVLERTAETIRERVRLQGQIRTLTAQ 305

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + S WI+G+LP  +  L+   +P Y+  L+  P G  LLG        G++V+R +I  
Sbjct: 306 GRLSGWIVGALPVALLVLLSAMNPAYLQPLLATPLGWTLLGAGVVMEAAGVLVIRALIRV 365

Query: 186 DV 187
           DV
Sbjct: 366 DV 367


>gi|261856882|ref|YP_003264165.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837351|gb|ACX97118.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 284

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 98/184 (53%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  K     P+ L ++  S+RAGL  + A+  +   +  P+  EF  V+  Q +G+
Sbjct: 101 LKQRRIDKIQQQLPDGLMMVSGSMRAGLGFTAALESLARDTDPPLAQEFALVLREQRMGV 160

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L +++      +P+Q+V+ F + +++  ++GGNL+E+L +L+  LR R  M+ KV++L+
Sbjct: 161 KLEDALLHFNDRVPVQDVTLFVSAVNISREVGGNLAESLTSLASTLRRRLIMEGKVKSLT 220

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +    ++  +P  + T +    P  M+ L + P G  ++ VA     +G  +   ++
Sbjct: 221 AQGRLQGIVMALMPVGLLTFLTLAYPDTMHDLYHTPLGWGIIAVAVVMEYLGYRMSLKIV 280

Query: 184 NFDV 187
             D+
Sbjct: 281 TIDI 284


>gi|148655424|ref|YP_001275629.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567534|gb|ABQ89679.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 327

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 101/186 (54%), Gaps = 4/186 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  KF     + ++++  S+R+G  +  ++ ++  ++ +P  SE+RRV++   LGL  
Sbjct: 142 KQRVTKFNAQLGDTINMLANSLRSGYSLLQSMELVSREAPEPTASEYRRVVQEVGLGLRT 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +++ +P +++    T + +Q + GGNL++ L  +   +R+R  +K ++  L+ +
Sbjct: 202 EDALDNLLKRVPSEDLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIAVLTAQ 261

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLLGVAAAFML-IGIMVMRL 181
            + SA++I  LP  ++  +   +P YM  + +    P     L VA   M+ IG   +  
Sbjct: 262 GRISAYVITGLPIGLAIFITVINPNYMAPMFSFGMPPEHWCCLPVAGIVMIVIGFFAIMK 321

Query: 182 MINFDV 187
           +++ +V
Sbjct: 322 IVDIEV 327


>gi|309780756|ref|ZP_07675497.1| TadB protein [Ralstonia sp. 5_7_47FAA]
 gi|308920438|gb|EFP66094.1| TadB protein [Ralstonia sp. 5_7_47FAA]
          Length = 325

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 93/185 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P A D+I R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 HRRTRRLLKLEAQLPEATDLISRALRAGHSLPAALEMAGTELPAPIGAELAIVFSQINFG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+S++ + +   +P+ ++ +    I +Q + GGNL+E L N+ +++R R  +  KV+ L
Sbjct: 201 VSMSDAFAGLTDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  +   +Y  +P  M+ L     G  LL  A     +G++ +R +
Sbjct: 261 SAEGRLGGWILTLLPPVMGLAIYLLNPELMSTLWTTDAGIRLLWFAITMTCLGMLWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|241662161|ref|YP_002980521.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864188|gb|ACS61849.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 325

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 93/185 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P A D+I R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 HRRTRRLLKLEAQLPEATDLISRALRAGHSLPAALEMAGTELPAPIGAELAIVFSQINFG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+S++ + +   +P+ ++ +    I +Q + GGNL+E L N+ +++R R  +  KV+ L
Sbjct: 201 VSMSDAFAGLTDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  +   +Y  +P  M+ L     G  LL  A     +G++ +R +
Sbjct: 261 SAEGRLGGWILTLLPPVMGLAIYLLNPELMSTLWTTDAGIRLLWFAITMTCLGMLWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|319795560|ref|YP_004157200.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598023|gb|ADU39089.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 285

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 95/182 (52%), Gaps = 1/182 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR  +   + P+AL  I  ++RAG  +S AV V+V     P+  EF  V++ Q LG+S 
Sbjct: 105 KKRRQQIESELPDALLFIASALRAGSALSVAVQVLVRDQQGPLGQEFGLVLKEQRLGVSF 164

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++I +M + + + +       + V  ++GGNLSE L  L+  LR +  ++ ++QAL+ +
Sbjct: 165 DDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIQALTAQ 224

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +    ++   P  +  ++Y   P  M +L +   G  +L V    + +G  ++R ++  
Sbjct: 225 GRIQGLVMTLFPLLLMGVLYLMQP-TMGLLFSTKIGWAVLFVIGVMLFLGYAMIRKIVAI 283

Query: 186 DV 187
           D+
Sbjct: 284 DI 285


>gi|323529157|ref|YP_004231309.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386159|gb|ADX58249.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 282

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 95/186 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K + KKR        P+AL ++  ++RAG     A+  +V ++  P+  EF  ++    L
Sbjct: 97  KRMHKKRVEAIEKQLPDALLMMSGALRAGASFPTALEAVVHETPPPISQEFDLLMREIRL 156

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L  ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++A
Sbjct: 157 GIDLDIAMRNVEKRIPIPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLTMEGKIKA 216

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + +    ++  LP  +  ++ F  P  M  L   P G   L V     L+G   +  
Sbjct: 217 LTSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTKPVGWATLAVIGVMELLGYFSISK 276

Query: 182 MINFDV 187
           + + DV
Sbjct: 277 ITHIDV 282


>gi|319791196|ref|YP_004152836.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315593659|gb|ADU34725.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 285

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 98/182 (53%), Gaps = 1/182 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR  +   + P+AL  I  ++RAG  +S A+ V+V     P+  EF  V++ Q LG+S 
Sbjct: 105 KKRRQQIESELPDALLFIASALRAGSALSVAIQVLVRDQVGPLGQEFGLVLKEQRLGVSF 164

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++I +M + + + +       + V  ++GGNLSE L  L+  LR +  ++ +++AL+ +
Sbjct: 165 DDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIKALTAQ 224

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +    ++   P  +  ++Y   P  M++L     G ++L V A  +++G  ++R ++  
Sbjct: 225 GRIQGLVMTLFPLLLMGVLYLMQP-TMSLLFTTTIGWVVLTVIAIMLMLGYAMIRKIVAI 283

Query: 186 DV 187
           D+
Sbjct: 284 DI 285


>gi|330873644|gb|EGH07793.1| hypothetical protein PSYMP_04410 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 295

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 94/178 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL
Sbjct: 115 ERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQLGVSL 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++          E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E
Sbjct: 175 PDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGE 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +A ++G LP  ++      +P Y+  + ND  G ++L +A    ++G +++  M+
Sbjct: 235 TRMTAIVLGLLPVSMAGYFLAVNPDYLLHMWNDGSGQIMLSMAFGLQVLGCLMLWRML 292


>gi|330963435|gb|EGH63695.1| hypothetical protein PSYAC_02057 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 295

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 94/178 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL
Sbjct: 115 ERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQLGVSL 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++          E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E
Sbjct: 175 PDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGE 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +A ++G LP  ++      +P Y+  + ND  G ++L +A    ++G +++  M+
Sbjct: 235 TRMTAIVLGLLPVSMAGYFLAVNPDYLLHMWNDGSGQIMLSMAFGLQVLGCLMLWRML 292


>gi|147677787|ref|YP_001212002.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
 gi|146273884|dbj|BAF59633.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
          Length = 323

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 94/181 (51%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  KF     +AL I+  S+R+G     A+ ++  +   P+  EF   ++  + G    
Sbjct: 143 KRLVKFNGQIGDALIIMANSLRSGFSFLQAMDMVRKEMPGPIAKEFGAALQEMNWGTPTE 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  MV  +  +++    T + +Q Q+GGNL+E L  ++  +R+R  +K +++ L+ + 
Sbjct: 203 EALLNMVSRVNSEDLELVVTAVLIQRQVGGNLAEVLDKIAFTIRERVRIKREIKTLTAQG 262

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + S  IIG LP  +S  ++  +  YM VL     G  ++  A  F ++G+ +++ +I   
Sbjct: 263 RISGLIIGLLPIFLSIAIFLLNHAYMKVLFTSKAGLTMVSCAVLFQVLGLALIKKIIKIP 322

Query: 187 V 187
           V
Sbjct: 323 V 323


>gi|281356957|ref|ZP_06243447.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281316515|gb|EFB00539.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 294

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  KF     +AL +I  S++AG  ++ A+  +  Q+  P+  EFR +I+   
Sbjct: 108 LRQLKVRRLEKFNFQLEDALGVISSSLKAGFSINQALEEVAEQNIHPISVEFRLLIQEIR 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + +++  M R +  ++    +T I    Q GG L+  L  ++ ++R+R  +  KV+
Sbjct: 168 LGVPVEQALENMNRRLRSEDFELVATAILTARQTGGELTGTLERVASLIRERVRISNKVR 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+   +  A +I   P  +   +++ +P  +   + +P G  LL VA  F +IG +++R
Sbjct: 228 ALTALGRLQAILIALTPVALLIGLWWINPVMIRAFVTNPIGIALLIVAGIFDVIGFLIIR 287

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 288 RIVTIEV 294


>gi|37680190|ref|NP_934799.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|37198937|dbj|BAC94770.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
          Length = 294

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 101/189 (53%), Gaps = 8/189 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +H  +    +F    P+ +D + R+V+ G P+ D    +    S+  +   +R+    H 
Sbjct: 109 RHFEQLAINEFNTQMPDIIDSMERAVKVGAPLHDIFFAL----SEQYQGSAKRLFLAMHD 164

Query: 62  GLSLSESISRMVRY----MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
            L L  S+ R++++    MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M++
Sbjct: 165 RLKLGHSVERVMQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMES 224

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           +V+ ++ E++ SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++
Sbjct: 225 RVRTITSESRTSAKVLAILPPALIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLL 284

Query: 178 VMRLMINFD 186
           ++R +  F 
Sbjct: 285 LIRQLTKFK 293


>gi|89053484|ref|YP_508935.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863033|gb|ABD53910.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 322

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 94/182 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR +   +  P+A++++VRS+R G P   ++  +  + SDP+ SE   + +    G  +
Sbjct: 141 KKRLSLLEEQLPDAVELMVRSLRVGHPFVASINTVSREMSDPIASELGVIADEAAYGRDV 200

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +ESI  M   + +Q++ F +  + +Q   GGNL+E LA L+ ++R R  +  KV+ ++ E
Sbjct: 201 AESIRAMADRLDIQDLRFLAVAVGIQQTSGGNLAEILAGLADVMRARFKLFRKVRVITAE 260

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A+ S   +   P      +    P Y + +I+ P         A  + +  ++MR+++N 
Sbjct: 261 ARGSGNFLSVFPILALVGINVMQPDYYSEVIDTPVFIPAAAGVAVALGLNWVIMRVLVNI 320

Query: 186 DV 187
            V
Sbjct: 321 KV 322


>gi|307726637|ref|YP_003909850.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307587162|gb|ADN60559.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 282

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 93/182 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR        P+AL ++  ++RAG     A+  +V ++  P+  EF  ++    LG+ L
Sbjct: 101 KKRIEVIEQQLPDALLMMSGALRAGASFPTALEAVVHETPPPISQEFDLLMREIRLGIDL 160

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++AL+ +
Sbjct: 161 DIAMRNVEKRIPVPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLTMEGKIRALTSQ 220

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +    ++  LP  +  ++ F  P  M  L   P G   L V     L+G   +  + N 
Sbjct: 221 GRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTQPVGWATLAVIGVMELLGYFSISKITNI 280

Query: 186 DV 187
           DV
Sbjct: 281 DV 282


>gi|84385680|ref|ZP_00988711.1| hypothetical Flp pilus assembly protein TadB [Vibrio splendidus
           12B01]
 gi|84379660|gb|EAP96512.1| hypothetical Flp pilus assembly protein TadB [Vibrio splendidus
           12B01]
          Length = 300

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 95/182 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R  +F + FP+AL+I++ +V AG  +  A++ +     +P+  EF+ + +   L
Sbjct: 114 RFLVTRRRREFENTFPDALNILMSAVTAGDSLMQAISYVGDVMHNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   +A L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTIRANIARGGQLKGVMARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +  ++ DP G ++L       L G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFMLILNYVNPDNVEFVLYDPEGRLVLFYVLGSELFGLFLVWL 293

Query: 182 MI 183
           ++
Sbjct: 294 LV 295


>gi|91777215|ref|YP_552423.1| putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
 gi|91689875|gb|ABE33073.1| Putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
          Length = 282

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K + KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    
Sbjct: 96  LKRMRKKRIEALEKQLPDALLMMSGALRAGASFPAALEAVVYETAPPISQEFDLLMREIR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + + +P+ ++   +  +++  ++GGNL+EAL +++R LR++  M+ K++
Sbjct: 156 LGIDLDIAMRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F     M  L ++P G   L V      +G   + 
Sbjct: 216 ALTSQGRMQGIVMTCLPLFLMLVLRFMEAKAMAPLFSEPVGWATLAVIGVMECLGYFWIS 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 RITNIDV 282


>gi|294139874|ref|YP_003555852.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
 gi|293326343|dbj|BAJ01074.1| Flp pilus assembly protein TadB, putative [Shewanella violacea
           DSS12]
          Length = 311

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 90/172 (52%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +F   FP  L  I R+V AG+ V  A+A +       +  EF  + +   +G+SL +++ 
Sbjct: 135 QFDHAFPQVLGQISRAVAAGISVPQAIAQVSEYQQGFLGREFELIRDRLAIGISLKQTLE 194

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
           +    +P     FF+  + +  + GG L E L +L R L D   +K K+++L+ E + +A
Sbjct: 195 QACYRLPYASFHFFTVALILNQENGGQLREVLHSLGRTLHDNGAIKMKIKSLTAEPRMTA 254

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
            I+ SLP  + ++++F +P    VL N   GH +L    + + +G+ ++ ++
Sbjct: 255 LILASLPLILISIMFFKNPTSFAVLTNTQTGHHVLVYVVSSIALGLGIINML 306


>gi|163856390|ref|YP_001630688.1| hypothetical protein Bpet2079 [Bordetella petrii DSM 12804]
 gi|163260118|emb|CAP42419.1| putative membrane protein [Bordetella petrii]
          Length = 281

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 92/158 (58%)

Query: 30  GLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVIS 89
           G+ VS A+  IV  S  P+  EF  ++  Q LG+S   +++R+ + +P +  +  +  + 
Sbjct: 124 GVGVSTALRHIVDHSEPPLAQEFGLMLREQRLGVSFDAALARLSQRVPSEASALVAAALR 183

Query: 90  VQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSP 149
           V +  GGNL+E L  ++R LR+R  ++ KV+AL+ + +  AWI+G+LP  ++ ++    P
Sbjct: 184 VATHTGGNLAETLDGIARTLRERLQLQGKVRALTAQGRLQAWIVGALPLLLAAVLDRMEP 243

Query: 150 GYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             M +L + P G  +L V A     G++++R +++ D+
Sbjct: 244 DAMAILWHTPLGWAVLAVVAGLETAGVLLIRRIVDIDI 281


>gi|27365655|ref|NP_761183.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|27361803|gb|AAO10710.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
          Length = 294

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 101/189 (53%), Gaps = 8/189 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +H  +    +F    P+ +D + R+V+ G P+ D    +    S+  +   +R+    H 
Sbjct: 109 RHFEQLAINEFSMQMPDIIDSMERAVKVGAPLHDIFFAL----SEQYQGSAKRLFLAMHD 164

Query: 62  GLSLSESISRMVRY----MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
            L L  S+ R++++    MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M++
Sbjct: 165 RLKLGHSVERVMQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMES 224

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           +V+ ++ E++ SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++
Sbjct: 225 RVRTITSESRTSAKVLAILPPVLIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLL 284

Query: 178 VMRLMINFD 186
           ++R +  F 
Sbjct: 285 LIRQLTKFK 293


>gi|320156057|ref|YP_004188436.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|319931369|gb|ADV86233.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 294

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 101/189 (53%), Gaps = 8/189 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +H  +    +F    P+ +D + R+V+ G P+ D    +    S+  +   +R+    H 
Sbjct: 109 RHFEQLAINEFNMQMPDIIDSMERAVKVGAPLHDIFFAL----SEQYQGSAKRLFLAMHD 164

Query: 62  GLSLSESISRMVRY----MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
            L L  S+ R++++    MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M++
Sbjct: 165 RLKLGHSVERVMQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMES 224

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           +V+ ++ E++ SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++
Sbjct: 225 RVRTITSESRTSAKVLAILPPALIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLL 284

Query: 178 VMRLMINFD 186
           ++R +  F 
Sbjct: 285 LIRQLTKFK 293


>gi|28871969|ref|NP_794588.1| hypothetical protein PSPTO_4854 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968013|ref|ZP_03396159.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301383671|ref|ZP_07232089.1| hypothetical protein PsyrptM_13603 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059960|ref|ZP_07251501.1| hypothetical protein PsyrptK_08210 [Pseudomonas syringae pv. tomato
           K40]
 gi|302131626|ref|ZP_07257616.1| hypothetical protein PsyrptN_09547 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855222|gb|AAO58283.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927356|gb|EEB60905.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 295

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 94/179 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL
Sbjct: 115 ERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQLGVSL 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++          E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E
Sbjct: 175 PDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGE 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + +A ++G LP  ++      +P Y+  + +D  G ++L +A    ++G +++  M+ 
Sbjct: 235 TRMTAIVLGLLPVSMAGYFLAVNPDYLLQMWSDDSGRIMLSMAFGLQMLGCLMLWRMLR 293


>gi|331014705|gb|EGH94761.1| hypothetical protein PLA106_02335 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 295

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 94/179 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL
Sbjct: 115 ERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQLGVSL 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++          E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E
Sbjct: 175 PDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGE 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + +A ++G LP  ++      +P Y+  + +D  G ++L +A    ++G +++  M+ 
Sbjct: 235 TRMTAIVLGLLPVSMAGYFLAVNPDYLLQMWSDDSGRIMLSMAFGLQILGCLMLWRMLR 293


>gi|258624767|ref|ZP_05719698.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|262173890|ref|ZP_06041567.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|258582929|gb|EEW07747.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|261891248|gb|EEY37235.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
          Length = 303

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G    E
Sbjct: 124 KTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIGEDPDE 183

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL+ EA+
Sbjct: 184 VLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNALTSEAR 243

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           +SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + +++
Sbjct: 244 SSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMIL 299


>gi|262164952|ref|ZP_06032690.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
 gi|262027332|gb|EEY45999.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
          Length = 303

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G    E
Sbjct: 124 KTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIGEDPDE 183

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL+ EA+
Sbjct: 184 VLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNALTSEAR 243

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           +SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + +++
Sbjct: 244 SSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMIL 299


>gi|258620799|ref|ZP_05715834.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
 gi|258586997|gb|EEW11711.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
          Length = 303

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G    E
Sbjct: 124 KTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIGEDPDE 183

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL+ EA+
Sbjct: 184 VLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNALTSEAR 243

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           +SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + +++
Sbjct: 244 SSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMIL 299


>gi|153833200|ref|ZP_01985867.1| TadB [Vibrio harveyi HY01]
 gi|156977405|ref|YP_001448311.1| Flp pilus assembly protein TadB [Vibrio harveyi ATCC BAA-1116]
 gi|148870471|gb|EDL69386.1| TadB [Vibrio harveyi HY01]
 gi|156528999|gb|ABU74084.1| hypothetical protein VIBHAR_06192 [Vibrio harveyi ATCC BAA-1116]
          Length = 300

 Score = 84.3 bits (207), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 94/182 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L+ +R   F + FP+AL+I++ +V AG  +  A++ +     + +  EF+ + +   L
Sbjct: 114 RYLVTRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGDVMDNSIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  +      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTLRANIARGGQLKGVLARLIRVLVDARTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N ++ DP G ++L         G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFMIILNYVNPDNVNFVLYDPSGRLVLFYVLGSEFFGLFIVWL 293

Query: 182 MI 183
           ++
Sbjct: 294 LV 295


>gi|294676063|ref|YP_003576678.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474883|gb|ADE84271.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 322

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 96/176 (54%), Gaps = 4/176 (2%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           D  P+A++++VRS+R G P++ A+  +  +  DP+ +EF  + +    G ++ +S+  + 
Sbjct: 149 DQLPDAVELMVRSLRVGHPLASAIQAVAKEIPDPLGTEFGIIADEAAYGRNVVDSLRDLA 208

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             + +Q++ F +  +S+Q   GGNL+E L  L++++R R  +  +V+A++ E K S   +
Sbjct: 209 ERLDMQDLRFLAVAVSIQQTSGGNLAEVLEGLAKVIRSRFRLFRRVRAITAEPKWSGVFL 268

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG--IMVMRLMINFDV 187
            + P  V  ++   +P Y + + + P    +      F L+G  ++ M++M    V
Sbjct: 269 SAFPVAVLVVIQVVAPTYYDNVKDSP--SFVPAALIVFALLGANVLFMKIMTTIKV 322


>gi|312882148|ref|ZP_07741897.1| Flp pilus assembly protein TadB [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370194|gb|EFP97697.1| Flp pilus assembly protein TadB [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 300

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 93/183 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ KR   F + FP+AL+I++ +V AG  +  A+  +     + +  EF+R+ +   L
Sbjct: 114 RSLVTKRRRDFENTFPDALNILMSAVSAGDSLMQAIIYVGDVMDNAIGREFKRMGDRFKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   LA L R+L + + ++ K  A
Sbjct: 174 GESPDVILHRACKTYPYPEFLFFTVTIRANIARGGQLKGVLARLIRVLVESRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+  +P     L+ + +P  ++ +++DP G  LL        +G+ ++ L
Sbjct: 234 MTSEARISAKIVAMIPVIFMLLLNYINPENIDFILHDPSGRGLLYYVVGSEFLGLFIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVK 296


>gi|302185192|ref|ZP_07261865.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           642]
          Length = 294

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+  M+
Sbjct: 236 MTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLWRML 291


>gi|66047621|ref|YP_237462.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258328|gb|AAY39424.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 294

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+  M+
Sbjct: 236 MTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLWRML 291


>gi|330969403|gb|EGH69469.1| type II secretion system protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 294

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+  M+
Sbjct: 236 MTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLWRML 291


>gi|148975966|ref|ZP_01812755.1| hypothetical Flp pilus assembly protein TadB [Vibrionales bacterium
           SWAT-3]
 gi|145964711|gb|EDK29964.1| hypothetical Flp pilus assembly protein TadB [Vibrionales bacterium
           SWAT-3]
          Length = 300

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 94/182 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R   F + FP+AL+I++ +V AG  +  A++ +     +P+  EF+ + +   L
Sbjct: 114 RFLVTRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGEVMDNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  +      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLKRSCKNYPYPEFLFFTVTLRANIARGGQLKGVLARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N ++ D  G ++L       L G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLVFMIILNYVNPDNVNYVLYDESGRVVLFYVLGSELFGLFIVWL 293

Query: 182 MI 183
           ++
Sbjct: 294 LV 295


>gi|94312589|ref|YP_585798.1| type II secretion system protein, pilus assembly, transmembrane
           part [Cupriavidus metallidurans CH34]
 gi|93356441|gb|ABF10529.1| type II secretion system protein, pilus assembly, transmembrane
           part [Cupriavidus metallidurans CH34]
          Length = 309

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 84/171 (49%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++   K L   P  LD +VR +  G  V  A    V  +  P+R    +VI  Q  G  
Sbjct: 128 IRRIKEKMLRQLPGFLDGVVRLMTIGSSVPAAFQNSVANTEPPLRQCLVQVIHLQRAGKE 187

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++ +M R   L E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS 
Sbjct: 188 LDQAVLQMGRAYDLDELVIVSSVLRLSQRYGGRADVVMERTATFMRDREEAQRELMALSA 247

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G LP  V   ++  + GY+ ++  DP G  +L  AA   + G
Sbjct: 248 ETRMSAWVLGLLPLIVGGGMFVFNAGYILLMWRDPGGRAMLLTAAGLEVAG 298


>gi|332798624|ref|YP_004460123.1| Type II secretion system F domain-containing protein
           [Tepidanaerobacter sp. Re1]
 gi|332696359|gb|AEE90816.1| Type II secretion system F domain protein [Tepidanaerobacter sp.
           Re1]
          Length = 309

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 97/184 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K  I K+  +F     +AL I+   +RAG  ++ A+  +     DP+ SEFR       
Sbjct: 123 LKMSINKKQIQFEKQLGDALQILANGLRAGFSLTQAIESLAKDMPDPLGSEFRTASRELL 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ +   +S++   M  +++   +  + +Q Q+GGNL+E L N+S+ +RDR  +K  V+
Sbjct: 183 LGMDIETVLSKIADRMKSEDMRLLTAAVVIQLQVGGNLAEILDNISQTIRDRLAIKRSVR 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+G +P  +  ++   SP Y ++      GH+++ ++     +G + + 
Sbjct: 243 TLTAQGRISGQIVGIIPIALLLIISIISPDYTSIFFTTTYGHIMIFISVIMECLGFLAIY 302

Query: 181 LMIN 184
            +++
Sbjct: 303 KIVD 306


>gi|168699470|ref|ZP_02731747.1| hypothetical protein GobsU_08112 [Gemmata obscuriglobus UQM 2246]
          Length = 330

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 89/176 (50%), Gaps = 3/176 (1%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K+L     A +++ R +R G  V++A    VG   DP+  EF R +     G+    +  
Sbjct: 157 KYLRQIAGAFELMARVIRTGQSVTEAFRAAVGAFDDPLAEEFGRCVHQIEHGIRPEAAFR 216

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            M     + E+  F   +++Q Q GGNLSE L  L+ ++R R  ++ K++AL+ E +  +
Sbjct: 217 EMSDRADVLELRIFVVAMTIQRQTGGNLSEVLDRLAGVVRARLRVRQKIRALTAEGRMQS 276

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             +  LP  V  ++YF +  Y   L+   R  +LLG     + +G + +R ++NF+
Sbjct: 277 RTLTVLPVVVFAMMYFLNRPYAEGLLAQWR--LLLGTVTC-VAVGTLWIRNIMNFE 329


>gi|149927030|ref|ZP_01915288.1| type II secretion system protein [Limnobacter sp. MED105]
 gi|149824251|gb|EDM83471.1| type II secretion system protein [Limnobacter sp. MED105]
          Length = 302

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 88/179 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  + L   PN LD +VR    G  ++ +    +  +  P++      ++ Q+ GL L
Sbjct: 122 RKRRLQMLGQLPNFLDGVVRVSAVGYSLTVSFNTALENAEQPLKEALGLAVQMQYAGLEL 181

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++ R+ R   L E    ++V+++    GG     L  L++ LRDR+    ++ A+S E
Sbjct: 182 DQAMHRLARVYGLSEFKLIASVVALALNYGGKSDILLGRLAQYLRDREQHHQEMLAMSSE 241

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA  +  L   ++ ++   +P Y+  + ND  G MLL VA    + G  ++  M+ 
Sbjct: 242 ARMSAVFMCCLTPALAGIILTLNPAYLGTMWNDDTGRMLLFVAGILQIAGAAIIYRMVK 300


>gi|325964117|ref|YP_004242023.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470204|gb|ADX73889.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 309

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 88/169 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R AKF     + + +++  +R G  V  +V     ++  P   E  R++    +G    
Sbjct: 129 RRRAKFEGQLTDTIQMLIGGLRVGHSVLRSVEAAAQEADVPTSEELLRIVNETRIGKDSR 188

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            +   +   M  ++  + S  I +  ++GG+L+E L  ++  +R+R  +K ++++LS E 
Sbjct: 189 LAFEDVAERMDSEDFRWISQAIQINREVGGDLAEVLEQVAGTIRERSEIKGQIRSLSAEG 248

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K SA+++ ++P  V+ ++ F + GY+NV +  P G ++L +A     +G
Sbjct: 249 KMSAYVLMAMPVGVAFILAFINSGYLNVFVEKPLGLVMLVMAIVMFTVG 297


>gi|330953056|gb|EGH53316.1| type II secretion system protein [Pseudomonas syringae Cit 7]
          Length = 294

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 90/176 (51%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + +D  G ++L +A A  + G +V+  M+
Sbjct: 236 MTALVLALLPITMAGYFLAVNPSYLLHMWDDDSGKIMLSMAFALQVTGCVVLWRML 291


>gi|91775992|ref|YP_545748.1| type II secretion system protein [Methylobacillus flagellatus KT]
 gi|91709979|gb|ABE49907.1| type II secretion system protein [Methylobacillus flagellatus KT]
          Length = 303

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 93/180 (51%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +++R    +   P  +D + R++  G  V  AV  +      P+R+   RV+    LG  
Sbjct: 122 LQRRQRIIVTQIPLFIDQVSRALSTGKSVEGAVRSVTEDMQMPLRAVLDRVVRATDLGAG 181

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            ++++ +      ++E+   +  I + S  G +  E L ++ +++R ++  + ++ A++ 
Sbjct: 182 FADAMQKAAELHHIKELGLIALAIRISSNYGSSPQEMLKSIVQMIRQQEQAQRELAAMTG 241

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E K +AW++   P  +   ++  +PGY+++++NDP G ++   A A  ++G+++   M+ 
Sbjct: 242 ETKMTAWVLSLTPLLIVGYMFIANPGYIDMMLNDPSGALIFKAALAMQVVGVLIFWRMMK 301


>gi|255658707|ref|ZP_05404116.1| type II secretion system protein F domain protein [Mitsuokella
           multacida DSM 20544]
 gi|260849094|gb|EEX69101.1| type II secretion system protein F domain protein [Mitsuokella
           multacida DSM 20544]
          Length = 319

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 88/170 (51%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           KF +   + L ++  ++RAG     A  +I  +   P+  E + V+   +LG +L  ++ 
Sbjct: 143 KFTNQLGDMLTMVANALRAGFSFMQAFELISREMDAPMGREVQLVVNEVNLGNTLESALD 202

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            M R +   +     T + +Q Q+GG+L+  L  +S  + +R  M+ +V  L+ + + S 
Sbjct: 203 NMQRRVASPDFELVVTAVLIQRQVGGDLASILDTISETIAERVRMRREVMTLTAQGRLSG 262

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++  LPF ++ ++ F  P Y+  L+ D  G +++G+A    LIGI  ++
Sbjct: 263 IVLAILPFAMAGILTFIKPDYLKPLLEDEVGRIIIGIAIVSELIGIFFIK 312


>gi|330976794|gb|EGH76830.1| type II secretion system protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 294

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 91/178 (51%), Gaps = 4/178 (2%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYF--TSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  +ST  YF   +P Y+  + +D  G ++L  A A    G +V+  M+
Sbjct: 236 MTAVVLALLP--ISTAGYFLAVNPNYLLHMWDDESGKIMLSAAFALQATGCVVLWRML 291


>gi|264680615|ref|YP_003280525.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262211131|gb|ACY35229.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 321

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 86/181 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K  A+     P  LD  VR V  G  V  A  +    + DP++S   +       G+ L
Sbjct: 137 QKYRARLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLARAGMDL 196

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + A++ E
Sbjct: 197 ENAVAHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLSAMTAE 256

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAW++  LP  V  L+   +  Y   + +D  G  ++GVAAA  + G++++  +   
Sbjct: 257 TRLSAWVLSLLPVAVCCLIISFNASYFLNMWDDASGRNIIGVAAALQVFGVVLLYRLAKL 316

Query: 186 D 186
           D
Sbjct: 317 D 317


>gi|59713407|ref|YP_206182.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
 gi|59481655|gb|AAW87294.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
          Length = 307

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 2/181 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L K+   +F + FP+AL+++  +V AG  +  AV V VG+S D  V  EF+R+ E   LG
Sbjct: 123 LRKREKNRFEESFPDALNMMSSAVSAGEGIMQAV-VFVGRSLDGKVGKEFKRMGEQLQLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    Q GG L E +  L+R++   + ++ K  AL
Sbjct: 182 ESPDTVFRKSCERFPYPSFQFFIITLRTSMQRGGQLKEVMKRLNRLMFGARAIEKKKLAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA I+ ++PF    ++ + SP     ++ +P G  +L        IGI+++ L+
Sbjct: 242 TSEARASAKIVAAIPFIFLFMLQYLSPENYEFVMFNPAGRPILYYVLISESIGILIIWLL 301

Query: 183 I 183
           +
Sbjct: 302 M 302


>gi|197337544|ref|YP_002157816.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
 gi|197314796|gb|ACH64245.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
          Length = 307

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 2/181 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L K+   +F + FP+AL+++  +V AG  +  AV V VG+S D  V  EF+R+ E   LG
Sbjct: 123 LRKREKNRFEESFPDALNMMSSAVSAGEGIMQAV-VFVGRSLDGKVGKEFKRMGEQLQLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    Q GG L E +  L+R++   + ++ K  AL
Sbjct: 182 ESPDTVFRKSCERFPYPSFQFFIITLRTSMQRGGQLKEVMKRLNRLMFGARAIEKKKLAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA I+ ++PF    ++ + SP     ++ +P G  +L        IGI+++ L+
Sbjct: 242 TSEARASAKIVAAIPFIFLFMLQYLSPENYEFVMFNPAGRPILYYVLISESIGILIIWLL 301

Query: 183 I 183
           +
Sbjct: 302 M 302


>gi|42521750|ref|NP_967130.1| hypothetical protein Bd0110 [Bdellovibrio bacteriovorus HD100]
 gi|39574280|emb|CAE77784.1| TadB [Bdellovibrio bacteriovorus HD100]
 gi|51468908|emb|CAE47781.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 291

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 95/186 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + + ++R  KF+D   + L I+   ++AG    +++  +V    +P+  EF +V+    +
Sbjct: 106 RMIYEQRCTKFVDQMVDGLTIMANGIKAGSNPQESMKRVVEIMGNPMSQEFAQVLYQMQV 165

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S   +++ +   +P  +V  F T I++  + GGNL+E    +  ++R+R+ ++ K+QA
Sbjct: 166 GDSFESALNDLGNRIPRPDVQMFVTSINILKETGGNLAETFQTIVLVVRERQKVEKKIQA 225

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ +      I+  +PF +  +     P ++  + N   G +LL       +IG ++++ 
Sbjct: 226 LTAQGMMQGIIVTLIPFILMAVFLVIDPAFIKPMFNTTLGLVLLAAMLGLQIIGGVLIKK 285

Query: 182 MINFDV 187
           ++   V
Sbjct: 286 LVTIKV 291


>gi|188592035|ref|YP_001796633.1| type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938409|emb|CAP63396.1| Type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 308

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 92/180 (51%), Gaps = 1/180 (0%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q  G
Sbjct: 125 HRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQNSIANTEAPLRQCLVQAVHLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L +++ ++ R   ++E+   ++V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KELDQAVLQVGRAYKVEELVLVASVLRLSVRYGGRADVVMERTATFMRDREQAQRELMAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
           S E + SAW++G LP  V+  ++  + GY+ ++  DP G  +L  AAA  + G +M+ RL
Sbjct: 245 SAETRLSAWVLGLLPLVVAGGLFTLNAGYILMMWKDPTGKTMLLSAAALEVAGALMLYRL 304


>gi|330895622|gb|EGH27929.1| type II secretion system protein [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 293

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 88/176 (50%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 115 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQLGVSLPD 174

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 175 AARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 234

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + +D  G ++L  A A    G +V+  M+
Sbjct: 235 MTAVVLALLPISMAGYFLAVNPNYLLHMWDDESGKIMLSAAFALQATGCVVLWRML 290


>gi|71733377|ref|YP_276553.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71553930|gb|AAZ33141.1| type II secretion system protein F domain protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 294

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 88/176 (50%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLQGIEATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+  M+
Sbjct: 236 MTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLWRML 291


>gi|289625309|ref|ZP_06458263.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647834|ref|ZP_06479177.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330867143|gb|EGH01852.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330871031|gb|EGH05740.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
          Length = 294

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 88/176 (50%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+  M+
Sbjct: 236 MTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLWRML 291


>gi|261251277|ref|ZP_05943851.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260938150|gb|EEX94138.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 304

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 93/181 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L +++  KF  +FP+AL+I+  ++ +G  +  A   +  Q ++ V +EF+ + E   +G
Sbjct: 120 KLKQRQEEKFKTNFPDALNILSGAISSGQSIVHAFEYVGKQLNNEVGNEFKFMAERLLIG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL
Sbjct: 180 EDPDDVLERSATTFPYLEYFFFASTIRINLSRGGQLKDVINRINRLMFDSRAVEKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA II  LP     ++ FTSP   + ++ +P G  +         IG + + L+
Sbjct: 240 TSEARASAKIIACLPVIFLVILKFTSPENYSFVMFEPGGQPIFYYVLISEFIGFVCIWLI 299

Query: 183 I 183
           +
Sbjct: 300 L 300


>gi|257483344|ref|ZP_05637385.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298488956|ref|ZP_07006979.1| Flp pilus assembly protein TadB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156454|gb|EFH97551.1| Flp pilus assembly protein TadB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322733|gb|EFW78826.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330482|gb|EFW86461.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330887978|gb|EGH20639.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330989173|gb|EGH87276.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012563|gb|EGH92619.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 294

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 88/176 (50%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 116 RVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQLGVSLPD 175

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 176 AARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 235

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+  M+
Sbjct: 236 MTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLWRML 291


>gi|319779647|ref|YP_004130560.1| Flp pilus assembly protein TadB [Taylorella equigenitalis MCE9]
 gi|317109671|gb|ADU92417.1| Flp pilus assembly protein TadB [Taylorella equigenitalis MCE9]
          Length = 281

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 90/179 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K LIKKR  K +  FP+ L  +  ++++G  +  ++ +I   S  P+  EF   +    L
Sbjct: 95  KWLIKKRQKKLIQQFPDFLLSLSNALKSGAGLQHSIKLINETSEKPISQEFALFLHQIRL 154

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S+ ES++ +++  P   +S F T++ V  + GGNL+  L  LS  +R+   +  K+ A
Sbjct: 155 GSSVEESLTVLLQRNPSMNMSQFVTLVKVSYKTGGNLANMLEVLSTNMRENNLLIKKIDA 214

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           L+ +++  +WI+  LP  +  ++   +P   N       G+  L +     + G + M+
Sbjct: 215 LTSQSRMQSWIMTLLPIFLLMVLSVVAPNLTNYFWEHKYGYFALALIVIMEIGGFLTMK 273


>gi|323493930|ref|ZP_08099047.1| putative Flp pilus assembly protein TadB [Vibrio brasiliensis LMG
           20546]
 gi|323311871|gb|EGA65018.1| putative Flp pilus assembly protein TadB [Vibrio brasiliensis LMG
           20546]
          Length = 304

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 92/180 (51%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L +++  KF ++FP+AL+I+  ++ +G  +  A   +  Q  + V +EF+ + E   +G 
Sbjct: 121 LKQRQEEKFKNNFPDALNILSGAISSGQSIVHAFEYVGKQLDNEVGNEFKFMAERLLIGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL+
Sbjct: 181 DPDDVLERSATTFPYLEYFFFASTIRINLSRGGQLKDVINRINRLMFDSRAVEKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ASA II  LP     ++ FTSP   + ++ +P G  +         IG + +  ++
Sbjct: 241 SEARASAKIIACLPVIFLVILKFTSPENYSFVMFEPGGQPIFYYVLISEFIGFVCIWFIL 300


>gi|301165544|emb|CBW25115.1| putative pilus assembly-related protein [Bacteriovorax marinus SJ]
          Length = 296

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 87/179 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L+ +R   +     +AL ++   +RAGL V  A+ ++V +   PV  EF  +++   
Sbjct: 110 INYLVDRRINAYSAQMVDALTLLSNGIRAGLSVPQAIGMVVDEMPAPVSQEFNMILQQNR 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E    + + +P ++   F + I++  + GGNL+E    +  ++R+R  +K K+ 
Sbjct: 170 IGVPLEECFDNLSKRIPTEDNDMFVSSINILRETGGNLAEVFDTIVDVIRERVRLKQKID 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
             + +       I  +P+ +  + + + P  +  +   P G +L   A AF   G  V+
Sbjct: 230 TFTAQGMFQGLTIFLMPYGIGLIYFVSDPESVKPMFTHPLGIILTLAALAFDFAGGFVI 288


>gi|320158387|ref|YP_004190765.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|319933699|gb|ADV88562.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 305

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 90/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G 
Sbjct: 121 LQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL+
Sbjct: 181 DPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  ++
Sbjct: 241 SEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFICIWFIL 300


>gi|73539234|ref|YP_299601.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72122571|gb|AAZ64757.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 312

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 86/175 (49%), Gaps = 6/175 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q  G  
Sbjct: 131 VRRIRQKMLLQLPGFLDGVVRLMTIGSSVPAAFQNSIANTDAPLRQCLVQAVHLQRAGKE 190

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++ +M R   LQE+   ++V+ +  + GG     +   +  +RDR+  + ++ ALS 
Sbjct: 191 LDQAVLQMGRIYHLQELVLLASVLRLSVRYGGRADVMMERTAAFMRDREQAQRELMALSA 250

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML------LGVAAAFML 173
           E + SAWI+G LP  V   ++  + GY+ ++  DP G  +      L +A AFML
Sbjct: 251 ETRLSAWILGLLPLVVGGGLFVLNAGYVLMMWRDPTGKTMLLTALALEIAGAFML 305


>gi|27378606|ref|NP_770135.1| hypothetical protein blr3495 [Bradyrhizobium japonicum USDA 110]
 gi|27351754|dbj|BAC48760.1| blr3495 [Bradyrhizobium japonicum USDA 110]
          Length = 338

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 97/179 (54%), Gaps = 1/179 (0%)

Query: 6   KKRTA-KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++R A +     P+A+ ++  +VR+GLPV +A   +  +   P   +F  V    +LG  
Sbjct: 154 QRRVALQLFRQLPDAIQLVTSTVRSGLPVHEAFRALAREMPQPTAGQFAIVCNEVNLGRP 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++  + R   + E + F+  ++VQ + GG+L+E L NL   +R R  + A+ +AL+ 
Sbjct: 214 PAEAVEGVYRRTQVAEYAMFAVTLAVQLKSGGSLAETLQNLGDTVRQRVALAARAKALAG 273

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           E   S+  +   P     ++Y ++P  +++L  DP G+ LL  A A +L+G +V+  M+
Sbjct: 274 EVIFSSRALTISPLIGGGVLYASNPQTVDLLFTDPVGNKLLAYAVASVLVGALVISWMV 332


>gi|326424176|ref|NP_762075.2| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|319999559|gb|AAO07065.2| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
          Length = 305

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 90/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G 
Sbjct: 121 LQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL+
Sbjct: 181 DPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  ++
Sbjct: 241 SEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFICIWFIL 300


>gi|221070077|ref|ZP_03546182.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220715100|gb|EED70468.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 322

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 84/181 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K  A+     P  LD  VR V  G  V  A  +    + DP++S   +       G+ L
Sbjct: 138 QKFRARLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLARAGMDL 197

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + A++ E
Sbjct: 198 ENAVAHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLSAMTAE 257

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAW++  LP  V  L+   +  Y   + ND  G  ++  AAA  + G++++  M   
Sbjct: 258 IRMSAWVLSLLPVAVCCLIISFNASYFLNMWNDASGRNIIWAAAALQVFGVLLLYRMAKL 317

Query: 186 D 186
           D
Sbjct: 318 D 318


>gi|37676257|ref|NP_936653.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|37200798|dbj|BAC96623.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
          Length = 305

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 90/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G 
Sbjct: 121 LQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL+
Sbjct: 181 DPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  ++
Sbjct: 241 SEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFVCIWFIL 300


>gi|332284567|ref|YP_004416478.1| type II secretion system protein [Pusillimonas sp. T7-7]
 gi|330428520|gb|AEC19854.1| type II secretion system protein [Pusillimonas sp. T7-7]
          Length = 282

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 97/182 (53%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R  +F +  P+ L  +  ++RAG  +  A+  IV QS  P+  EF  ++  Q +G+  
Sbjct: 101 KLRLQRFDEQLPDLLQALAGALRAGAGLQSALKHIVAQSPAPLSQEFGLMLRQQRMGIGF 160

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++++ + R MP +      + +++ +Q GGNL+E L +++  LR R  + ++VQAL+ +
Sbjct: 161 EQALADLYRRMPFEGTGLVVSALTIAAQSGGNLAETLESIAATLRARLRLLSRVQALTSQ 220

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +  AWI+  LP  ++ ++++  P  M  L   P G  ++       ++GI  +R ++  
Sbjct: 221 GRLQAWIMAGLPPVLAIVLHYLDPDSMRALWETPAGWSVVAAIVTMEVLGIWFIRRIVAI 280

Query: 186 DV 187
            +
Sbjct: 281 TI 282


>gi|284048523|ref|YP_003398862.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952744|gb|ADB47547.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 321

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 91/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I +R   F     + L ++  S+RAG      + +I  +   P+ +EF  V+    
Sbjct: 135 LQRRISRRKEAFERQLADCLTLVSNSLRAGFSFLQTMEIISREMQPPMSTEFANVMRNTS 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG ++ +++  M + +  ++ S   T + +Q Q+GGNL+  L  +   + +R  ++ +V 
Sbjct: 195 LGRTMEDALQEMDQRVGNEDFSLVITAVLIQQQVGGNLATILDTIRETISERIRLRREVG 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + K S  ++  +P  +      TSP Y+  L+    G M +G A    +IG +++ 
Sbjct: 255 TLTAQGKFSGLVLTCIPVALGLFFAVTSPEYLKPLLTTSIGKMAIGAAVVMEIIGYLIIS 314

Query: 181 LMINFDV 187
            +++  +
Sbjct: 315 RIVDIKI 321


>gi|283777929|ref|YP_003368684.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283436382|gb|ADB14824.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 318

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 92/171 (53%), Gaps = 3/171 (1%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+A D++ R++RAG  V  A  VI    + P++ EF    E QHLG+    ++  + R 
Sbjct: 150 LPDAFDVMSRALRAGQTVPAAFQVIATDFNSPLKEEFAHCYEQQHLGIERDVALRDLARR 209

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
             + E+  F   + +  + GGNL+E L NL+ +LR R  +  +++AL+ E +  A ++ +
Sbjct: 210 TSVMELQIFVVALIMHGKTGGNLAELLGNLALLLRKRGKLHDRIRALTGEGRMQAVVLIA 269

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           LP  +  ++Y  +  Y  VL++ P   MLL       LIG + +R +I+ +
Sbjct: 270 LPAVIFGVMYVMNREYAQVLLDRP---MLLIGCGISQLIGALCIRKIIDIE 317


>gi|117620900|ref|YP_855995.1| Flp pilus assembly protein TadB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562307|gb|ABK39255.1| Flp pilus assembly protein TadB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 294

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 95/185 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L ++   +F    P  +D ++R++R G P++D   ++  Q    +   F ++ +   +
Sbjct: 109 QQLQQRALEQFRTRLPEVIDGMIRALRVGAPLADIFLLVARQQRGLMSRLFAQMHDELQV 168

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  +++ + +    + + E  F + V+S+Q + GG LSE LA L   LR R+ + A +Q 
Sbjct: 169 GQPVAQVMQQAAGRVAVAEFQFLTIVLSLQQETGGRLSEVLAQLVETLRARQTLAASIQT 228

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ E++ +A ++ +LP  +  +++ T   +   L+    G  +LG  +  + +G+ ++R 
Sbjct: 229 ITAESRNAAKVLAALPVIILLVLFTTGREHFTYLMTTTSGQWVLGYVSISVAVGLWLIRR 288

Query: 182 MINFD 186
           +    
Sbjct: 289 LTRLQ 293


>gi|76663417|emb|CAE47793.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 291

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 96/186 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + + +KR A+F+D   + L I+   ++AG    +++  +V    +P+  EF +V+    +
Sbjct: 106 RMIYEKRCARFVDQMVDGLTIMANGIKAGSNPQESMKRVVEIMGNPMSQEFAQVLYQMQV 165

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S   +++ +   +P  +V  F T I++  + GGNL+E    +  ++R+R+ ++ K+QA
Sbjct: 166 GDSFESALNDLGNRIPRPDVQMFVTSINILKETGGNLAETFQTIVLVVRERQKVEKKIQA 225

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ +      I+  +PF +  +     P ++  + +   G +LL       +IG ++++ 
Sbjct: 226 LTAQGLMQGIIVTLIPFILMVVFSIIDPTFIKPMFSTTLGLVLLVAMLGLQIIGGVLIKK 285

Query: 182 MINFDV 187
           ++   V
Sbjct: 286 LVTIKV 291


>gi|257791503|ref|YP_003182109.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257475400|gb|ACV55720.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 306

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 91/181 (50%), Gaps = 1/181 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE-TQHLGLS 64
           KKR+ +F     +AL +I  ++R G     +++ +     +P+ SE +RVIE   +  +S
Sbjct: 123 KKRSMQFETQLASALPMISENLRGGSSFEMSISAVAQFMPEPIHSELQRVIEDVSNASIS 182

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L ++  R+   +   E    +T + +Q + GGNL+  +  ++  +  R  +K KV++ + 
Sbjct: 183 LPDAFERLAIRIQSSEAHLLATAVMIQKEGGGNLASVVDTIAETIARRIELKNKVRSSTA 242

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            A+ SA  + ++PF V     + SPGYM+     P    ++  AA    IG+ ++  M  
Sbjct: 243 NARFSAVFVAAVPFAVLAFFTYGSPGYMDNFYAWPFWPAVIIAAAVLDGIGLFLISRMYK 302

Query: 185 F 185
           F
Sbjct: 303 F 303


>gi|72162674|ref|YP_290331.1| integral membrane protein [Thermobifida fusca YX]
 gi|71916406|gb|AAZ56308.1| putative integral membrane protein [Thermobifida fusca YX]
          Length = 310

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 93/186 (50%), Gaps = 10/186 (5%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   F    P    ++  + +AGL +  A+ +   + +DP  +E R V E+  +G   
Sbjct: 129 EKRREAFTAQLPELARVLSNATQAGLALPTAIDMAADELADPAGAELRHVAESIKVGQPF 188

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E+++ + + MP +E+    + + V ++ GG L  AL N+S  L +RK  + +V+ +  E
Sbjct: 189 EEALNDLRKRMPSREIGVLISTLLVSARSGGALVTALRNISETLENRKETRREVRTILSE 248

Query: 126 AKASAWI-----IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             ++AW      +GSL F ++ L+    PG +  +     G ++LG A     IG +V+R
Sbjct: 249 TTSTAWTLLLMGVGSL-FLLNALM----PGTVARMTESFAGLVVLGAALTLFTIGFVVIR 303

Query: 181 LMINFD 186
            M   D
Sbjct: 304 RMSRID 309


>gi|149178504|ref|ZP_01857092.1| secretion system protein TadB [Planctomyces maris DSM 8797]
 gi|148842619|gb|EDL56994.1| secretion system protein TadB [Planctomyces maris DSM 8797]
          Length = 310

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 94/181 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR     ++ P  +D++ RS  AG  +  A+A++  ++  P+  EFRR      + LS+
Sbjct: 129 KKRMQTIQEELPEMIDLLARSTHAGASLEQAIAIVGEETKGPLSFEFRRCARQLDMNLSV 188

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
              +  +   + L ++   ++ + +  + GGNL   L  ++ ++RDR N + +++A +  
Sbjct: 189 PAVMKSLSSRIQLIDLKILTSTLMLYRKTGGNLPANLERMADVVRDRINYRRQMKASTGA 248

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +ASA ++  +      ++    P +++ L  DP G++LL +A    +IGI+ +  ++  
Sbjct: 249 GRASALLMTVVAPVAFVVLLVAFPAHVSNLYTDPIGNILLLIAIVLEVIGILWVSTLLRT 308

Query: 186 D 186
           D
Sbjct: 309 D 309


>gi|116694143|ref|YP_728354.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113528642|emb|CAJ94989.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 308

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 87/175 (49%), Gaps = 6/175 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q  G  
Sbjct: 127 VRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQNSIANTEAPLRQCLVQAVHLQRAGKE 186

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++ ++ R   ++E+   ++V+ +  + GG     +   +  +RDR+  + ++ ALS 
Sbjct: 187 LDQAVLQVGRVYKVEELVLVASVLRLSVRYGGRADVVMERTAAFMRDREQAQRELMALSA 246

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML------LGVAAAFML 173
           E + SAWI+G LP  V+  ++  + GY+ ++  DP G  +      L +A AFML
Sbjct: 247 ETRLSAWILGLLPLVVAGGLFMLNAGYILMMWKDPTGKTMLLSALALEIAGAFML 301


>gi|330873866|gb|EGH08015.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 198

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 87/176 (49%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  + +      LD  VRS+++G  ++DAV   +  +  P++    R+     LG+SL +
Sbjct: 20  RVRRMIQQLAQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQLGVSLPD 79

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +           E   F+  + V  + GGN SE + NL +++RDR+    +++A++ E +
Sbjct: 80  AARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLRAMTGETR 139

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+  M+
Sbjct: 140 MTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLWRML 195


>gi|310822672|ref|YP_003955030.1| type II secretion system protein f domain-containing protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395744|gb|ADO73203.1| type II secretion system protein F domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 281

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 99/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K+  K+R  KF     +AL  +  + +AGL    A+  +  ++  P+  EF   ++   L
Sbjct: 96  KYYRKRRIKKFNVQLVDALQAMANAFKAGLTFPQAIEHVAREALPPLSQEFGLFVKEVKL 155

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L E++  M + +   ++       ++  QLGGN++E    +S ++R+R  ++ K+ A
Sbjct: 156 GVPLEEALINMGKRVGSDDLELVVVSTNIARQLGGNMAEMFETISMVIRERFRLEGKIDA 215

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K   WI+ S+P  +  ++    P  M  +++   G++L+ V A   ++GI+++R 
Sbjct: 216 LTSQGKLQGWIVASMPAVLGMVLNSMRPDLMEPMMDHMFGYVLVTVIAIMEILGILIIRR 275

Query: 182 MINFDV 187
           ++N D+
Sbjct: 276 IVNIDI 281


>gi|152986618|ref|YP_001350204.1| hypothetical protein PSPA7_4868 [Pseudomonas aeruginosa PA7]
 gi|150961776|gb|ABR83801.1| hypothetical protein PSPA7_4868 [Pseudomonas aeruginosa PA7]
          Length = 293

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 82/156 (52%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD +VRS+ AG  + DA+   V  + DP+R  F        LG+ L
Sbjct: 113 RRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVEDAEDPLRDIFGLARNHVLLGIHL 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  +     ++E+   +  +SV  + GGN ++ L  + R++ +R+ +  ++ A++ E
Sbjct: 173 PEALQEVAELYEVEELRILALGVSVNHRYGGNTTDLLDGIVRLIHEREKLSRQLHAMTGE 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            + SA+++  +P  +   +  ++PGY+  +  D  G
Sbjct: 233 TRISAYVLAGVPSALGGYILASNPGYLLNMWADGSG 268


>gi|49085940|gb|AAT51316.1| PA4301 [synthetic construct]
          Length = 295

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 84/158 (53%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        LG+
Sbjct: 112 LYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVLLGI 171

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ A++
Sbjct: 172 HLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLHAMT 231

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            E + SA+++  +P  +   +  ++PGY+  +  D  G
Sbjct: 232 GETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTG 269


>gi|15599497|ref|NP_252991.1| TadB [Pseudomonas aeruginosa PAO1]
 gi|107100115|ref|ZP_01364033.1| hypothetical protein PaerPA_01001136 [Pseudomonas aeruginosa PACS2]
 gi|218893393|ref|YP_002442262.1| TadB [Pseudomonas aeruginosa LESB58]
 gi|254244888|ref|ZP_04938210.1| hypothetical protein PA2G_05761 [Pseudomonas aeruginosa 2192]
 gi|9950523|gb|AAG07689.1|AE004846_6 TadB [Pseudomonas aeruginosa PAO1]
 gi|126198266|gb|EAZ62329.1| hypothetical protein PA2G_05761 [Pseudomonas aeruginosa 2192]
 gi|218773621|emb|CAW29435.1| TadB [Pseudomonas aeruginosa LESB58]
          Length = 294

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 84/158 (53%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        LG+
Sbjct: 112 LYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVLLGI 171

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ A++
Sbjct: 172 HLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLHAMT 231

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            E + SA+++  +P  +   +  ++PGY+  +  D  G
Sbjct: 232 GETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTG 269


>gi|116052335|ref|YP_792646.1| hypothetical protein PA14_55880 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254239029|ref|ZP_04932352.1| hypothetical protein PACG_05206 [Pseudomonas aeruginosa C3719]
 gi|296391000|ref|ZP_06880475.1| hypothetical protein PaerPAb_22729 [Pseudomonas aeruginosa PAb1]
 gi|313106820|ref|ZP_07793032.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
 gi|115587556|gb|ABJ13571.1| putative pilus assembly protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170960|gb|EAZ56471.1| hypothetical protein PACG_05206 [Pseudomonas aeruginosa C3719]
 gi|310879534|gb|EFQ38128.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
          Length = 294

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 84/158 (53%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        LG+
Sbjct: 112 LYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVLLGI 171

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ A++
Sbjct: 172 HLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLHAMT 231

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            E + SA+++  +P  +   +  ++PGY+  +  D  G
Sbjct: 232 GETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTG 269


>gi|299532822|ref|ZP_07046209.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719046|gb|EFI60016.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 327

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 82/181 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K   +     P  LD  VR V  G  V  A  +    + DP++S   +       G+ L
Sbjct: 143 QKYRTRLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLARAGMDL 202

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + A++ E
Sbjct: 203 ENAVTHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLSAMTAE 262

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            + SAW++  LP  V  L+   +  Y   + ND  G  ++  A A  + G++++  M   
Sbjct: 263 TRLSAWVLSLLPVAVGCLIISFNASYFLNMWNDASGRNIIWAAVALQVFGVLLLYRMAKL 322

Query: 186 D 186
           D
Sbjct: 323 D 323


>gi|260914308|ref|ZP_05920777.1| Flp pilus assembly protein TadB [Pasteurella dagmatis ATCC 43325]
 gi|260631409|gb|EEX49591.1| Flp pilus assembly protein TadB [Pasteurella dagmatis ATCC 43325]
          Length = 294

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 83/172 (48%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  D  ++  +R+   +       +S SR
Sbjct: 123 FPEVIQILTAAASSGAGLLQALERCGKDLTGQLGDEFKNIHKRLAIGEDPVTVFEDSYSR 182

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T+I      GG + E ++ L RI+ D K M+ K +A++ EA+ SA 
Sbjct: 183 Y----PYKEFYFFITIIRTNLSKGGQIREVISRLGRIIADAKKMEQKKKAMTSEARMSAM 238

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+ S P      + FT P   + LINDP G  +L       LIG++++  ++
Sbjct: 239 IVASFPIAFFFFMQFTMPENFDFLINDPSGRYVLYYVFGSELIGMLIIWWLM 290


>gi|86144314|ref|ZP_01062646.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
 gi|85837213|gb|EAQ55325.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
          Length = 304

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 91/181 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L  ++  +F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +G
Sbjct: 120 NLKARQVERFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNEVGKEFKFMAERLLIG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL
Sbjct: 180 EDPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA II  LP     ++ FTSP   + ++ +  G  +     A  L+G   + L+
Sbjct: 240 TSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLASELVGFFCIWLI 299

Query: 183 I 183
           +
Sbjct: 300 L 300


>gi|258515695|ref|YP_003191917.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779400|gb|ACV63294.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 306

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 88/175 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +I KR           L I   S+R+G+ ++ A+A  +G+ +  +  E +R+     
Sbjct: 119 LNAMISKRGELLAKQLHGCLIIWANSLRSGVSLAQAIAGSIGRVAPQINEELKRIKYDID 178

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S ++++ + +  +P+ E         +  QLGGNL+E   N+   + +R   +  ++
Sbjct: 179 LGFSSADALEKALVRIPVAEFKMVVMTAKIHRQLGGNLAERFDNICLTIEERIATRDVLK 238

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           A + +AK  A + G +PF V  ++   SP Y+  +++ P G M+L ++   + +G
Sbjct: 239 AHTTQAKLGAVVAGLMPFIVLIILKTMSPDYLKPMLDSPYGTMMLMLSVFLVFLG 293


>gi|209809174|ref|YP_002264712.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
 gi|208010736|emb|CAQ81127.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
          Length = 303

 Score = 77.4 bits (189), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 91/182 (50%), Gaps = 2/182 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L K+   +F D FP+AL+++  +V +G  +  A+ + VG S D  V  EF+R+ E   LG
Sbjct: 119 LGKREKNRFEDSFPDALNMLSSAVSSGEGIMHAI-IFVGASLDGKVGKEFKRMGEQLQLG 177

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    + GG L E +  L+R++   ++++ K  AL
Sbjct: 178 ESPDTVFRKSCARFPYPSFQFFIITLRTSMERGGQLKEIMRRLNRLMFGARSIEKKKYAL 237

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ S+PF    ++ + SP     ++ +P G  +L        IGI+ + L+
Sbjct: 238 TSEARTSAKIVASIPFIFLFMLQYLSPENYEYVMFNPDGRPILYYVLISESIGILTIWLL 297

Query: 183 IN 184
           + 
Sbjct: 298 MK 299


>gi|323495641|ref|ZP_08100712.1| flp pilus assembly protein tadb [Vibrio sinaloensis DSM 21326]
 gi|323319276|gb|EGA72216.1| flp pilus assembly protein tadb [Vibrio sinaloensis DSM 21326]
          Length = 306

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 83/165 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M  L +++  +F   FP+AL+++  +V +G  +  ++  +       V  EF+R+ E   
Sbjct: 120 MSWLEQRQQKEFEMAFPDALNMLASAVSSGESLMHSIMFVGKTLEGSVGEEFKRMGERLQ 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S      +     P +   FF   +    Q GG L + +  L+R++ D + ++ K  
Sbjct: 180 LGESPDSVFKKSCNRFPYRSFQFFVITLRANMQRGGQLKDVITRLNRLMFDARAIEKKKY 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
           AL+ EA+ SA I+ ++PF    ++ + SP   + ++N P+G  +L
Sbjct: 240 ALTSEARTSAKIVAAIPFFFLFILQYLSPENYDFVMNHPKGQPIL 284


>gi|28900580|ref|NP_800235.1| putative TadB protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808960|dbj|BAC62068.1| putative TadB [Vibrio parahaemolyticus RIMD 2210633]
          Length = 289

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 6/178 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +  +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    +
Sbjct: 110 QAQRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGEEFKKMSERLLIGEDPDD 169

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+
Sbjct: 170 VLARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEAR 229

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-----HMLLGVAAAFMLIGIMVMR 180
           ASA II +LP     ++  TSP   N ++ +  G     ++L+  A  F  I  M++R
Sbjct: 230 ASAKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFI-YMILR 286


>gi|84385700|ref|ZP_00988731.1| putative TadB [Vibrio splendidus 12B01]
 gi|84379680|gb|EAP96532.1| putative TadB [Vibrio splendidus 12B01]
          Length = 304

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 91/178 (51%), Gaps = 6/178 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    +
Sbjct: 125 REKKFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGKEFKKMSERLLIGEDPDD 184

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF++ I +    GG L   +  ++RI+ + + ++ K  AL+ EA+
Sbjct: 185 VLARSASTFPYVEYFFFASTIRINLSRGGQLKNVINRINRIMFEARAIEKKKNALTSEAR 244

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-----HMLLGVAAAFMLIGIMVMR 180
           +SA II +LP     ++  TSP     ++ +  G     ++L+     F LI  M++R
Sbjct: 245 SSAKIIAALPVIFMCILKLTSPENYQFVMFEEGGKPIFYYVLISELIGFFLIS-MILR 301


>gi|153836331|ref|ZP_01988998.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|149750233|gb|EDM60978.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|328470522|gb|EGF41433.1| putative TadB protein [Vibrio parahaemolyticus 10329]
          Length = 304

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 6/178 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +  +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    +
Sbjct: 125 QAQRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLENEVGEEFKKMSERLLIGEDPDD 184

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+
Sbjct: 185 VLARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEAR 244

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-----HMLLGVAAAFMLIGIMVMR 180
           ASA II +LP     ++  TSP   N ++ +  G     ++L+  A  F  I  M++R
Sbjct: 245 ASAKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFI-YMILR 301


>gi|260365460|ref|ZP_05777997.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
 gi|260877525|ref|ZP_05889880.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|260897534|ref|ZP_05906030.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|260901736|ref|ZP_05910131.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308087149|gb|EFO36844.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|308090878|gb|EFO40573.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|308108899|gb|EFO46439.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308114317|gb|EFO51857.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
          Length = 304

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 6/178 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           +  +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    +
Sbjct: 125 QAQRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGEEFKKMSERLLIGEDPDD 184

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+
Sbjct: 185 VLARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEAR 244

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG-----HMLLGVAAAFMLIGIMVMR 180
           ASA II +LP     ++  TSP   N ++ +  G     ++L+  A  F  I  M++R
Sbjct: 245 ASAKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFI-YMILR 301


>gi|255020084|ref|ZP_05292155.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970446|gb|EET27937.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 284

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 89/185 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L K+R  +  D  P+ L ++  ++R G  +   +  +    S P+  E   V+  Q LG
Sbjct: 100 YLKKRRFLRLHDQLPDTLLMMASALRGGANLGQTLEGLAKDMSPPMNQELSLVVREQRLG 159

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +   E++S +   +  Q+     + + +  ++GGNL++ L  L   +R R  M+ K++AL
Sbjct: 160 VPFEEAVSHLAERVRSQDFDLVVSALRINREVGGNLADTLQRLGETVRRRLMMEQKIRAL 219

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + K    ++ +LP  +   +    P     L +  RG  +L +A    ++G   +R +
Sbjct: 220 TSQGKLQGIVMTALPVLIILALLRIEPAATGALFDTYRGWAVLAIAIVLEILGYWGIRKI 279

Query: 183 INFDV 187
           ++ +V
Sbjct: 280 VSIEV 284


>gi|218708111|ref|YP_002415732.1| putative bacterial type II secretion system protein F [Vibrio
           splendidus LGP32]
 gi|218321130|emb|CAV17080.1| putative bacterial type II secretion system,protein F, TadB [Vibrio
           splendidus LGP32]
          Length = 306

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 88/177 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL K+   +F + FP+AL+++  S+ AG  +   +  +  +    V  EF+ + E  +LG
Sbjct: 122 HLQKREKKRFEETFPDALNMLASSLSAGESIGRGIGYVGKKLEGEVGKEFKLMSERLNLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             + +   +  R  P     FF   +    Q GG L E ++ L+R + + + ++ K  AL
Sbjct: 182 EPIDDVFRKSCRRFPYPSFHFFVITLRANMQRGGQLKEVMSRLNRQMFEARAVERKKFAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + EA+ SA I+G+ PF    ++ F SP     +++ P G  +L        IG++++
Sbjct: 242 TSEARISAKIVGATPFFFLFILQFLSPENFEFVMHHPEGRPILYYLITSESIGMLII 298


>gi|190574782|ref|YP_001972627.1| putative type II secretion/pilus assembly transmembrane protein
           [Stenotrophomonas maltophilia K279a]
 gi|190012704|emb|CAQ46332.1| putative type II secretion/pilus assembly transmembrane protein
           [Stenotrophomonas maltophilia K279a]
          Length = 313

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 1/179 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M+   K R A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +    
Sbjct: 129 MRRTTKLR-AQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYAR 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  ++S   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ 
Sbjct: 188 SGMDLDRALSLAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELA 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           A + E + SAW++G LP   + L+  +SP +   +++DP GH +L +A    L G  ++
Sbjct: 248 ATTSETRMSAWVLGLLPPASAVLMAISSPEFFQPVLHDPLGHKILLIALGLELFGAFLL 306


>gi|86147188|ref|ZP_01065504.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio sp. MED222]
 gi|85835072|gb|EAQ53214.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio sp. MED222]
          Length = 306

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 88/177 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL K+   +F + FP+AL+++  S+ AG  +   +  +  +    V  EF+ + E  +LG
Sbjct: 122 HLQKREKKRFEETFPDALNMLASSLSAGESIGRGIGYVGKKLEGEVGKEFKLMSERLNLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             + +   +  R  P     FF   +    Q GG L E ++ L+R + + + ++ K  AL
Sbjct: 182 EPIDDVFRKSCRRFPYPSFHFFVITLRANMQRGGQLKEVMSRLNRQMFEARAVERKKFAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + EA+ SA I+G+ PF    ++ F SP     +++ P G  +L        IG++++
Sbjct: 242 TSEARISAKIVGATPFFFLFILQFLSPENFEFVMHHPEGRPILYYLITSESIGMLII 298


>gi|329935279|ref|ZP_08285245.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
 gi|329305102|gb|EGG48961.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
          Length = 315

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 93/182 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +  +LG ++
Sbjct: 134 QKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLNLGRTV 193

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG++  +L NL++ L DRK  + +V+ +  E
Sbjct: 194 DDALGELAERLPSRELIVLVTTLVLSNKAGGSVVSSLRNLTQTLEDRKETRREVRTMLSE 253

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             A+A+ +  L      LV  ++ G +  +   P G  L+ ++ A   +G +V+R +   
Sbjct: 254 VNATAFTVPMLGLGSLVLVNSSNEGALERVTGSPLGQALVLISLALYTVGFLVIRRLGRI 313

Query: 186 DV 187
           +V
Sbjct: 314 EV 315


>gi|330830428|ref|YP_004393380.1| Flp pilus assembly protein TadB [Aeromonas veronii B565]
 gi|328805564|gb|AEB50763.1| Flp pilus assembly protein TadB [Aeromonas veronii B565]
          Length = 294

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 91/174 (52%), Gaps = 8/174 (4%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +F    P  +D ++R++R G P++D    I  Q +   R    R+    H  L + + ++
Sbjct: 118 QFRTGLPEVIDGMIRALRVGAPLAD----IFQQVARQQRGLMSRLFAQMHDELQVGQPVA 173

Query: 71  RMVRY----MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++R     + + E  F + V+S+Q + GG LS+ LA L   LR R+ + A +Q ++ E+
Sbjct: 174 QVMRQAANRVTVAEFQFLTIVLSLQQETGGRLSDVLAQLVETLRARQTLAASIQTITAES 233

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           + SA ++ +LP  +  +++ T   +   L+    G  ++G  +  + +G+ ++R
Sbjct: 234 RNSAKVLAALPVIILLVLFSTGREHFTYLMTTASGQWVMGYVSISVAVGLWLIR 287


>gi|194366100|ref|YP_002028710.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348904|gb|ACF52027.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 318

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (47%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           K  A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +     G+ L 
Sbjct: 139 KLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYARSGMDLD 198

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            +++   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ A + E 
Sbjct: 199 RALALAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELAATTSET 258

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + SAW++G LP   + L+  +SP +   +++DP GH +L +A    L G  ++
Sbjct: 259 RMSAWVLGLLPPACAVLMAISSPEFFQPVLHDPLGHKILLIALGLELFGAFLL 311


>gi|148974881|ref|ZP_01811861.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
 gi|145965390|gb|EDK30639.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
          Length = 304

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 91/180 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L +++  +F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +G 
Sbjct: 121 LKQRQMDRFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNEVGKEFKFMAERLLIGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +  + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL+
Sbjct: 181 APDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ASA II  LP     ++ FTSP   + ++ +  G  +        L+G   + L++
Sbjct: 241 SEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLVSELLGFFCIWLIL 300


>gi|237653360|ref|YP_002889674.1| type II secretion system protein [Thauera sp. MZ1T]
 gi|237624607|gb|ACR01297.1| type II secretion system protein [Thauera sp. MZ1T]
          Length = 289

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 97/185 (52%), Gaps = 1/185 (0%)

Query: 4   LIKKRTAKFLDD-FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L+++R    ++   P+AL +I   +RAG+ ++ A+  +V +   P+  EF   +    LG
Sbjct: 105 LLRQRRLDLIEQQLPDALQVIAGGLRAGVSMTVALQQLVREGRPPIAQEFDLTLREHRLG 164

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E++  +   + +  ++     + + ++ GG+L+EAL   +  +R +  M+ K+ AL
Sbjct: 165 IPLDEALDHLAARVRMPSLTLVIAAMRIANETGGSLAEALERAALTVRSQLAMEGKIGAL 224

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + K  A ++G LP  +  ++    P  M  L + P G   L V A   ++G++++R +
Sbjct: 225 TAQGKLQAVVVGMLPLALLLVLDRMEPEAMGFLWHSPPGWATLAVIATLEVLGVLLIRRI 284

Query: 183 INFDV 187
           +  DV
Sbjct: 285 VAIDV 289


>gi|239817415|ref|YP_002946325.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239803992|gb|ACS21059.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 241

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 82/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K   + +   P  +D +VR +  G     A  + +  +  P+R    R       G+ 
Sbjct: 60  LQKVRRQLISQLPAYIDAMVRLITIGNSTQAAFQLAIATTQAPLRGHMERSAALVRAGVD 119

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  ++ +    + ++E+   ++++ +  + GG     L  ++  +RDR+  + ++ A+S 
Sbjct: 120 LDRALHQTANNVRVEEMFLLASILGLGVRYGGRSDLLLERVANFMRDREQAEHELVAMSA 179

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAWI+G LP  V T +   +P Y   + ND  G ML+  +A   L+G
Sbjct: 180 ETRLSAWILGLLPLGVGTFLVVVNPDYFLSMWNDDTGRMLIFSSAGLQLLG 230


>gi|154250529|ref|YP_001411353.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154479|gb|ABS61696.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 291

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 93/185 (50%), Gaps = 12/185 (6%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG---QSSDPVRSEF-----RRV 55
           +I  R  K ++   +A+      VR  L V ++++V +    QSS P+  EF     RR+
Sbjct: 104 IIDYRARKRMNALSDAMLGYFDRVRQLLVVGNSLSVALARATQSSPPIVIEFFSPTIRRI 163

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G  ++ES++++     L E+  F T I    + GG+L+  L+NL   +R R  +
Sbjct: 164 AN----GAGVAESVNQLADETDLYELRLFGTAIETNLRFGGSLTSILSNLIDNIRRRAAV 219

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
             +V+  + + +ASAW++G LP  V+++V   S  YM   I +P G  LL   A   + G
Sbjct: 220 MREVRGSTSQIRASAWVLGLLPMIVASVVMVQSTDYMRWFIEEPAGRKLLIYCALSQIFG 279

Query: 176 IMVMR 180
             +MR
Sbjct: 280 AFMMR 284


>gi|269105135|ref|ZP_06157829.1| flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|312621085|ref|YP_003993813.1| flp pilus assembly protein tadb [Photobacterium damselae subsp.
           damselae]
 gi|268160585|gb|EEZ39084.1| flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|311872806|emb|CBX86897.1| Flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae]
          Length = 306

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L K+   KF + FP+AL+I+  ++ +G  +  A+ V VG++ D  V +EF  + E   LG
Sbjct: 123 LQKRERKKFEESFPDALNILTSAISSGESIIHAI-VFVGKTLDGAVGNEFSLMGERLQLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +      GG L + ++ L+RI+ D + ++ K  AL
Sbjct: 182 ESPDNVFRKSCMRFPYPSFQFFVITLRANMHRGGQLKDVMSRLNRIMFDARAIEKKKYAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ ++PF    ++ + SP     ++ +P G  +L        IGI ++ L+
Sbjct: 242 TSEARISAKIVAAIPFIFLFMLQYLSPENYEFVMFNPGGRPILYYVIISESIGITIVWLL 301

Query: 183 I 183
           +
Sbjct: 302 M 302


>gi|254506141|ref|ZP_05118285.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
 gi|219550959|gb|EED27940.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
          Length = 306

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 85/160 (53%), Gaps = 2/160 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSL 65
           ++  +F   FP+AL+++  +V +G  +  ++ + VG+S +  V  EF+R+ E   +G S 
Sbjct: 126 RQQKEFEMAFPDALNMLASAVSSGESLMHSI-IFVGKSLEGSVGEEFKRMGERLQMGESP 184

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                +     P +   FF   +    Q GG L + +  L+R++ D + ++ K  AL+ E
Sbjct: 185 DTVFRKSCNRFPYRSFQFFVITLRANMQRGGQLKDVITRLNRLMFDARAIEKKKYALTSE 244

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
           A+ SA I+ ++PF    ++ + SP   + ++N P+G  +L
Sbjct: 245 ARTSAKIVAAIPFFFLFMLQYLSPENYDFVMNHPKGQPIL 284


>gi|304311187|ref|YP_003810785.1| type II secretion system protein F [gamma proteobacterium HdN1]
 gi|301796920|emb|CBL45133.1| type II secretion system protein F [gamma proteobacterium HdN1]
          Length = 295

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 93/182 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R+ KF+   P+AL  +  ++++GL +  ++  +V    +P+  EF +V+    +G  L
Sbjct: 114 KNRSDKFVKQMPDALAAMSTALKSGLNLVKSLQQVVRNQPEPLAQEFAQVLVEYRIGTDL 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++S   + + +   EV   ++ I +   +GGNL+    NL+  LR+   ++ K++A++  
Sbjct: 174 NDSFGDLAKRIDRPEVVLMNSAIRINRSVGGNLAATFENLADSLRETSKVEGKIKAMTAM 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             +   +  ++P  V+ + +      M +L +   G + LG+      +G+  ++ ++N 
Sbjct: 234 GSSQGKLALAVPIVVALVFFQQERAAMEMLFHTKLGWIWLGMMVFSAFLGMTFIKKIVNV 293

Query: 186 DV 187
           DV
Sbjct: 294 DV 295


>gi|254524987|ref|ZP_05137042.1| Flp pilus assembly protein TadB [Stenotrophomonas sp. SKA14]
 gi|219722578|gb|EED41103.1| Flp pilus assembly protein TadB [Stenotrophomonas sp. SKA14]
          Length = 318

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 86/179 (48%), Gaps = 4/179 (2%)

Query: 5   IKKRT----AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           I +RT    A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +    
Sbjct: 133 IMRRTTRLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYAR 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  ++S   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ 
Sbjct: 193 SGMDLDRALSLAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELA 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           A + E + SAW++G LP   + L+   SP +   ++++P GH +L +A    L+G  ++
Sbjct: 253 ATTSETRMSAWVLGLLPPASAVLMAIASPDFFQPVLHEPLGHKVLLIALGLELVGAFLL 311


>gi|262275465|ref|ZP_06053275.1| flp pilus assembly protein TadB [Grimontia hollisae CIP 101886]
 gi|262220710|gb|EEY72025.1| flp pilus assembly protein TadB [Grimontia hollisae CIP 101886]
          Length = 308

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 82/155 (52%), Gaps = 1/155 (0%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F  +FP+AL+++  SV AG  +  A+  +     + V  EF+R+ E  ++G S      +
Sbjct: 132 FERNFPDALNMVASSVTAGESLLHAIQYVGSHLDNIVGREFKRMGERLNIGESTDAVFRK 191

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
             +  P     FF   + V    GG L   +  L+R+L + ++++ K +A++ EA+ S++
Sbjct: 192 ACQRFPTPAFQFFVIAMRVNVNRGGQLRHVIGRLNRVLFNARSIEMKKRAMTAEARMSSY 251

Query: 132 IIGSLPFC-VSTLVYFTSPGYMNVLINDPRGHMLL 165
           I+ ++PF  +  ++   SP   + ++NDP G  LL
Sbjct: 252 IVCAIPFIFLFGVLRVLSPENYDFVMNDPGGRYLL 286


>gi|260892677|ref|YP_003238774.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260864818|gb|ACX51924.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 283

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 84/159 (52%), Gaps = 1/159 (0%)

Query: 21  DIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQE 80
            ++  ++RAG  V  AV   V  +  P++ E   ++    LG SL E++    R  P  E
Sbjct: 115 GVMATALRAGQDVMSAVEGSVKYARPPLKRELEELVAEVKLGRSLGEAVENFARKWPSPE 174

Query: 81  VSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFC 139
               +  +++  ++GG  + +AL +++  +R+R  +K +V+A +   + SA ++G++P  
Sbjct: 175 TRLLAYAVTLAQRMGGQAVPKALLSVTSSVRERLELKHQVRAKTTYQRVSAVVVGAVPLW 234

Query: 140 VSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
              +++F +PG++  L+  P G     V  A +++G ++
Sbjct: 235 CLGVMWFLNPGFLGSLLETPGGRACFTVGVALLVVGWLL 273


>gi|87310970|ref|ZP_01093095.1| hypothetical protein DSM3645_15370 [Blastopirellula marina DSM
           3645]
 gi|87286260|gb|EAQ78169.1| hypothetical protein DSM3645_15370 [Blastopirellula marina DSM
           3645]
          Length = 317

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 95/184 (51%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +RT       P A   I R++RAG  +  A+ ++      P+  EF    E QHLG
Sbjct: 136 HRRLQRTEMLTQQLPEAFSAISRALRAGQGLPTAIQMVANDFPKPLSEEFTHYYEQQHLG 195

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++   ++  MVR + + E+  F+  + VQ + GGNL+E L  L+ ++R R  ++ +V+AL
Sbjct: 196 VANEVALRDMVRRVDVMELRIFAVALIVQQRAGGNLAELLKKLADLIRKRVKLRRRVKAL 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +  A ++ ++P  V   +   +P Y +VL       +L+G A +   IG  ++  +
Sbjct: 256 TGEGRMQAVVLIAMPVLVLAALAVVAPDYSSVLWE--HYEILIGCAIS-QCIGAFLISRI 312

Query: 183 INFD 186
           +N D
Sbjct: 313 VNID 316


>gi|319795782|ref|YP_004157422.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598245|gb|ADU39311.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 330

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++K   + +   P  +D +VR +  G     A  + +     P+R    R       G+ 
Sbjct: 149 LQKFRRQLVSQLPAYIDSMVRLITIGNSTQAAFQLAIANCEPPLRGYLDRAASLVRAGVD 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  ++ +    + ++E+   ++++ +  + GG     L  ++  +RDR+  + ++ A+S 
Sbjct: 209 LDRALHQTAVSVRIEEMYLLASILGLGVRYGGRADLLLERVANFMRDREQAEHELVAMSS 268

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAWI+G LP  V T +  ++P Y   L ND  G ML+  A    L+G
Sbjct: 269 ETRLSAWILGLLPVGVCTFLMISNPSYFMGLWNDGTGRMLIFSAVGLQLLG 319


>gi|294146461|ref|YP_003559127.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292676878|dbj|BAI98395.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 297

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 88/175 (50%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R    ++  P  +D + +    G  ++ A+   +  +   VRS    V     LG  +
Sbjct: 116 QRRVEALIEALPYYIDAVRQMQAVGNSLAQALDRALADAPAVVRSYIAPVARRLELGAPV 175

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++++  +   + + E+S  +  I    + GG++S  L NL+ ILR+R  +K +++A   E
Sbjct: 176 ADAMQVLAERLRVPEISMLAAAIRTNMRYGGSISAVLLNLANILRERIRIKRELKAAISE 235

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AK S  ++  +P     ++   +P Y++  + DPRGH L  VA     +G++VMR
Sbjct: 236 AKISGRVLIVMPLVAMAVLVAMNPDYIDFFLRDPRGHRLAVVALVLQGMGMLVMR 290


>gi|218676253|ref|YP_002395072.1| putative Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
 gi|218324521|emb|CAV25998.1| putative Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
          Length = 304

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 89/180 (49%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L +++   F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +G 
Sbjct: 121 LKQRQMNSFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNDVGKEFKLMAERLLIGE 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL+
Sbjct: 181 DPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNALT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ASA II  LP     ++ FTSP   + ++ +  G  +        L+G   + L++
Sbjct: 241 SEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLVSELLGFFCIWLIL 300


>gi|221197784|ref|ZP_03570830.1| type II secretion system protein [Burkholderia multivorans CGD2M]
 gi|221204658|ref|ZP_03577675.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221175515|gb|EEE07945.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221181716|gb|EEE14117.1| type II secretion system protein [Burkholderia multivorans CGD2M]
          Length = 337

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 156 IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLRGGVE 215

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 216 IDRAMLHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSA 275

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  +++ V  T+P Y++ + NDP G MLL +A    L G
Sbjct: 276 ETRLSAFVLVMLPIAIASFVIMTNPQYLHGMWNDPSGQMLLVIAFLLQLFG 326


>gi|220913385|ref|YP_002488694.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860263|gb|ACL40605.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 316

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 77/155 (49%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   F    P+ L +    +RAG  +  A+     ++  P+  E  R++    
Sbjct: 130 LNMLTARRRKTFDAQVPDTLQMFSGGLRAGHSLLRAIDAAAQENQGPMAEELSRIVNETR 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L ES++ + R    ++  + S  I +  ++GG+L+E L ++   +RDR  +K +V+
Sbjct: 190 IGRDLGESMADVSRRTASEDFYWISQAIEIHREVGGDLAEVLDHVGETIRDRNQVKGQVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           ALS E + SA ++ +LP  +   +   +P Y  V 
Sbjct: 250 ALSAEGRISAMVLMALPILMFIGLVTFNPTYARVF 284


>gi|221213136|ref|ZP_03586112.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221167349|gb|EED99819.1| type II secretion system protein [Burkholderia multivorans CGD1]
          Length = 337

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 156 IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLRGGVE 215

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 216 IDRAMLHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSA 275

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  +++ V  T+P Y++ + NDP G MLL +A    L G
Sbjct: 276 ETRLSAFVLVMLPIAIASFVIMTNPQYLHGMWNDPSGQMLLVIAFLLQLFG 326


>gi|119962927|ref|YP_948622.1| type II secretion system protein F [Arthrobacter aurescens TC1]
 gi|119949786|gb|ABM08697.1| putative bacterial type II secretion system protein F domain
           [Arthrobacter aurescens TC1]
          Length = 316

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 85/161 (52%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           +  +R A+F     + L ++  S+RAG  +  AV  +  ++  P + EF R++    LG 
Sbjct: 133 MTSRRRAQFEAQLGDTLQMLSGSMRAGHSLLRAVDAVALEAQSPTKEEFARIVGEVRLGR 192

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L +++      +  ++  + +  I +  ++GG+L+E L +++  +R+R  +K +V+ALS
Sbjct: 193 DLRDALLDAANRLHSEDFLWATQAIEIHREVGGDLAEVLDHVAETIRERSQIKGQVRALS 252

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML 164
            E + SA+++ +LP  +   +   +  Y+  L   P G ++
Sbjct: 253 AEGRLSAYVLIALPTGMFLYLSLANGTYIQPLFTHPVGWIM 293


>gi|307295328|ref|ZP_07575167.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306878831|gb|EFN10050.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 297

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 69/121 (57%)

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
            LG  +++++  +   + + E+S  +  I    + GG++S  L NL+ ILR+R  +K ++
Sbjct: 170 ELGAPVADAMQMLAERLRVPEISMLAAAIRTNMRYGGSISAVLLNLANILRERIRIKREL 229

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A   EA+ S  ++  +P     L+   +PGY++  + DPRGH L  VA A   +G++VM
Sbjct: 230 KAAISEARISGRVLIVMPLAAMALLVAMNPGYVDFFLRDPRGHRLALVAMALQGMGMLVM 289

Query: 180 R 180
           R
Sbjct: 290 R 290


>gi|283778865|ref|YP_003369620.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437318|gb|ADB15760.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 300

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 93/182 (51%), Gaps = 6/182 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R        P AL  +  +VR+G  +S+A  ++  +   P+  EF    +   LG +   
Sbjct: 121 RVGTMQKQMPQALQAVADAVRSGQTLSEACQLVSKEIKGPLGQEFAYAHQQLELGHAPVS 180

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++RM   +PL E   F+T + V  + GGNLS     +S   RDR++++  + A++  ++
Sbjct: 181 VMNRMATRVPLTEFRVFATAVVVHRRAGGNLSLLTERMSHSARDRQDVRNHLMAVTSGSR 240

Query: 128 ASAW--IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRLM-I 183
            SA+  ++G +   V+ L +   P Y+   + +P+G  LL +A    ++G I V R++ +
Sbjct: 241 LSAFGMVLGGI-IAVAFLTWL-EPDYVRAFLENPKGPWLLFIAFMLQVVGAIWVWRILKV 298

Query: 184 NF 185
           N+
Sbjct: 299 NY 300


>gi|33601082|ref|NP_888642.1| hypothetical protein BB2099 [Bordetella bronchiseptica RB50]
 gi|33575517|emb|CAE32595.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 281

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 92/176 (52%), Gaps = 10/176 (5%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R +
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRV 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI-----GIMVMRLMINFDV 187
           P  +  ++    P  M  L      H L G AA  +++     GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALW-----HTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|86360425|ref|YP_472313.1| hypothetical protein RHE_PE00149 [Rhizobium etli CFN 42]
 gi|86284527|gb|ABC93586.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 321

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 135 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAVAVNAVADTGQMPASREFERIAREQK 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 195 LGIGLVEALDRHGRTVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIS 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 255 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 314

Query: 181 LMINFDV 187
            M+   V
Sbjct: 315 SMMKVSV 321


>gi|284048519|ref|YP_003398858.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952740|gb|ADB47543.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 309

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 77/145 (53%), Gaps = 4/145 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H+I+ R  K +   P+ LD++  SV+AGL +  A+  +V +   P+  EFRR++    
Sbjct: 153 LNHIIRNRQTKIIRQLPDVLDLLSISVQAGLSLDGAMRKVVERMEGPLIDEFRRMLRDVR 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++   S+  M R   +Q+V  F   +    +LG ++S+ L   +  +RD +  +A+ Q
Sbjct: 213 MGMTRRRSMQLMARRCDVQDVYLFVMSVVQSERLGASMSDTLVIQADNMRDLRRQRARTQ 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVY 145
           A+    KA   +I  L FC+   ++
Sbjct: 273 AM----KAPVKMIFPLVFCIFPAIF 293


>gi|241667101|ref|YP_002985185.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862558|gb|ACS60223.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 287

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 101 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAIAVNAVADTGQMPASREFERIAREQK 160

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 161 LGIGLVEALDRHGRNVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 220

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 221 TSSSQARMNFRVVNGGALFMMLMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 280

Query: 181 LMINFDV 187
            M+   V
Sbjct: 281 SMMKVSV 287


>gi|148556413|ref|YP_001263995.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148501603|gb|ABQ69857.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 302

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 88/178 (49%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
           T + ++D P  +D + + +  G  +  A+A  +  SS  V +     I    LG  L E+
Sbjct: 124 TEQLIEDLPFFIDAVRQLIAVGNSLPQALARALPASSPAVHAYLGPAIRRIELGAPLGEA 183

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           + ++   + L E+S  ++ I V  + GG L+  L+N++ ++R+R  +  ++ A + E + 
Sbjct: 184 LQQVATRLHLTEISMLASAIRVNIRYGGPLTHILSNIAALIRERGRVAREIAAATAEMRV 243

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           SA ++  +P  ++     ++  Y++  ++  RG  L  VA A  LIG   M  +   D
Sbjct: 244 SAKLLAVMPLILAAFFLLSNHAYLDFFLDPQRGRTLALVAVALQLIGAAAMARIQRLD 301


>gi|260778158|ref|ZP_05887051.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606171|gb|EEX32456.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 301

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 81/170 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KK+  +F  +    L ++ R+V AGL V  A+  +    +  +  EF  + +   LG+SL
Sbjct: 118 KKQIEEFDTNIVQVLGLVSRAVSAGLSVPQAIEQVANSQTGLLGREFALITDNLALGISL 177

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++      +P +   +FS  + +    GG L E L NLSR + D + M  KV++++ E
Sbjct: 178 RQTLDEACTRLPYRTFRYFSVALILNQSNGGQLREILHNLSRTMHDNRAMLKKVKSMTAE 237

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
            + +A  +  LP  +  +V +       +L+    G  +L   AA +  G
Sbjct: 238 PRMTAKFLSLLPLILVAVVAWIDVSLFELLVYTESGQSILIYCAASIAFG 287


>gi|297192378|ref|ZP_06909776.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197723021|gb|EDY66929.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 312

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 67/124 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT  F+   P    ++  + +AGL +  A+ + V +  DP R E RRV +   LG SL 
Sbjct: 132 KRTEAFISQLPELTRVLANATQAGLALRTAIGMAVEELDDPAREELRRVADQLALGRSLD 191

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +V  +P +E++   + + + ++ GG +  +L NL+  L +RK  + +V  L  + 
Sbjct: 192 DALGDLVERLPSRELTVLVSTLILSNRAGGTIVTSLRNLTETLEERKETRREVTTLLSQV 251

Query: 127 KASA 130
           K +A
Sbjct: 252 KVTA 255


>gi|209546005|ref|YP_002277895.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538862|gb|ACI58795.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 287

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 101 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAVAVNAVADTGQMPASREFERIAREQK 160

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 161 LGIGLVEALDRHGRTVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 220

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 221 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 280

Query: 181 LMINFDV 187
            M+   V
Sbjct: 281 SMMKVSV 287


>gi|238027559|ref|YP_002911790.1| Flp pilus assembly protein TadB [Burkholderia glumae BGR1]
 gi|237876753|gb|ACR29086.1| Flp pilus assembly protein TadB [Burkholderia glumae BGR1]
          Length = 338

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  K +   P+ LD +VR V  G  V  A    +G +  P+R    +V      G+ 
Sbjct: 157 ISARRLKIVQQLPSFLDGVVRLVTLGNSVPAAFQGALGTTEMPLRRCLDQVSRMLRTGVE 216

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +   ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 217 IDRAMLHIAKEYRVREFELVGSVLRLSVKYGGRADVMLERMATFMRDLEQAERELHAMSA 276

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G LP  V + V  T+P Y   +  +  G ++L VA    ++G
Sbjct: 277 ETRLSAWVLGLLPVAVGSFVVSTNPQYFTAMWMNESGRLVLYVAFGLQMLG 327


>gi|149909543|ref|ZP_01898197.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
 gi|149807448|gb|EDM67399.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
          Length = 305

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 87/177 (49%), Gaps = 2/177 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L ++   +F + FP AL+++  +V +G  +  A+ + VG + D  V  EF+ + +   LG
Sbjct: 122 LQRREKKQFEEAFPEALNMLTSAVSSGESIMHAI-IFVGTALDGEVGKEFKLMGDRLRLG 180

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    + GG L E +  L+R++ D + ++ K  AL
Sbjct: 181 DSPDSVFKKSCNRFPYPAFQFFVITLRANMRHGGQLKEIMTRLNRLMFDARAIEKKKFAL 240

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + EA+ASA I+G++PF    L+ + SP     ++  P G  +L        IGI ++
Sbjct: 241 TSEARASAKIVGAIPFVFLFLLQYLSPENFEFVMFHPSGRPILYYVLISEAIGISII 297


>gi|116255774|ref|YP_771607.1| putative transmembrane pilus component protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115260422|emb|CAK03526.1| putative transmembrane pilus component protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 318

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 132 IRYYLQRRWLQIESQLPYAVDQIVSAVRTGKPLAIAVNAVADTGQMPASREFERIAREQK 191

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 192 LGIGLVEALDRHGRNVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 251

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 252 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 311

Query: 181 LMINFDV 187
            M+   V
Sbjct: 312 SMMKVSV 318


>gi|152981651|ref|YP_001355003.1| Flp pilus assembly protein TadB [Janthinobacterium sp. Marseille]
 gi|151281728|gb|ABR90138.1| Flp pilus assembly protein TadB [Janthinobacterium sp. Marseille]
          Length = 311

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 75/169 (44%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K +   P  LD +VR    G  +  A    V  + +P+R    R       G+ L 
Sbjct: 132 RRHQKMVRQLPAFLDTMVRLTIVGNSLESAFQATVLTTEEPLRELLDRSNRLVQAGMDLE 191

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ +  R   LQE+   + VI V  + GG     L  ++  +RDR+  + ++ ALS E 
Sbjct: 192 HALVQKARVFRLQELELIAAVIGVALRFGGRADTVLERMAAFMRDREYSQNELVALSSET 251

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + SAWI+G LP  +   +   +      ++ DP G  LL  A     IG
Sbjct: 252 RLSAWILGLLPIGLGVFMVIFNNRMFVTMLEDPLGKNLLIFAVVLEAIG 300


>gi|84386793|ref|ZP_00989818.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio splendidus 12B01]
 gi|84378321|gb|EAP95179.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio splendidus 12B01]
          Length = 304

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 76/163 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K +  +F     N L +I R+V AGL V  A+  +       +  EF  + +   LGLSL
Sbjct: 120 KMQVEEFEQGIINVLGLISRAVAAGLSVPQAIEQVSETQPGLLGREFSYIRDNLTLGLSL 179

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +S+      +P     +FS  + +    GG L + L +LSR + D + M+ KV++L+ E
Sbjct: 180 RQSLDDACVRLPYSSFRYFSVALILNQSNGGQLRDILQSLSRTMHDNRAMRKKVKSLTSE 239

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
            + +A  +  LP  +   +Y   P  +  L N   G  +L  A
Sbjct: 240 PRMTALFLSILPLGLLGGIYLMEPAMIVQLFNTESGQRVLTYA 282


>gi|187926430|ref|YP_001892775.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|241665917|ref|YP_002984276.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|187728184|gb|ACD29348.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|240867944|gb|ACS65604.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 308

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 83/177 (46%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K   + L   P  LD +VR +  G  V  A       +  P+R+    + + Q  G  L
Sbjct: 128 RKMNERLLQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEQPLRNCLTAITQMQRAGKDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + R   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 188 DAAVLTVGRQYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQRELFALSAE 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWIIG LP  V  ++   +  Y+  +  DP G  L+  A    ++G +M+ RL
Sbjct: 248 TRLSAWIIGLLPVVVGGVIIMFNAAYIMSMWRDPFGKTLILTAFGMEVLGAVMLARL 304


>gi|161524902|ref|YP_001579914.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189350348|ref|YP_001945976.1| Flp pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342331|gb|ABX15417.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189334370|dbj|BAG43440.1| Flp pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 330

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 149 IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQSALQTTEEPLRGCLDHVSRMLRTGVE 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 209 IDRAMLHIAKIYRTKEFELLGSVLRLSVKYGGRADVMLERMAIFMRDLEQAERELTAMSA 268

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  + + V  T+P Y+  + NDP G MLL  A    L G
Sbjct: 269 ETRLSAFVLMMLPIAIGSFVVMTNPKYLQGMWNDPSGRMLLTFAFLAQLAG 319


>gi|323493499|ref|ZP_08098621.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
 gi|323312322|gb|EGA65464.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
          Length = 302

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 88/177 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG  +
Sbjct: 119 RQQVEEFEQSIVQVLGLISRAVSAGLSVPQAISQVAEAQDGLLGREFSRIEDQLALGHGM 178

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++     +P +   +F+  + +    GG L + L +LSR L D + M+ KV++L+ E
Sbjct: 179 KHTLNEACVRLPYKAFRYFTIALVLNQNSGGQLRDILHSLSRTLHDNRTMQKKVKSLTAE 238

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
            + +A  +  LP  +  +V + +P    VLI    G  +L   A  ++IG + ++LM
Sbjct: 239 PRMAARFLSLLPLGLLAVVAWVNPSLFGVLIETESGQSVLVYCAVSIVIGALSLQLM 295


>gi|186473166|ref|YP_001860508.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184195498|gb|ACC73462.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 275

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 83/169 (49%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R        P+ L +I   +RAG     A+   V +S  P+  EF  ++    LG+ L 
Sbjct: 95  RRIETLERQLPDMLLMIAGGLRAGASFPIALESAVQESVPPISQEFDLLLREIRLGIDLD 154

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  + + +P+ +    +  + +  ++GGNL++AL +++  LRD+  M+ K++AL+ + 
Sbjct: 155 VAMRNIEQRIPVPDFMMVTAAVMISREVGGNLAQALESVASTLRDKLQMEGKIRALTSQG 214

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           +    ++  LP  +  ++    P  M  L   P G   L V AA  L+G
Sbjct: 215 RMQGIVMTCLPLFLMMVLRAMEPVAMAPLFTSPIGWATLAVVAAMELLG 263


>gi|283778972|ref|YP_003369727.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437425|gb|ADB15867.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 289

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 92/177 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L   ++AK      +A+D+++ ++ AG  V+ A+A  + +SS P++ +   ++    LG
Sbjct: 105 YLATMKSAKLERQLADAIDLMIGALGAGTGVTSAMAAAIEESSYPLKGQLEDLLARIRLG 164

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
                    + + +PL+    FS+ ++V  ++GG+L+  LA+  R +RDR  +  ++Q+ 
Sbjct: 165 DDPQAVFRSLSQRIPLETFLLFSSTLAVHWEVGGSLAPTLASAGRTIRDRIEIGRRIQSN 224

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
             +++ S   I  L + ++ +V+  SP  M   +N   G  ++  +     +GI+ M
Sbjct: 225 IAQSQVSTVFILLLTYFIAAVVWRNSPEQMQAFLNTDMGGSVVAGSMVLQAVGIVWM 281


>gi|52425831|ref|YP_088968.1| MaoC protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307883|gb|AAU38383.1| MaoC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 293

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 77/165 (46%), Gaps = 10/165 (6%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   +F + FP  + I+  +  +G  +  A+       S  +  EF  +    H  L++
Sbjct: 112 RRNRKEFEEMFPEVIQILNSATSSGAGLLQALERCGKDISGQIGEEFTAI----HKRLAI 167

Query: 66  SESISRMV-----RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            E  + +      RY P +E  FF T+I V    GG + E +  L R++ D K M+ K  
Sbjct: 168 GEDANSVFEDSYSRY-PYKEYYFFITIIRVNLDKGGQMREVILRLGRVIADSKKMEKKKS 226

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
           A++ EA+ SA I+ S P      + F  P     L+NDP G M+L
Sbjct: 227 AMTSEARMSAMIVASFPVAFFIFMKFMMPENFEFLLNDPGGRMIL 271


>gi|160897512|ref|YP_001563094.1| type II secretion system protein [Delftia acidovorans SPH-1]
 gi|160363096|gb|ABX34709.1| type II secretion system protein [Delftia acidovorans SPH-1]
          Length = 320

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 79/173 (45%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  + L   P  LD +VR +  G     A  + +    DP+    ++          L 
Sbjct: 141 KRRERLLQQLPGFLDNMVRLISIGNSPHAAFQMALNNVPDPLGDALQQAAAMLSASPDLG 200

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++ ++ R   L E    + V  +  + GG     L  +S  +RDR++ + ++ ALS E 
Sbjct: 201 QAMGQLERNWRLPEFGLLAAVFRMSVRYGGRADLVLERVSAYIRDRQSAERELHALSSEI 260

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + SAW++  LP  V  L+   + GY   + ND  G  ++ VAAA   +G  ++
Sbjct: 261 RMSAWVLALLPLVVGALIMVINRGYFMRMWNDDSGQTMVLVAAALEALGAFLL 313


>gi|290957845|ref|YP_003489027.1| type II secretion system F protein [Streptomyces scabiei 87.22]
 gi|260647371|emb|CBG70476.1| putative type II secretion system F protein [Streptomyces scabiei
           87.22]
          Length = 341

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 90/182 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +   LG S+
Sbjct: 160 QKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLALGRSV 219

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  +L NL++ L DRK  + +V+ +  E
Sbjct: 220 DDALGELAERLPSRELIVLVTTLVLSNKAGGTVVSSLRNLTQTLEDRKETRREVRTMLSE 279

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             A+A+ +  L      L+  ++ G +  +   P G +L+ ++     +G  V+R +   
Sbjct: 280 VNATAFTVPLLGLGSLLLINSSNDGALARVTGSPLGQLLVLISIGLYTVGFFVIRRLGKI 339

Query: 186 DV 187
           +V
Sbjct: 340 EV 341


>gi|17549305|ref|NP_522645.1| pilus assembly transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17431557|emb|CAD18235.1| probable pilus assembly tadb transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 308

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 84/177 (47%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+    + + Q  G  L
Sbjct: 128 RRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLTSITQLQRAGKDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 188 DAAVLAVGQLYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQKELLALSAE 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +M+ RL
Sbjct: 248 TRMSAWILGLLPVVVGGIIIMFNAAYVMSMWRDPSGKMLMMAAFGLEVMGSLMLARL 304


>gi|269216232|ref|ZP_06160086.1| putative bacterial type II secretion system protein F domain
           protein [Slackia exigua ATCC 700122]
 gi|269130491|gb|EEZ61569.1| putative bacterial type II secretion system protein F domain
           protein [Slackia exigua ATCC 700122]
          Length = 335

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 82/171 (47%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P+AL  +     AGL V  A A +  ++  P+R  F  V     LG S+ E++ R  R  
Sbjct: 164 PDALRCMEACFHAGLTVPQAFAEVARETKPPLRDAFSMVSHDMELGRSVDEALERFRRAS 223

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
            L E+SF +  + VQ   GG+ S  + +    +     ++  ++  + +AK SA ++  +
Sbjct: 224 SLPELSFVAMALDVQHACGGDASRIVQSAQESVERGIELRRSLRVQTAQAKLSAQVVSIM 283

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           P  +  ++    PG+M+       G  LL  AAA  + GI ++  +++ D+
Sbjct: 284 PIALLVVLSGIDPGFMDPFFESGAGIALLVCAAAMEIAGIAIVSRVLDVDI 334


>gi|89100215|ref|ZP_01173082.1| putative integral membrane protein [Bacillus sp. NRRL B-14911]
 gi|89085065|gb|EAR64199.1| putative integral membrane protein [Bacillus sp. NRRL B-14911]
          Length = 308

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 96/181 (53%), Gaps = 1/181 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           K T +  +    A  ++  + ++G+ ++  + V+  + + P R EF+ + +   LGL   
Sbjct: 129 KYTEQLNNQLSEACRLLGNATKSGMTITQGLEVVASEINSPAREEFKVLTQNLRLGLDFE 188

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            +++ M + +  +E   F + + +Q + GGNL++ L  +++ L +RK ++  ++  + E 
Sbjct: 189 RALAEMEKRIKTREYKLFISALMIQKRSGGNLTKVLYEMAQTLEERKILRQTIKTATAEQ 248

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +  ++I+ ++P  +  ++     G+++++   P G +L+ +    M + ++++R + N  
Sbjct: 249 RFVSYILPAMPIFLLFMLNNIMDGFIDLIFTVP-GAILMTIFIIGMAVALILVRAVTNIK 307

Query: 187 V 187
           V
Sbjct: 308 V 308


>gi|15602713|ref|NP_245785.1| hypothetical protein PM0848 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721157|gb|AAK02932.1| TadB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 291

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS----LSESISR 71
           FP  + I+  +   G  +  ++       +  +  EF+ + +   LG        +S SR
Sbjct: 120 FPEVIQIMNAAATGGAGLLQSLERCGKDLTGQLGEEFKAIHKRLALGEDPMSVFEDSYSR 179

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T+I      GG + E +  L R++ D K M+ K +A++ EA+ SA+
Sbjct: 180 Y----PYKEFYFFITIIRTNLSKGGQIREVITRLGRVIADSKKMEQKKKAMTSEARMSAF 235

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRG----HMLLGVAAAFMLIGIMVMR 180
           I+ S P      + F  P   + L+NDP G    + + G  A  MLI   +MR
Sbjct: 236 IVASFPIAFFLFMQFAMPENFDFLLNDPSGRYVLYYVFGSEAFGMLIIWWLMR 288


>gi|171921005|gb|ACB59188.1| TadB [Actinobacillus suis ATCC 33415]
          Length = 295

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 86/183 (46%), Gaps = 9/183 (4%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+   + 
Sbjct: 113 QRRNKKLFNEKFPEVIQVLNSATSSGISLLQALERCGKDITGPIGEEFSIIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
                 +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ K +
Sbjct: 173 AMAVFHDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++ 
Sbjct: 229 AMTSEARMSAAIVACFPVAFFLFMKVTTPENFDFVVNDPNGRIILYYVVGSELLGMFIIW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|171321819|ref|ZP_02910722.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171092890|gb|EDT38140.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 224

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 83/171 (48%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  + +   P+ LD IVR V  G  V  A    +  + +P+RS    V      G+ 
Sbjct: 43  IQRRRLRIVRQIPSFLDGIVRLVTLGNSVPAAFQSALLTTEEPLRSCLDHVSRMLRGGVE 102

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 103 IDRAMMHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSS 162

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  + + V  T+P Y++ + NDP G  LL VA    L G
Sbjct: 163 ETRLSAFVLVMLPIGIGSFVVMTNPKYLHGMWNDPSGRTLLMVAFLLQLGG 213


>gi|330819178|ref|YP_004348040.1| type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327371173|gb|AEA62528.1| type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 282

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 92/182 (50%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R A      P+ L +   ++RAG   + A+  +V ++  P+  E   ++    LG+ L
Sbjct: 101 KRRIAMLERQLPDVLLMTAGALRAGASFAVAMESVVSEAPAPISGELELLMRELRLGIDL 160

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + R +P+ +    +  +++  ++GGNL+EAL +++R L  +  M+ K++AL+ +
Sbjct: 161 DIAMQNIERRIPVPDFLMVTAAVTISREVGGNLAEALESVARTLGAKLQMEGKIRALTSQ 220

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +    ++  LP  +  ++ F  P  M  L ++  G + L V A    +G   +  + N 
Sbjct: 221 GRMQGIVMTLLPLGLMVVLNFMEPEAMAPLFHERVGWLTLAVIAVMEFLGYKAISKITNI 280

Query: 186 DV 187
           DV
Sbjct: 281 DV 282


>gi|85711970|ref|ZP_01043024.1| Flp pilus assembly protein TadB [Idiomarina baltica OS145]
 gi|85694156|gb|EAQ32100.1| Flp pilus assembly protein TadB [Idiomarina baltica OS145]
          Length = 281

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 89/185 (48%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + +  KR        P  L  +   +++G+ + +AV  +  +   P+  E   +I    L
Sbjct: 95  RRMRNKRYRALQRQLPMLLMNLSNQLKSGMSMVNAVTSLFDEFEAPLGQEVNELIRQVRL 154

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L  +++   R +P+  ++     +++  + GG  S+ L  L+  L  ++ ++ + QA
Sbjct: 155 GDDLPTALTDWQRRVPIFSITLVVQALTLGYRNGGQQSQVLRRLAENLGQQQKVRDRQQA 214

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           LS + +  AW++  +P  +  L+ +  P +   L N   G + LGVA    LIG M+++ 
Sbjct: 215 LSAQGRMQAWVLICMPLALFLLLNWMKPTHTAYLTNTLIGQVALGVAIVLTLIGAMMVKR 274

Query: 182 MINFD 186
           ++N D
Sbjct: 275 ILNTD 279


>gi|78066134|ref|YP_368903.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
 gi|77966879|gb|ABB08259.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
          Length = 326

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 145 ISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSTLQTAEMPLRRCLDDVSRMLRSGVE 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E      V+ +  + GG     L  +S  +RD ++ + ++ A+S 
Sbjct: 205 IDRAMLHVAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEHAERELSAMSA 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++  +P  V + V  TSP Y   + ND  G  L+ +A A   +G
Sbjct: 265 ETRMSAWVLALMPIAVGSFVIATSPHYFTAMWNDDSGRQLVYLAFALQTMG 315


>gi|311105394|ref|YP_003978247.1| type II secretion system protein F domain-containing protein 1
           [Achromobacter xylosoxidans A8]
 gi|310760083|gb|ADP15532.1| bacterial type II secretion system protein F domain protein 1
           [Achromobacter xylosoxidans A8]
          Length = 281

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 81/148 (54%)

Query: 40  IVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLS 99
           +V QS  P+  EF  ++  Q +G+    ++  +   MP    +     + + +Q GGNL+
Sbjct: 134 VVEQSGAPLAQEFGLMLREQRMGVPWDSALENLRNRMPADSTALVVAAMRIAAQTGGNLA 193

Query: 100 EALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           EAL ++++ LR R  ++AK+ AL+ + +  AWI+GSLP  +  ++    P  M +L + P
Sbjct: 194 EALESIAQTLRARLQLQAKLLALTSQGRLQAWIVGSLPLLLLAVLDRLEPEIMGLLWHTP 253

Query: 160 RGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            G  +L + A     G++++R ++  D+
Sbjct: 254 VGWGVLTIVAVLETTGMLLIRRIVRIDI 281


>gi|325111218|ref|YP_004272286.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324971486|gb|ADY62264.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 286

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 76/158 (48%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  + L   P  +D + R+ R G  +   + ++   +  P+  E  R +    +G++++
Sbjct: 104 RRQGQILRQLPPMIDELARAARTGRSLDQCLEMVATDTPAPLGDEMERSVRKLQMGVTMN 163

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +     +  +   +T +SV  Q GG+L   L  L+R LRDR     +++A++  +
Sbjct: 164 EALYELPERTGVNGLRILATALSVHQQTGGDLVRVLERLARTLRDRGMFLGRLRAITAGS 223

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML 164
           +A+A ++  LP  +     F  P Y+  L+    G  +
Sbjct: 224 RATALLMILLPPAILVFFIFRDPDYLASLMASNWGRFI 261


>gi|253580449|ref|ZP_04857714.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848179|gb|EES76144.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 257

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIV-------GQSSDPVRSEFRRV 55
            +I++R       F +AL  +  +V+AG  V  AV   V       G+ +D V  EFR +
Sbjct: 67  RMIRERRKNLNYQFKDALTSLSVAVQAGYSVESAVKTCVRDLERLYGKGTDIV-EEFRYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
              QH+ + L E    +     ++++  F++V     + GG+++  +  +SR+L D+ ++
Sbjct: 126 ESQQHISVPLEELFLDLGERSQIEDIENFASVFYTAKRTGGDMNRVIQKVSRMLGDKIDV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGV-----AAA 170
           K +++A     K+   I+  +P  +   +  TSPG+++VL  +P G   + +     AAA
Sbjct: 186 KKEIEATLAAKKSEQMIMSLMPVGIILYLQMTSPGFLSVLYGNPFGIAAMSICLVIYAAA 245

Query: 171 FML 173
           + L
Sbjct: 246 YWL 248


>gi|317491687|ref|ZP_07950122.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920121|gb|EFV41445.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 290

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 81/172 (47%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F D FP  L ++  +V AG  +  A+          +   F R+    +LG       + 
Sbjct: 115 FEDRFPEILSVVNAAVSAGNSIHQALHRCGEGIDGDLGVTFHRIDRRLNLGEDPERVFND 174

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                  +E  FF  V+ V  Q GG L   +  LSRI+ + KNM  +  A++ EA+ SA 
Sbjct: 175 AWENYRYREFYFFVVVMLVSLQHGGQLRTLMGRLSRIVNNSKNMARRKSAMTSEARTSAK 234

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+ SLP      + + SP   + +++DP G ++L    A   IG++++ +++
Sbjct: 235 IVASLPLLFFCGMKYFSPENFDFVVHDPVGRLILYYVIASEAIGMIIIWILL 286


>gi|313835700|gb|EFS73414.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA2]
 gi|314928371|gb|EFS92202.1| type II secretion system F domain protein [Propionibacterium acnes
           HL044PA1]
 gi|314970223|gb|EFT14321.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA3]
 gi|328908048|gb|EGG27807.1| LOW QUALITY PROTEIN: Type II secretion system F domain protein
           [Propionibacterium sp. P08]
          Length = 307

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 92/177 (51%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++RTAKF++  P    ++  +  AGL +  A+A++  +  +P RSEF +V      G SL
Sbjct: 126 QRRTAKFVNQLPELARLLANASHAGLSLPTAIAMVSDELGEPARSEFAQVENRLRFGASL 185

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  +  ++  +EV+   + + V ++ GG+L  AL  ++  L +RK  + +V  +  +
Sbjct: 186 QTALDELASHVRSREVTVLMSTLIVSARSGGSLVTALRGIADSLEERKETRREVTTILSQ 245

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + A+A++I  +   +   +    PG + ++ +   G + L    +   +G +V+R M
Sbjct: 246 SLATAYLIIIIGLGLLVALNMFEPGTVELMTHSLVGRICLIAGLSLFAVGFVVIRQM 302


>gi|295836765|ref|ZP_06823698.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|295826196|gb|EFG64731.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 314

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 88/181 (48%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   LG S+ 
Sbjct: 134 KRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLALGRSVD 193

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  + R +P +E+    T +++ ++ GG +  +L NL+  L +RK  + +V+ +  E 
Sbjct: 194 EALDELQRRLPSRELVVLVTTLALSNKAGGTVVGSLRNLTVTLEERKETRREVRTMLSEV 253

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R +   D
Sbjct: 254 NATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIRRLGRID 313

Query: 187 V 187
           V
Sbjct: 314 V 314


>gi|330816718|ref|YP_004360423.1| Flp pilus assembly protein TadB [Burkholderia gladioli BSR3]
 gi|327369111|gb|AEA60467.1| Flp pilus assembly protein TadB [Burkholderia gladioli BSR3]
          Length = 329

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  K +   P+ LD +VR V  G  V  A    +G +  P+R    +V      G+ 
Sbjct: 148 ISARRLKIVRQLPSFLDGVVRLVTLGNSVPAAFQGALGTTEMPLRLCLDQVSRMLRTGVE 207

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +   ++E     +V+ +  + GG     L  +S  +RD +  + +++A+S 
Sbjct: 208 IDRAMLHIAKEYRIREFELVGSVLRLSVKYGGRADVMLERMSTFMRDLEQAERELRAMSA 267

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G LP  V + V  T+P Y   +  +  G ++L VA     IG
Sbjct: 268 ETRLSAWVLGLLPIAVGSFVVSTNPKYFMAMWMNESGRVVLYVAFILQAIG 318


>gi|307261000|ref|ZP_07542682.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306869302|gb|EFN01097.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 199

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 88/186 (47%), Gaps = 9/186 (4%)

Query: 3   HLIKKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIE 57
            L ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+  
Sbjct: 14  KLGQRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLAR 73

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
            + +     +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ 
Sbjct: 74  GEDVMAVFQDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQ 129

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K +A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ 
Sbjct: 130 KKKAMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMF 189

Query: 178 VMRLMI 183
           ++  ++
Sbjct: 190 IIWWLM 195


>gi|299069495|emb|CBJ40764.1| Type II secretion system protein [Ralstonia solanacearum CMR15]
          Length = 308

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 81/174 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G  L
Sbjct: 128 RRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLTSTTQLQRAGKDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 188 DAAVLAVGQLYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALSAE 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++
Sbjct: 248 TRLSAWILGLLPVVVGGIIIMVNAPYVMSMWRDPSGKMLMMAAFGLEVMGSLIL 301


>gi|307245408|ref|ZP_07527496.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307254363|ref|ZP_07536201.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307258821|ref|ZP_07540553.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306853749|gb|EFM85966.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306862662|gb|EFM94618.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306867172|gb|EFM99028.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 295

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 9/183 (4%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+   + 
Sbjct: 113 QRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +     +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ K +
Sbjct: 173 VMAVFQDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++ 
Sbjct: 229 AMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|46143338|ref|ZP_00204445.1| COG4965: Flp pilus assembly protein TadB [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208033|ref|YP_001053258.1| tight adherence protein B [Actinobacillus pleuropneumoniae L20]
 gi|165975970|ref|YP_001651563.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|303252183|ref|ZP_07338351.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307247523|ref|ZP_07529568.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|126096825|gb|ABN73653.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165876071|gb|ABY69119.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|302648966|gb|EFL79154.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|306856026|gb|EFM88184.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
          Length = 295

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 9/183 (4%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+   + 
Sbjct: 113 QRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFAIIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +     +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ K +
Sbjct: 173 VMAVFQDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++ 
Sbjct: 229 AMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|190149861|ref|YP_001968386.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251576|ref|ZP_07337750.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307249755|ref|ZP_07531733.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252111|ref|ZP_07534010.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307263185|ref|ZP_07544806.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|189914992|gb|ACE61244.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302649574|gb|EFL79756.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306858170|gb|EFM90248.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860411|gb|EFM92425.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306871547|gb|EFN03270.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 295

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 9/183 (4%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+   + 
Sbjct: 113 QRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +     +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ K +
Sbjct: 173 VMAVFQDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++ 
Sbjct: 229 AMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|307256570|ref|ZP_07538351.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306864980|gb|EFM96882.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 295

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 9/183 (4%)

Query: 6   KKRTAK-FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K F + FP  + ++  +  +G+ +  A+       + P+  EF    +R+   + 
Sbjct: 113 QRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFAIIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +     +S SR     P +E  FF ++I      GG + E ++ L R + D   M+ K +
Sbjct: 173 VMAVFQDSYSRY----PYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++ 
Sbjct: 229 AMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|167816006|ref|ZP_02447686.1| type II secretion system protein [Burkholderia pseudomallei 91]
          Length = 206

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 25  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 84

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 85  IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 144

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 145 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 195


>gi|217423568|ref|ZP_03455069.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|217393426|gb|EEC33447.1| type II secretion system protein [Burkholderia pseudomallei 576]
          Length = 237

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 56  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 115

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 116 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 175

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 176 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 226


>gi|257790637|ref|YP_003181243.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257474534|gb|ACV54854.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 296

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 85/172 (49%), Gaps = 1/172 (0%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           KF +    A+ +I  ++RAG  V+ A+  +    SDP++SEFRR+      G  + E++ 
Sbjct: 120 KFEEQLGQAMPLIASNLRAGSSVAQAIGPVAENMSDPIKSEFRRLTSDIRAGTPVPEALD 179

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
           ++      +++  F+T + +  Q GG+L++   N+ + +R R   +  +++ +   +  +
Sbjct: 180 KVADRTGSRDLRLFATAVDISQQTGGSLADITENVGQTVRARVEARKAIRSKTSLNRIES 239

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
            I+  LP  +   +   SP +     + P G  L+ +A     +  ++MR M
Sbjct: 240 QIMVGLPVFMMAALLAISPSHRE-FYSQPSGWALIALAVVLDTLAYLMMRKM 290


>gi|167738782|ref|ZP_02411556.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167824381|ref|ZP_02455852.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167911132|ref|ZP_02498223.1| type II secretion system protein [Burkholderia pseudomallei 112]
          Length = 211

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 30  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 89

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 90  IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 149

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 150 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 200


>gi|300694108|ref|YP_003750081.1| type II secretion system protein [Ralstonia solanacearum PSI07]
 gi|299076145|emb|CBM10581.1| Type II secretion system protein [Ralstonia solanacearum PSI07]
          Length = 308

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 83/177 (46%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G  L
Sbjct: 128 RRMNERLMQQLPGFLDGMVRLMSIGSAVPAAFQAASANTEPPLRTCLTSATQLQRAGKDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 188 DAAVLAVGQQYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQKELLALSAE 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +M+ RL
Sbjct: 248 TRLSAWILGLLPVVVGGIIIMFNAAYVMSMWRDPVGKMLMTAAFGLEVMGSLMLARL 304


>gi|167894488|ref|ZP_02481890.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 215

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 34  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 93

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 94  IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 153

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 154 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 204


>gi|167845913|ref|ZP_02471421.1| type II secretion system protein [Burkholderia pseudomallei B7210]
          Length = 216

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 35  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 94

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 95  IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 154

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 155 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 205


>gi|282865304|ref|ZP_06274356.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559777|gb|EFB65327.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 312

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 84/169 (49%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT  F++  P    ++  + +AGL +  A+ + V +  +P + E RRV +   +G SL 
Sbjct: 132 KRTEAFINQLPELTRVLANATQAGLALRTAIGMAVEELDNPAQEELRRVADRLAVGHSLD 191

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ++++ +V  +P +E++   + + + ++ GG +  +L NL+  L +RK  + +V  L  + 
Sbjct: 192 DALNELVERLPSRELTVLVSTLILSNRAGGTIVSSLRNLTETLEERKETRREVTTLLSQV 251

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +A  +  L      ++     G ++ +     G + + VAA     G
Sbjct: 252 KVTAVAVPILGLGFLLIINGMRAGALDDMTGSTPGRIAVVVAAGLYAAG 300


>gi|167719784|ref|ZP_02403020.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 220

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 39  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 98

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 99  IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 158

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 159 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 209


>gi|206559897|ref|YP_002230661.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035938|emb|CAR51830.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 326

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 77/171 (45%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V +    G+ 
Sbjct: 145 ISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSQMLRSGVE 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ A+S 
Sbjct: 205 IDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELSAMSA 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++  LP  V + V  TSP Y   +  D  G  L+ +A A   IG
Sbjct: 265 ETRLSAWVLALLPIAVGSFVIATSPRYFTAMWGDDNGRQLIYLAFALQAIG 315


>gi|167570102|ref|ZP_02362976.1| hypothetical protein BoklC_09676 [Burkholderia oklahomensis C6786]
          Length = 268

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 78/163 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ +
Sbjct: 88  QKRRLQIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVEI 147

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S E
Sbjct: 148 DRAMVYIAELYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELAAMSAE 207

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
            + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A
Sbjct: 208 TRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLA 250


>gi|167836790|ref|ZP_02463673.1| hypothetical protein Bpse38_09905 [Burkholderia thailandensis
           MSMB43]
          Length = 221

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 40  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 99

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 100 IDRAMVYVATLYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 159

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L  V  AF+L
Sbjct: 160 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQL--VYLAFIL 206


>gi|148976303|ref|ZP_01813027.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrionales bacterium SWAT-3]
 gi|145964397|gb|EDK29652.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrionales bacterium SWAT-3]
          Length = 302

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 81/174 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K +  +F     + L +I R+V AGL V  A+  +       +  EF  + +   LGLSL
Sbjct: 118 KLQVEEFEKSIISVLGLISRAVSAGLSVPQAIDQVAQNEQGLLGREFSYIRDNLALGLSL 177

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++      +P     +FS  + +    GG L + L  LSR + D + M+ KV++L+ E
Sbjct: 178 RDTLEDACIRLPYHSFRYFSVALILNQSNGGQLRDILQGLSRTMHDNRAMRKKVKSLTSE 237

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            + +A  +  LP  +   + +  P   + LIN   G  +L    + +  G +++
Sbjct: 238 PRMTALFLSLLPIGLIGSIAWIEPTMADRLINTESGQNVLIYVLSSICFGTLIL 291


>gi|167562911|ref|ZP_02355827.1| hypothetical protein BoklE_10150 [Burkholderia oklahomensis EO147]
          Length = 258

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 80/168 (47%), Gaps = 2/168 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ +
Sbjct: 78  QKRRLQIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVEI 137

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S E
Sbjct: 138 DRAMVYIAELYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELAAMSAE 197

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
            + SAW++G+LP  + + V  T+P Y + +  DP G  L  V  AF+L
Sbjct: 198 TRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQL--VYLAFIL 243


>gi|172060498|ref|YP_001808150.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171993015|gb|ACB63934.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 330

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 149 IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLRTGVE 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    QE     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 209 IDRAMLHIAKIYRTQEFELLGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSA 268

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  + + V  T+P Y+  +  DP G MLL +A    + G
Sbjct: 269 ETRLSAFVLVMLPIGIGSFVVMTNPKYLEGMWIDPGGRMLLVLAFLLQIAG 319


>gi|167919155|ref|ZP_02506246.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
          Length = 256

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 75  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 134

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 135 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 194

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 195 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 245


>gi|187251610|ref|YP_001876092.1| TadB [Elusimicrobium minutum Pei191]
 gi|186971770|gb|ACC98755.1| TadB [Elusimicrobium minutum Pei191]
          Length = 535

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 96/182 (52%), Gaps = 1/182 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+L ++R  K  +   ++L ++  S++AG+ +  A  ++      P+  EF  VI+   
Sbjct: 349 LKNLKRRRGTKINNQLMDSLILLSNSLKAGMDIVQAFEMVSKDMKPPIADEFGLVIKNYQ 408

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  +++  M   +  + +S+    I +Q Q+GGNL++    +   +R+   ++ K+Q
Sbjct: 409 LGSSFEQALEMMEDRVENRLLSYMIKAIVLQRQVGGNLTKIFERIVETIREESKLEEKLQ 468

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI-MVM 179
           A++ + +  + ++G +P+ + ++++   P  M        G ++L     ++L+G+ MV 
Sbjct: 469 AMTAQQRIQSIVVGIMPWLMISVMFLFRPDAMINFYTSGIGLIVLFFCIFWILMGMKMVS 528

Query: 180 RL 181
           +L
Sbjct: 529 KL 530


>gi|226310158|ref|YP_002770052.1| hypothetical protein BBR47_05710 [Brevibacillus brevis NBRC 100599]
 gi|226093106|dbj|BAH41548.1| conserved hypothetical membrane protein [Brevibacillus brevis NBRC
           100599]
          Length = 306

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 74/132 (56%)

Query: 22  IIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEV 81
           ++  S+RAGL +S  ++++  + + P   EF R+     LG+S   ++S M + +P +E 
Sbjct: 142 LLANSLRAGLTLSQGISLVAKEMNYPAGDEFSRMARELQLGVSFDRALSDMEKRIPTREF 201

Query: 82  SFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVS 141
             F+  + +Q + GGNLS+ L  ++  L DR+ +  +++ ++ E +  + ++  +P  + 
Sbjct: 202 RIFTATLLIQRRAGGNLSQVLQEMAETLEDRRIVNQEIKTMTAEQRYVSILVPIMPVALV 261

Query: 142 TLVYFTSPGYMN 153
            ++   + G+++
Sbjct: 262 LMMNTMNKGFID 273


>gi|226196404|ref|ZP_03791986.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225931621|gb|EEH27626.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 316

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 135 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 194

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 195 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 254

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 255 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 305


>gi|167620220|ref|ZP_02388851.1| hypothetical protein BthaB_28195 [Burkholderia thailandensis Bt4]
          Length = 242

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 61  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLRSGVE 120

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 121 IDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 180

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L  V  AF+L
Sbjct: 181 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQL--VYLAFIL 227


>gi|170732850|ref|YP_001764797.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169816092|gb|ACA90675.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 326

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 145 ISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSRMLRSGVD 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ A+S 
Sbjct: 205 IDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELSAMSA 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++  LP  V + V  TSP Y   + ND  G  L+ +A     IG
Sbjct: 265 ETRLSAWVLALLPIAVGSFVIATSPRYFTAMWNDDTGRQLVYLAFVLQAIG 315


>gi|167902895|ref|ZP_02490100.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 264

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 83  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 142

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 143 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 202

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 203 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 253


>gi|107022597|ref|YP_620924.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116689546|ref|YP_835169.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|105892786|gb|ABF75951.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116647635|gb|ABK08276.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 326

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 145 ISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSRMLRSGVD 204

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ A+S 
Sbjct: 205 IDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELSAMSA 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++  LP  V + V  TSP Y   + ND  G  L+ +A     IG
Sbjct: 265 ETRLSAWVLALLPIAVGSFVIATSPRYFTAMWNDDAGRQLVYLAFVLQAIG 315


>gi|221066736|ref|ZP_03542841.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220711759|gb|EED67127.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 317

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 1/178 (0%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           + KR  + L   P+ LD +VR +  G     A  + V     P+    ++   +      
Sbjct: 136 LSKRREQLLQQLPSFLDNMVRLITIGNSPHAAFQLAVVNVPAPLGDALQQASASLRASPD 195

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L  ++  + R   L E    + V  + ++ GG   + L  +S  +RDR++ + ++ ALS 
Sbjct: 196 LGHAMGLLERSWRLSEFGLLAAVFRMSTRYGGRADQVLERVSAYIRDRQSAERELHALSA 255

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH-MLLGVAAAFMLIGIMVMRL 181
           E + SAWI+  LP  V  L+   + GY   +  D  G  M+LG A    L    + RL
Sbjct: 256 EVRLSAWILALLPVAVGGLIMILNQGYFMTMWQDETGRKMVLGAAGLEALGSFFLYRL 313


>gi|67641291|ref|ZP_00440072.1| type II secretion system protein [Burkholderia mallei GB8 horse 4]
 gi|121598780|ref|YP_993095.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124386324|ref|YP_001026128.1| hypothetical protein BMA10229_A0120 [Burkholderia mallei NCTC
           10229]
 gi|126449995|ref|YP_001080600.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|167002478|ref|ZP_02268268.1| type II secretion system protein [Burkholderia mallei PRL-20]
 gi|254178697|ref|ZP_04885352.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|254206226|ref|ZP_04912578.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|121227590|gb|ABM50108.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124294344|gb|ABN03613.1| putative membrane protein [Burkholderia mallei NCTC 10229]
 gi|126242865|gb|ABO05958.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|147753669|gb|EDK60734.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|160699736|gb|EDP89706.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|238522200|gb|EEP85646.1| type II secretion system protein [Burkholderia mallei GB8 horse 4]
 gi|243061819|gb|EES44005.1| type II secretion system protein [Burkholderia mallei PRL-20]
          Length = 306

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 125 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 184

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 185 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 244

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 245 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 295


>gi|51891529|ref|YP_074220.1| putative sercretion system protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855218|dbj|BAD39376.1| putative sercretion system protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 299

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 89/172 (51%), Gaps = 2/172 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           +  P  L ++   +RAG  +  AV  +V Q+  P+R EF RV     L +   +++  + 
Sbjct: 125 EQLPETLMLMASVIRAGGTLYQAVQTVVQQAPQPMRGEFERVARAMQLQVPAGDALGLIR 184

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSR-ILRDRKNMKAKVQALSMEAKASAWI 132
             + L E +       V  + GG+L   L ++SR ++ DR+ ++A ++A   E KASA +
Sbjct: 185 DRVGLGEFTSVVVACKVAGEAGGDLDRVLESISRELVEDRQFLRA-MEAACAEGKASARL 243

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + ++P  V  LV + +P Y    + DP G +LL  +   M +G +++R + +
Sbjct: 244 VTAVPLVVVALVSYQNPAYFGEALTDPLGRVLLLGSLCAMALGWLLIRQITD 295


>gi|167582057|ref|ZP_02374931.1| hypothetical protein BthaT_28197 [Burkholderia thailandensis TXDOH]
          Length = 261

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 80  MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLRSGVE 139

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 140 IDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 199

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L  V  AF+L
Sbjct: 200 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQL--VYLAFIL 246


>gi|261251594|ref|ZP_05944168.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260938467|gb|EEX94455.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 302

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 88/177 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG  +
Sbjct: 119 KQQIEEFEQSIVQVLGLISRAVSAGLSVPQAISQVAESQGGLLGREFSRIEDQLALGHGM 178

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++     +P +   +F+  + +    GG L E L +LSR L D + M+ KV++L+ E
Sbjct: 179 RYTLNEACIRLPYKAFRYFTIALVLNQSNGGQLREILHSLSRTLHDNRTMQKKVKSLTSE 238

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
            + +A  +  LP  +  +V + +P    +LI    G  +L   A  +++G + +++M
Sbjct: 239 PRMAARFLSLLPLGLLAVVAWINPSLFVLLIKTETGQSVLIYCAVSIVLGAITLQVM 295


>gi|260768629|ref|ZP_05877563.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
 gi|260616659|gb|EEX41844.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
          Length = 292

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 91/172 (52%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           + +   P+ ++ + R ++ GL ++ AV      ++ P++   +RVI  + +G+ L ++  
Sbjct: 117 QLVQQLPSFVEQVNRRIKVGLSIAQAVEQSASATNAPLKDVLQRVIHRKAVGVELQDAFE 176

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
           +      +       ++ S+ ++ GG+++++L +L ++LR +   + ++++++ E + +A
Sbjct: 177 KESVVTGVVAFHLLGSIFSINTRYGGSITDSLESLVKLLRQQDLSRRELKSITGETRITA 236

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           W+IGS P  VS  +   +P  +  +     G   L +  +  L+GI+++  M
Sbjct: 237 WVIGSAPLLVSAYMLTQNPELLINMWYSEGGRQALILGISLQLLGIILIWRM 288


>gi|134282399|ref|ZP_01769104.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|134246437|gb|EBA46526.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 335

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 154 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 214 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 273

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 274 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 324


>gi|53719506|ref|YP_108492.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76810037|ref|YP_333344.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|126438493|ref|YP_001058810.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126453046|ref|YP_001066061.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242314637|ref|ZP_04813653.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254188636|ref|ZP_04895147.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254197238|ref|ZP_04903660.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254259377|ref|ZP_04950431.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|254297790|ref|ZP_04965243.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52209920|emb|CAH35892.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76579490|gb|ABA48965.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|126217986|gb|ABN81492.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126226688|gb|ABN90228.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157807876|gb|EDO85046.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157936315|gb|EDO91985.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653979|gb|EDS86672.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|242137876|gb|EES24278.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254218066|gb|EET07450.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 335

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 154 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 214 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 273

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 274 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 324


>gi|134295598|ref|YP_001119333.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134138755|gb|ABO54498.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 324

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +    +P+R     V      G+ 
Sbjct: 143 IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTCEEPLRGCLDHVSRMLRSGVE 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 203 IDRAMLHVAKVYRTKEFELLGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSA 262

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
           E + SA+++  LP  + + V  T+P Y+  + NDP G  LL +A
Sbjct: 263 ETRLSAFVLVMLPIAIGSFVVMTNPRYLEGMWNDPSGRTLLMLA 306


>gi|83719714|ref|YP_443056.1| hypothetical protein BTH_I2539 [Burkholderia thailandensis E264]
 gi|83653539|gb|ABC37602.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 336

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 155 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLRSGVE 214

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 215 IDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 274

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L  V  AF+L
Sbjct: 275 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQL--VYLAFIL 321


>gi|238796993|ref|ZP_04640497.1| Type II secretion system protein F domain protein [Yersinia
           mollaretii ATCC 43969]
 gi|238719253|gb|EEQ11065.1| Type II secretion system protein F domain protein [Yersinia
           mollaretii ATCC 43969]
          Length = 279

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 78/178 (43%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K     F  D P  + +I  +  +G  ++  +     + S P+  E   +    +LG S 
Sbjct: 98  KTHHTLFKRDLPEVILMINMAASSGASINQVLERCGNEISGPLGDELDLICRRLNLGESP 157

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
               +   +     E  F  T+I +  Q GG L E ++ LS+++   K  + K   ++ +
Sbjct: 158 EAVFNDAYQRFLYPEFYFLITIILLNLQQGGQLRELISRLSQVINKNKTSEQKKAVMTAQ 217

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + S  II  +P   STL+YF  P  M  + N P G M+        +IGI ++R M+
Sbjct: 218 TRMSVNIISLMPLVFSTLLYFLDPATMESMWNHPMGKMVFYYIILSEVIGITIIRTML 275


>gi|312883758|ref|ZP_07743477.1| Flp pilus assembly protein TadB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368507|gb|EFP96040.1| Flp pilus assembly protein TadB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 302

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 88/177 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG  +
Sbjct: 119 KQQIEEFEQSMVQVLGLISRAVSAGLSVPQAISQVTESQGGLMSREFSRIEDQLALGHGM 178

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +++     +P +   +F+  + +    GG L E L +LSR L + + M+ KV++L+ E
Sbjct: 179 RYALNEACIRLPYKAFRYFTIALLLNQSNGGQLREILHSLSRTLHENRAMQKKVKSLTSE 238

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
            + +A  +  LP  + TLV + +P    +LI    G  +L   A  +L+G + + LM
Sbjct: 239 PRTAARFLSLLPLGLLTLVAWINPSLFLLLIETEPGQSVLIYCAVSILVGAITLHLM 295


>gi|237812070|ref|YP_002896521.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|237505569|gb|ACQ97887.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 329

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 148 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLRSGVE 207

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 208 IDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 267

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G
Sbjct: 268 ETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAG 318


>gi|317133735|ref|YP_004089646.1| Type II secretion system F domain [Ruminococcus albus 7]
 gi|315450197|gb|ADU23760.1| Type II secretion system F domain [Ruminococcus albus 7]
          Length = 292

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 88/181 (48%), Gaps = 2/181 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS--SDPVRSEFRRVIETQHLGL 63
           KK    F + +  AL  +  S+RAG+ +  AV  +         ++ EFR++     LG 
Sbjct: 106 KKHKKNFEERYARALRQLSSSLRAGMTLQQAVEDLCKCPFIHYEIKKEFRQINSDIQLGF 165

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+SE+   M   +P  +V    + I +QS +GG+ +E++  ++  +  R  ++ +++ L 
Sbjct: 166 SISEAFGHMAERIPTADVKDVVSAIKMQSLVGGSEAESIEIITNNINSRMMLRKEIKTLF 225

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
              K +   +  LP  +   +Y++SP Y   L +   G ++  +A   M+IG  + R  +
Sbjct: 226 ASTKMTIIGMDILPAIIILFLYYSSPMYFRPLFSTLIGRLVFVLAIILMVIGSYIDRKFL 285

Query: 184 N 184
           N
Sbjct: 286 N 286


>gi|170701755|ref|ZP_02892691.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170133338|gb|EDT01730.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 327

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 77/169 (45%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R    +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 146 IHRRRQMIVRQLPSFLDGIVRLVTLGNSVPAAFQAALQTTEAPLRGCLDHVSRMLRTGVE 205

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +      +E     +V+ +  + GG     L  +S  +RD +  + +++A+S 
Sbjct: 206 IDRAMMHIANVYHTKEFELVGSVLRLSVRYGGRADIMLDRMSTFMRDLEQAERELEAMSS 265

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++  LP  + + V  T+P Y+  + ND  G  LL    AFML
Sbjct: 266 ETRLSAWVLVMLPIAIGSFVIATNPLYLQSMWNDYTGRQLL--VLAFML 312


>gi|325518468|gb|EGC98167.1| type II secretion system protein [Burkholderia sp. TJI49]
          Length = 257

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 80/171 (46%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 76  IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLRTGVE 135

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 136 IDRAMLHIAKIYRTEEFELLGSVLRLSVKYGGRADVMLERMAIFMRDLEQAERELTAMSA 195

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  + + V  T+P Y+  + ND  G +LL  A    L G
Sbjct: 196 ETRLSAFVLVMLPIAIGSFVVMTNPTYLQGMWNDSLGRLLLMFAFLMQLAG 246


>gi|115351459|ref|YP_773298.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115281447|gb|ABI86964.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 322

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 77/169 (45%), Gaps = 2/169 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R    +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 141 IHRRRQMIVRQLPSFLDGIVRLVTLGNSVPAAFQAALQTTEAPLRGCLDHVSRMLRTGVE 200

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +      +E     +V+ +  + GG     L  +S  +RD +  + +++A+S 
Sbjct: 201 IDRAMMHIANVYHTKEFELVGSVLRLSVRYGGRADIMLDRMSTFMRDLEQAERELEAMSS 260

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           E + SAW++  LP  + + V  T+P Y+  + ND  G  LL    AFML
Sbjct: 261 ETRLSAWVLVMLPIAIGSFVIATNPLYLQSMWNDYTGRQLL--VLAFML 307


>gi|312883312|ref|ZP_07743038.1| putative Flp pilus assembly protein TadB [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368928|gb|EFP96454.1| putative Flp pilus assembly protein TadB [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 304

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 89/178 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K++  ++   F+++FP+AL+I+  ++ +G  +  A   +  Q ++ V  EF+ + E   +
Sbjct: 119 KYMGGRKKKIFVENFPDALNILSGAISSGQSIVHAFEYVGSQLNNDVGKEFKIISERLLI 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +  + + R     P  E  FF + I +    GG L + +  ++R++ + ++++ K  +
Sbjct: 179 GENPDDVLERSGIQYPYLEYFFFISAIRINISRGGQLKDIINKINRLMFESRSLEKKKNS 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           L+ E++ SA I+G LP     ++ F SP   + ++    G  +         IG  ++
Sbjct: 239 LTAESRMSAKILGVLPIGFLFVLKFISPEDFDFVMFQEEGRPIFYYLICSEFIGFFII 296


>gi|307730003|ref|YP_003907227.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307584538|gb|ADN57936.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 404

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V      G+ + 
Sbjct: 224 RRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLRTTEAPLRECLDHVSRMLRSGVEID 283

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++S +      +E+     V+ +  + GG     L  +S  +RD +  + ++ A+S E 
Sbjct: 284 RALSHVAVLYGARELELLGAVLRLSVKYGGRADVMLDRMSSFMRDLEQAERELVAMSSET 343

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++
Sbjct: 344 RLSSWVLGMLPIGIGGFLILTNPRYFGSMWFDPGGRQILYLAFALQLTGAYLL 396


>gi|170696832|ref|ZP_02887932.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170138260|gb|EDT06488.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 356

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V      G+ + 
Sbjct: 176 RRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLQTTEAPLRECLDHVSRMLRSGVEID 235

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++S +      +E+     V+ +  + GG     L  +S  +RD +  + ++ A+S E 
Sbjct: 236 RALSHVAVLYGARELELVGAVLRLSVKYGGRADVMLDRMSSFMRDLEQAERELVAMSSET 295

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++
Sbjct: 296 RLSSWVLGMLPVGIGGFLILTNPRYFGSMWFDPGGRQILYLAFALQLTGAYLL 348


>gi|323525749|ref|YP_004227902.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323382751|gb|ADX54842.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 386

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 79/173 (45%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V      G+ + 
Sbjct: 206 RRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLQITEAPLRECLDHVSRMLRSGVEID 265

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++S +      +E+     V+ +  + GG     L  +S  +RD ++ + ++ A+S E 
Sbjct: 266 RALSHVAVLYGARELELVGAVLRLSVKYGGRADVMLDRMSSFMRDLEHAERELVAMSSET 325

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++
Sbjct: 326 RLSSWVLGMLPAGIGGFLILTNPRYFGAMWFDPGGRQILYIAFALQLTGAYLL 378


>gi|239979682|ref|ZP_04702206.1| hypothetical protein SalbJ_09607 [Streptomyces albus J1074]
 gi|291451547|ref|ZP_06590937.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291354496|gb|EFE81398.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 311

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 87/182 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +   LG S+
Sbjct: 130 QKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELCRVADQLALGRSV 189

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  +   +P +E+    T + + +Q GG +  +L NL+  L +RK  + +V+ +  E
Sbjct: 190 DAALGELAERLPSRELVVLVTTLVLSNQAGGTVVSSLRNLTATLEERKETRREVRTMLSE 249

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             A+A  + +L      L+   + G +  +     G +L+ +A     +G +V+R +   
Sbjct: 250 VHATALTVPALGLGSLLLINSQNEGALARVTGSALGQILILIALGLYAVGFLVIRRLGKI 309

Query: 186 DV 187
           +V
Sbjct: 310 EV 311


>gi|302521639|ref|ZP_07273981.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302430534|gb|EFL02350.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 242

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 87/181 (48%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   LG S+ 
Sbjct: 62  KRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLALGRSID 121

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  + R +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+ +  E 
Sbjct: 122 EALDELSRRLPSRELVVLVTTLVLSNKAGGTVVGSLRNLTVTLEERKETRREVRTMLSEV 181

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R +   D
Sbjct: 182 NATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIRRLGRID 241

Query: 187 V 187
           V
Sbjct: 242 V 242


>gi|187923648|ref|YP_001895290.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187714842|gb|ACD16066.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 342

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 84/181 (46%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V      G+ 
Sbjct: 160 VNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLRTGVE 219

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++S++ +   ++E+     V+ +  + GG     L  ++  +RD ++ + ++ A+S 
Sbjct: 220 IDRALSQVAQIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELVAMSS 279

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A    ++G  ++  + N
Sbjct: 280 ETRLSSWVLAMLPIGIGGFLILSNPKYFASMWFDPTGRQLVYLAFVLQVLGAYLLYRLAN 339

Query: 185 F 185
            
Sbjct: 340 L 340


>gi|260775649|ref|ZP_05884545.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608065|gb|EEX34234.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 306

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 92/185 (49%), Gaps = 2/185 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQ 59
           M  L  +    F + FP+AL ++  +V AG  +  +  + VG++ D PV  EF+++ +  
Sbjct: 120 MNWLQAREKQHFEEAFPDALTMLASAVSAGEGLMQSF-IFVGRTLDGPVGKEFKKMGDRL 178

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
            +G S +   S+  +  P     FF   +      GG + E +A L+R++   + ++ K 
Sbjct: 179 QMGESTNAVFSKSCQRFPYPSFHFFVITMRANIDRGGQIKEVVAKLNRVMFSARAIEKKK 238

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            AL+ EA+ SA I+G+LPF    L+ + SP     ++  P G  +L        IG+ ++
Sbjct: 239 YALTSEARVSAKIVGALPFFFLFLLQYISPDNFEFVMFHPDGRPVLYYVMISECIGMGLI 298

Query: 180 RLMIN 184
            L++ 
Sbjct: 299 WLLMK 303


>gi|296158798|ref|ZP_06841627.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891003|gb|EFG70792.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 356

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 83/181 (45%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V      G+ 
Sbjct: 174 VNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLRTGVE 233

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++S++     ++E+     V+ +  + GG     L  ++  +RD ++ + ++ A+S 
Sbjct: 234 IDRALSQVALIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELVAMSA 293

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A A  L G  ++  + N
Sbjct: 294 ETRLSSWVLAMLPVGIGGFLILSNPKYFASMWFDPTGRQLVYLAFALQLGGAYLLYRLAN 353

Query: 185 F 185
            
Sbjct: 354 L 354


>gi|318057611|ref|ZP_07976334.1| hypothetical protein SSA3_06719 [Streptomyces sp. SA3_actG]
 gi|318080453|ref|ZP_07987785.1| hypothetical protein SSA3_28141 [Streptomyces sp. SA3_actF]
 gi|333024717|ref|ZP_08452781.1| putative integral membrane protein [Streptomyces sp. Tu6071]
 gi|332744569|gb|EGJ75010.1| putative integral membrane protein [Streptomyces sp. Tu6071]
          Length = 314

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 87/181 (48%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   LG S+ 
Sbjct: 134 KRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLALGRSID 193

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  + R +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+ +  E 
Sbjct: 194 EALDELSRRLPSRELVVLVTTLVLSNKAGGTVVGSLRNLTVTLEERKETRREVRTMLSEV 253

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R +   D
Sbjct: 254 NATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIRRLGRID 313

Query: 187 V 187
           V
Sbjct: 314 V 314


>gi|254245562|ref|ZP_04938883.1| type II secretion system protein [Burkholderia cenocepacia PC184]
 gi|124870338|gb|EAY62054.1| type II secretion system protein [Burkholderia cenocepacia PC184]
          Length = 204

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V      G+ 
Sbjct: 23  IQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQSALLTTEEPLRGCLDVVSRMLRGGIE 82

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 83  IDRAMMHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELTAMSS 142

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SA+++  LP  + + V  T+P Y+  +  DP G  LL +A    ++G
Sbjct: 143 ETRLSAFVLVMLPIAIGSFVVMTNPKYLYGMWGDPSGRSLLMIAFLAQVVG 193


>gi|91783014|ref|YP_558220.1| putative tight adherence TadB related transmembrane protein
           [Burkholderia xenovorans LB400]
 gi|91686968|gb|ABE30168.1| Putative tight adherence TadB related transmembrane protein
           [Burkholderia xenovorans LB400]
          Length = 359

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 83/181 (45%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V      G+ 
Sbjct: 177 VNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLRTGVE 236

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++S++     ++E+     V+ +  + GG     L  ++  +RD ++ + ++ A+S 
Sbjct: 237 IDRALSQVALIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELVAMSA 296

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A A  L G  ++  + N
Sbjct: 297 ETRLSSWVLAMLPVGIGGFLILSNPKYFASMWFDPTGRQLVYLAFALQLGGAYLLYRLAN 356

Query: 185 F 185
            
Sbjct: 357 L 357


>gi|296122065|ref|YP_003629843.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014405|gb|ADG67644.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 285

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 88/185 (47%), Gaps = 5/185 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + ++   R  + L   P  L+ + R+   G  V   + ++   +  P+  E +  +    
Sbjct: 97  LMYVRSSRQNQILGQLPAMLEELARAATTGRSVEQCLQLVAADTPSPLGDELQLCVRRMQ 156

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + ++++ +     L  +  F   + V  Q GG+L   L  LS+ +RDR     +++
Sbjct: 157 MGMPMRDAVADLPDRTGLMTLRLFCMTLGVHQQTGGDLVWVLEQLSKTIRDRLQYLGRLR 216

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFT--SPGYMNVLINDPRGHMLLGVAAAFMLIG-IM 177
           A++  ++A+A ++  LP  V  L++FT   P Y + L+    G     +A    +IG I 
Sbjct: 217 AMTAASRATALLMVVLPPGV--LIFFTLRDPDYFSKLMGSSWGRNGTIIAFTLTMIGTIW 274

Query: 178 VMRLM 182
           V+R++
Sbjct: 275 VLRIL 279


>gi|251791987|ref|YP_003006707.1| TadB [Aggregatibacter aphrophilus NJ8700]
 gi|247533374|gb|ACS96620.1| TadB [Aggregatibacter aphrophilus NJ8700]
          Length = 294

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 78/172 (45%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  +  +S  +R+   +       +S SR
Sbjct: 123 FPEVIQIMNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRLSIGEDPMAVFEDSYSR 182

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA+ SA 
Sbjct: 183 Y----PYKEFYFFITIVRTNLNKGGQIREVISRLGRLIADSNKMEKKKKAMTSEARMSAM 238

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+  LP      + F  P     LINDP G  +L       L G+ ++  ++
Sbjct: 239 IVACLPVGFFFFMQFAMPENFEFLINDPSGRYVLYYVFGSELFGMGIIWWLM 290


>gi|29829794|ref|NP_824428.1| hypothetical protein SAV_3252 [Streptomyces avermitilis MA-4680]
 gi|29606903|dbj|BAC70963.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 313

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 88/182 (48%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR   F+   P+   ++  +  AGL +  A+A+   +   P   E  RV +   LG S+
Sbjct: 132 QKRIEAFIGQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLTLGRSV 191

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG++  +L NL++ L DRK  + +V+ +  E
Sbjct: 192 DDALDELAERLPSRELIVLVTTLVLANKAGGSVVSSLRNLTQTLEDRKETRREVRTMLSE 251

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             A+A+ +  L      L+  ++ G +  +     G  L+ ++     +G  V+R +   
Sbjct: 252 VNATAFTVPLLGLGSLLLINSSNEGALARVTGSSLGQGLILLSLGLYTVGFFVIRRLGKI 311

Query: 186 DV 187
           +V
Sbjct: 312 EV 313


>gi|296130403|ref|YP_003637653.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
 gi|296022218|gb|ADG75454.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
          Length = 306

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 90/181 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R   F+   P    ++  +  AGL ++ A+A+   +   P   E  RV      G  L
Sbjct: 125 QRRNEAFIGQMPELARLLSNATSAGLSIASALALAANELDAPAGPEMARVASRMRFGEDL 184

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             +I  +   +P +EV+  ++ + V ++ GG+L  AL +++  L +RK ++ +V+ +  +
Sbjct: 185 DTAIGELTARLPSREVAVLASTLLVSARSGGSLVTALRDIADTLEERKEIRREVRTVLAQ 244

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           + ++ +++  + F +  L+    PG +  +  D  G   L V ++  + G +++R M  F
Sbjct: 245 STSTGYLVIGMGFALLFLLNIIRPGTVEAMTEDWLGRGALVVGSSLFVGGFLLIRRMTRF 304

Query: 186 D 186
           D
Sbjct: 305 D 305


>gi|114321308|ref|YP_742991.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227702|gb|ABI57501.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 294

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 86/179 (48%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R        P  ++ I+RS++AG  +S AVA    +   PV    +RV     +G SL
Sbjct: 114 QRRLRAMEAQLPGFVEHIIRSLQAGRTLSVAVAAATREMRPPVAEVMQRVQREVDMGASL 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           S+++        +  +   +  + +  + GG+  + +  +  +LR R+  + +++A++ E
Sbjct: 174 SDALQGAADIYRVDALQLVAIGVRINLRYGGSAIQLMEQVVTLLRQRERARRELKAMTGE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + SA ++  LP  V       +P Y   ++    G  LLG A A+ ++GI ++  M+ 
Sbjct: 234 TRISAGVLAILPVGVGGYTVMMNPDYYATMLESTVGVWLLGGAMAWQVLGIFLIWRMVK 292


>gi|163857688|ref|YP_001631986.1| putative Flp pilus assembly protein [Bordetella petrii DSM 12804]
 gi|163261416|emb|CAP43718.1| putative Flp pilus assembly protein [Bordetella petrii]
          Length = 307

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 73/169 (43%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +  D  P  LD +VR +  G  ++ A       +S+P+R    +          L 
Sbjct: 128 RRRGRMFDQLPEMLDTMVRLITIGNSMAAAFQAASANTSEPLREVVEKAAHLSRSTQELD 187

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            +++ + R    +E+   + V+ V  + GG     L  ++  +RD    + ++ A S E 
Sbjct: 188 AALANVARQYGFEELRLLAAVVRVAQKYGGRSDVVLERIAAFMRDVAQARGELVAASAEI 247

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + SAW++  +P  ++  +  T+      + +DP G  +L  A    L G
Sbjct: 248 RLSAWVLALMPLGIACYIMLTNNAMFMDMWDDPLGFKMLMAALGLQLAG 296


>gi|302536566|ref|ZP_07288908.1| integral membrane protein [Streptomyces sp. C]
 gi|302445461|gb|EFL17277.1| integral membrane protein [Streptomyces sp. C]
          Length = 312

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 87/181 (48%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +RT +F++  P    I+  + +AGL +  A+ +   +   P   E  RV +   +G S+ 
Sbjct: 132 RRTERFINQLPELARILANATQAGLALRTAIGIAAEELEAPAGEELSRVADRLAVGHSIE 191

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  +V  +P +E+    + + + ++ GG +  +L NL+  L  RK  + +++    + 
Sbjct: 192 EALGEIVERLPSRELVVLVSTLVLSARAGGAIVGSLRNLTVTLEQRKETRREIRTQLSQV 251

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             +A+++ ++      LV    PG ++ +     G   + +A     +G +++R +   D
Sbjct: 252 TVTAYLVPAIGLGSLLLVDLMMPGALDRMTGAWIGQTAVLIALGLFTLGFVLIRRLSKID 311

Query: 187 V 187
           V
Sbjct: 312 V 312


>gi|261867451|ref|YP_003255373.1| TadB [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412783|gb|ACX82154.1| TadB [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 295

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  +  +S  +R+   +       +S  R
Sbjct: 124 FPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPVSVFEDSYDR 183

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA+ SA 
Sbjct: 184 Y----PYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEARMSAI 239

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+   P      + F  P   + LINDP G  +L       L G+ ++  ++
Sbjct: 240 IVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLM 291


>gi|225181994|ref|ZP_03735426.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167279|gb|EEG76098.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 305

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++  + R A     FP+ LD++  SV AGL    A+A +V +S  PV  EFRRV++   
Sbjct: 148 LENTARSRKASIEKSFPDTLDLLTVSVGAGLGFDGALAKVVEKSEGPVAEEFRRVLQEIK 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G +  E++        + +V  F+  I    QLG N+ + L   S  +R ++  + + Q
Sbjct: 208 MGKARREALRDFGERTGIDDVKSFTGAIVQADQLGLNIGKTLKVQSEQMRRKRRQRVEEQ 267

Query: 121 ALSMEAK 127
           A+ +  K
Sbjct: 268 AMKVPVK 274


>gi|33593508|ref|NP_881152.1| hypothetical protein BP2525 [Bordetella pertussis Tohama I]
 gi|33572864|emb|CAE42798.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382916|gb|AEE67763.1| hypothetical protein BPTD_2483 [Bordetella pertussis CS]
          Length = 281

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 91/176 (51%), Gaps = 10/176 (5%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R  
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRA 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI-----GIMVMRLMINFDV 187
           P  +  ++    P  M  L      H L G AA  +++     GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALW-----HTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|33596529|ref|NP_884172.1| hypothetical protein BPP1911 [Bordetella parapertussis 12822]
 gi|33566298|emb|CAE37211.1| putative membrane protein [Bordetella parapertussis]
          Length = 281

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 91/176 (51%), Gaps = 10/176 (5%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R  
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRA 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI-----GIMVMRLMINFDV 187
           P  +  ++    P  M  L      H L G AA  +++     GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALW-----HTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|307133500|dbj|BAJ19012.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  +  +S  +R+   +       +S  R
Sbjct: 124 FPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPVSVFEDSYDR 183

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA+ SA 
Sbjct: 184 Y----PYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEARMSAI 239

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+   P      + F  P   + LINDP G  +L       L G+ ++  ++
Sbjct: 240 IVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLM 291


>gi|307548791|dbj|BAJ19113.1| TadB [Aggregatibacter actinomycetemcomitans]
 gi|307548806|dbj|BAJ19127.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  +  +S  +R+   +       +S  R
Sbjct: 124 FPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPVSVFEDSYDR 183

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA+ SA 
Sbjct: 184 Y----PYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEARMSAI 239

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+   P      + F  P   + LINDP G  +L       L G+ ++  ++
Sbjct: 240 IVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLM 291


>gi|156741692|ref|YP_001431821.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156233020|gb|ABU57803.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 318

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 2/149 (1%)

Query: 21  DIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQE 80
            ++  ++RAG+ +  A+  +  +  +P RSEFR+      LG +L  ++  M R +  ++
Sbjct: 154 QLLANALRAGMSIQQAIGEVSERVPEPARSEFRQTHHELLLGDNLPLALHDMRRRVCSRD 213

Query: 81  VSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCV 140
           +      I VQ Q GGNL   L  ++  L +R+ ++ ++ +L+ EA+ SA ++  LP   
Sbjct: 214 LDVLINAIVVQHQAGGNLVRVLNGMANTLNERQRLEREIDSLTSEARFSALVVMVLPIFF 273

Query: 141 STLVYFTSPGYMNVLINDPRGHMLLGVAA 169
             ++  T  G    L     G +LLGV A
Sbjct: 274 LLMIRDTPLG--EALFQTVIGWVLLGVFA 300


>gi|10334986|gb|AAD38173.2|AF152598_2 TadB [Aggregatibacter actinomycetemcomitans]
 gi|26000716|gb|AAN75212.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAV----IVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           FP  + I+  +  +G  +  A+      + GQ  +  +S  +R+   +       +S  R
Sbjct: 124 FPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPVSVFEDSYDR 183

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA+ SA 
Sbjct: 184 Y----PYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEARMSAI 239

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           I+   P      + F  P   + LINDP G  +L       L G+ ++  ++
Sbjct: 240 IVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLM 291


>gi|92113784|ref|YP_573712.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
 gi|91796874|gb|ABE59013.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
          Length = 291

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 84/170 (49%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P  L+  +R +  G     A    + +S+ P+R+   RV   + LGL L E + R  +
Sbjct: 120 QLPGYLEQFLRELAVGASPERAFQRQIARSAPPLRNMLERVWVRRELGLELHEGLVRESQ 179

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            + L E++  +T + V  + GG+L + L +   +LR ++  + +++AL+ E + +A ++ 
Sbjct: 180 LLKLSELALLATALEVNQRHGGSLRDILGSFVTLLRQQERGRRELKALTGETRFTAVVLA 239

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            +P  +   +  T+P +++ + +   G   L +A    L G  VM  M+ 
Sbjct: 240 VIPVLIGGYILLTNPEFLSTMWHSADGRAALWLALGLELSGCFVMWRMLK 289


>gi|59711124|ref|YP_203900.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
 gi|59479225|gb|AAW85012.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
          Length = 305

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 85/176 (48%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L +K   +F + FP+AL+++  +V AG  ++ A+A +  +    V  EF+ + E   LG 
Sbjct: 122 LQEKEKKQFNERFPDALNMLSSAVSAGESITHAIAFVGKKLEGDVGKEFKIMGERLQLGE 181

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S  E   +     P     FF   +      GG L + ++ L+R++ D + ++ K  AL+
Sbjct: 182 SPDEVFKKSCVRFPYPAFRFFVITLRANMNRGGQLRDVISRLNRLMFDARAVERKKYALT 241

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            EA+ SA I+ + PF    ++ F SP     ++    G  +L        IG++++
Sbjct: 242 SEARISAKIVCATPFFFLFILQFLSPENYEFVMFHAEGRPILYYVLISEAIGMLII 297


>gi|238762412|ref|ZP_04623383.1| Type II secretion system protein F domain protein [Yersinia
           kristensenii ATCC 33638]
 gi|238699397|gb|EEP92143.1| Type II secretion system protein F domain protein [Yersinia
           kristensenii ATCC 33638]
          Length = 284

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 79/178 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+    F  DFP AL +I  +  +G  ++  +     + S P+ +EF  +    ++G S 
Sbjct: 103 KRHHTLFKKDFPEALLMINMAASSGASINQVLERCGQEISGPLGNEFSLICRRLNVGESP 162

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                   +     E  F  T+  +  Q GG L E  + LS ++   K  + K   ++ +
Sbjct: 163 EAVFYDSYQRFKHPEFYFLITITLLNLQQGGQLRELTSRLSEVINKNKTTEQKKAVMTAQ 222

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + S  II  +P   S L+YF  P  +  + + P G M+        ++GI+++R M+
Sbjct: 223 VRMSVNIISIMPIAFSFLLYFLDPTTIESMWDHPIGRMIYYYIITSEIVGIVLIRKML 280


>gi|293391328|ref|ZP_06635662.1| Flp pilus assembly protein TadB [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|32452627|gb|AAP43989.1| TadB [Aggregatibacter actinomycetemcomitans]
 gi|290951862|gb|EFE01981.1| Flp pilus assembly protein TadB [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 295

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 4/144 (2%)

Query: 40  IVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLS 99
           + GQ     +S  RR+   +       +S  R     P +E  FF T+I      GG + 
Sbjct: 152 LTGQLGQEFKSIHRRLSIGEDPATVFDDSYDRY----PYKEFYFFITIIRNNLNKGGQIR 207

Query: 100 EALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           E ++ L R++ D   M+ K +A++ EA+ SA I+   P      + F  P   + L+NDP
Sbjct: 208 EVISRLGRVIADSNKMEKKKKAMTSEARMSAIIVACFPVGFFFFMQFAMPENFDFLVNDP 267

Query: 160 RGHMLLGVAAAFMLIGIMVMRLMI 183
            G  +L       L G+ ++  ++
Sbjct: 268 TGRYVLYYVFGSELFGMGIIWWLM 291


>gi|309778766|ref|ZP_07673539.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308922474|gb|EFP68098.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 308

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 85/183 (46%), Gaps = 5/183 (2%)

Query: 4   LIKKRTAK----FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ 59
           LI  RT K     L   P  LD +VR +  G  V  A       +  P+R+    + + Q
Sbjct: 122 LIWNRTRKINERLLAQLPGFLDGVVRLMSIGSAVPAAFQAASANTEQPLRNCLTAITQMQ 181

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G  L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++
Sbjct: 182 RAGKDLDAAVLTVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQREL 241

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMV 178
            ALS E + SAWIIG LP  V  ++   +  Y+  +  DP G  L+  A    ++G +M+
Sbjct: 242 FALSAETRLSAWIIGLLPVVVGGVIIMFNAAYIMSMWRDPFGKTLILTAFGMEVLGAVML 301

Query: 179 MRL 181
            RL
Sbjct: 302 ARL 304


>gi|238789151|ref|ZP_04632939.1| Type II secretion system protein F domain protein [Yersinia
           frederiksenii ATCC 33641]
 gi|238722683|gb|EEQ14335.1| Type II secretion system protein F domain protein [Yersinia
           frederiksenii ATCC 33641]
          Length = 187

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 78/178 (43%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+  + F  DFP  L +I  +  +G  ++  +     + S P+  E   +    +LG S 
Sbjct: 6   KRHHSLFKKDFPEVLLMINMASGSGASINHVLERCGQEVSGPLGHELVLICRRLNLGESP 65

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                   +     E  F  T+I +  Q GG L E  + LS+++   K  + K   L+ +
Sbjct: 66  ETVFYDAYQRFNYPEFYFLITIILLNIQQGGQLKELTSRLSQVISKNKTTEQKKSVLTAQ 125

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + S  II ++P   S L+YF     +  + ++P G M+         IGI V+R M+
Sbjct: 126 TRMSVNIISAMPVAFSLLLYFIDAKNIESMWDNPIGRMIFFYIITSEAIGIYVIRKML 183


>gi|197336186|ref|YP_002155273.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
 gi|197317676|gb|ACH67123.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
          Length = 305

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 85/176 (48%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++   +F + FP+AL+++  +V AG  ++ A+A +  +    V  EF+ + E   LG 
Sbjct: 122 LQEREKKQFNERFPDALNMLSSAVSAGESITHAIAFVGKKLEGDVGKEFKIMGERLQLGE 181

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S  E   +     P     FF   +      GG L + ++ L+R++ D + ++ K  AL+
Sbjct: 182 SPDEVFKKSCVRFPYPAFRFFVITLRANMNRGGQLRDVISRLNRLMFDARAVERKKYALT 241

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            EA+ SA I+ + PF    ++ F SP     ++    G  +L        IG++++
Sbjct: 242 SEARISAKIVCATPFFFLFILQFLSPENYEFVMFHTEGRPILYYVLISEAIGMLII 297


>gi|33600814|ref|NP_888374.1| hypothetical protein BB1829 [Bordetella bronchiseptica RB50]
 gi|33568414|emb|CAE32326.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 308

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 78/160 (48%), Gaps = 2/160 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  + +   P  LD +VR +  G  V+ A    +G    P+    +R       G  L 
Sbjct: 129 RRRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVRSGKDLD 188

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ ALS E 
Sbjct: 189 AALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELTALSAEV 248

Query: 127 KASAWIIGSLPFCVST-LVYFTSPGYMNVLINDPRGHMLL 165
           + SAWI+  LP  ++  ++ F +  +M  + +DP G  LL
Sbjct: 249 RLSAWILALLPIGLALFIIIFNNQLFMG-MWHDPMGFRLL 287


>gi|318604218|emb|CBY25716.1| flp pilus assembly protein TadB [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 293

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 83/181 (45%), Gaps = 1/181 (0%)

Query: 4   LIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L +KR  +F   +FP +L +I  +  +G  ++  +     + S P+  EF  V    ++G
Sbjct: 109 LSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLNVG 168

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S         R     E  F  T+I +  Q GG L E  + LS ++   K  + K   +
Sbjct: 169 ESPESVFYDSYRRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKAVM 228

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R M
Sbjct: 229 TAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIRKM 288

Query: 183 I 183
           +
Sbjct: 289 L 289


>gi|257790306|ref|YP_003180912.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325830204|ref|ZP_08163661.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
 gi|257474203|gb|ACV54523.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325487671|gb|EGC90109.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
          Length = 322

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  KR     +  P+AL  +    +AGL +      +  +   P+ + F R      
Sbjct: 135 LRTVQDKRRDALREGIPDALRSMAVCFQAGLSLLQTFQQVASEVQGPLGTLFARAAHQLE 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G     ++  + R   + E++F +  + VQ Q GG++ + L      ++    ++  ++
Sbjct: 195 TGEGAGRALEVLRRGSSVAELAFVAVALDVQHQAGGSMKQVLDAARDTVQSEIELRRALR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + +AK SA ++  LPF +  +    S G+++     P G  LL +A      GI+ +R
Sbjct: 255 VQTAQAKLSARVVSVLPFVLIAVFSLVSEGFLDPFFASPMGMALLAIALGMQAAGIVAVR 314

Query: 181 LMINFDV 187
            M+  +V
Sbjct: 315 RMLAVEV 321


>gi|167587312|ref|ZP_02379700.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 261

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 77/171 (45%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 80  IHRRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQAALLTTEAPLRGCLDVVSRMLRTGVE 139

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 140 IDRAMVHIAKVYHTREFELVGSVLRLSVRYGGRADVMLERMAVFMRDLEQAERELVAMSS 199

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           E + SAW++  LP  +   V  T+P Y++ + ND  G   L +A    + G
Sbjct: 200 ETRLSAWVLVMLPIAIGGFVIATNPSYLSSMWNDDSGRAYLYLAFIMQIAG 250


>gi|297202076|ref|ZP_06919473.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297148029|gb|EDY58318.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 314

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 83/182 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  +  AGL +  A+ +   +   P   E   V     +G+ +
Sbjct: 133 QKRIEKFINQLPELARILANATHAGLALRTAIGMAAEELEAPAGEELANVANQLAVGVPM 192

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  M + +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 193 EDALDEMAKRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 252

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   + +A A   +G +++R M   
Sbjct: 253 VNMTSYAVPVLGIGSLFLMNGVKDGALERMTGSPLGQGAVIIAFALYTVGFVLIRRMSRI 312

Query: 186 DV 187
           DV
Sbjct: 313 DV 314


>gi|317489755|ref|ZP_07948254.1| hypothetical protein HMPREF1023_01953 [Eggerthella sp. 1_3_56FAA]
 gi|316911101|gb|EFV32711.1| hypothetical protein HMPREF1023_01953 [Eggerthella sp. 1_3_56FAA]
          Length = 322

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  KR     +  P+AL  +    +AGL +      +  +   P+ + F R      
Sbjct: 135 LRTVQDKRRDALREGIPDALRSMAVCFQAGLSLLQTFQQVASEVQGPLGTLFARAAHQLE 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G     ++  + R   + E++F +  + VQ Q GG++ + L      ++    ++  ++
Sbjct: 195 TGEGAGRALEVLRRGSSVAELAFVAVALDVQHQAGGSMKQVLDAARDTVQSEIELRRALR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + +AK SA ++  LPF +  +    S G+++     P G  LL +A      GI+ +R
Sbjct: 255 VQTAQAKLSARVVSVLPFVLIAVFSLVSEGFLDPFFASPMGMALLAIALGMQAAGIVAVR 314

Query: 181 LMINFDV 187
            M+  +V
Sbjct: 315 RMLAVEV 321


>gi|294631143|ref|ZP_06709703.1| integral membrane protein [Streptomyces sp. e14]
 gi|292834476|gb|EFF92825.1| integral membrane protein [Streptomyces sp. e14]
          Length = 313

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 84/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  AV +   +   P   E  +V     LG S+
Sbjct: 132 QKRIEKFINQLPELARILANATQAGLALRTAVGMAAEELEAPAGEELGKVSHQLALGASM 191

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 192 DDALGELADRLPSRELVVLVTTLVLANRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 251

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   + VA A   +G +++R +   
Sbjct: 252 VNMTSYAVPVLGIGALFLMNGVKDGALERMTGSPIGQGAVIVAFALYAVGFVLIRRLSRI 311

Query: 186 DV 187
           DV
Sbjct: 312 DV 313


>gi|83747914|ref|ZP_00944946.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN: TadB2 [Ralstonia solanacearum
           UW551]
 gi|83725447|gb|EAP72593.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN: TadB2 [Ralstonia solanacearum
           UW551]
          Length = 308

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 83/177 (46%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G  L
Sbjct: 128 RRMKERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGKDL 187

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 188 DAAVLAVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALSAE 247

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +M+ RL
Sbjct: 248 TRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPAGKMLMMAAFGLEVMGSLMLARL 304


>gi|320008844|gb|ADW03694.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 311

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 85/181 (46%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT  F+   P    ++  +  AGL +  ++A+   +   P   E R V +   +G +L 
Sbjct: 131 KRTEAFISQLPEISRVLANATHAGLSLRTSIAMAADELESPAGDELRVVADQLGVGRTLD 190

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P +E+    + + + ++ GG +  +L NL+  L +RK  + +V+    + 
Sbjct: 191 DALGELAERLPSRELVVLVSTLILSNRAGGQVVSSLRNLTVTLEERKETRREVRTQLSQI 250

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            A+A+ + ++      LV    PG ++ +     G + + V+     +G + +R +   D
Sbjct: 251 NATAYAVPAIGIGAMLLVNSILPGALDRMTGSVVGQIAVIVSLGLYALGFVAIRRVSKID 310

Query: 187 V 187
           +
Sbjct: 311 I 311


>gi|256827716|ref|YP_003151675.1| Flp pilus assembly protein TadB [Cryptobacterium curtum DSM 15641]
 gi|256583859|gb|ACU94993.1| Flp pilus assembly protein TadB [Cryptobacterium curtum DSM 15641]
          Length = 321

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 92/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H I++R     +  P+A+  I   + AGL      + +  +S  P++  F RV +    G
Sbjct: 136 HAIERREDALREALPDAVWSIGICLHAGLSQQQTFSRLEEESHGPLKEVFSRVSQALAAG 195

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L E+++ +     ++E++F +T + +Q Q GG++ + L     +L    N++  +   
Sbjct: 196 SPLDEALALLKGDGSIRELTFVATALEIQHQAGGSMKQVLETAGEMLAHETNLRRSLAVN 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + +A+ SA ++ ++   ++ ++   S G++    +   G ++L VA +  + GIM +R +
Sbjct: 256 TAQARLSARVVVAVTVLLAGVLSVLSDGFLETFFSSTEGIIMLAVALSMQVGGIMAVRKI 315

Query: 183 IN 184
           ++
Sbjct: 316 LS 317


>gi|207739455|ref|YP_002257848.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
 gi|206592831|emb|CAQ59737.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
          Length = 319

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 83/177 (46%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G  L
Sbjct: 139 RRMKERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGKDL 198

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 199 DAAVLAVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALSAE 258

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +M+ RL
Sbjct: 259 TRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPAGKMLMMAAFGLEVMGSLMLARL 315


>gi|33593027|ref|NP_880671.1| hypothetical protein BP1999 [Bordetella pertussis Tohama I]
 gi|33563402|emb|CAE42279.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382439|gb|AEE67286.1| hypothetical protein BPTD_1969 [Bordetella pertussis CS]
          Length = 306

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 80/165 (48%), Gaps = 3/165 (1%)

Query: 3   HL-IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           HL +K    + +   P  LD +VR +  G  V+ A    +G    P+    +R       
Sbjct: 122 HLWLKADRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVRS 181

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L  ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ A
Sbjct: 182 GKDLDAALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELTA 241

Query: 122 LSMEAKASAWIIGSLPFCVST-LVYFTSPGYMNVLINDPRGHMLL 165
           LS E + SAWI+  LP  ++  ++ F +  +M  + +DP G  LL
Sbjct: 242 LSAEVRLSAWILALLPIGLALFIIIFNNQLFMG-MWHDPMGFRLL 285


>gi|182436319|ref|YP_001824038.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776949|ref|ZP_08236214.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464835|dbj|BAG19355.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657282|gb|EGE42128.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 314

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 85/181 (46%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT +F++  P    I+  + +AGL +  ++++   +  DP   E  RV     +G  L 
Sbjct: 134 KRTERFINQLPELSRILANATQAGLALRTSLSMAAEELEDPAGEELARVARRLAVGEPLE 193

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++S +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+    + 
Sbjct: 194 DALSELTDRLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTETLEERKETRREVKTQLSQV 253

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             +A+ +         L+    PG ++ +     G + + V+     IG +V+R     D
Sbjct: 254 TVTAYAVPLFGIGAMLLMNAVMPGALDRMTGAFFGQVAVVVSIVLYAIGFVVIRRFSRID 313

Query: 187 V 187
           V
Sbjct: 314 V 314


>gi|33596972|ref|NP_884615.1| hypothetical protein BPP2379 [Bordetella parapertussis 12822]
 gi|33566423|emb|CAE37676.1| putative membrane protein [Bordetella parapertussis]
          Length = 306

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 80/165 (48%), Gaps = 3/165 (1%)

Query: 3   HL-IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           HL +K    + +   P  LD +VR +  G  V+ A    +G    P+    +R       
Sbjct: 122 HLWLKADRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVRS 181

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L  ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ A
Sbjct: 182 GKDLDAALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELTA 241

Query: 122 LSMEAKASAWIIGSLPFCVST-LVYFTSPGYMNVLINDPRGHMLL 165
           LS E + SAWI+  LP  ++  ++ F +  +M  + +DP G  LL
Sbjct: 242 LSAEVRLSAWILALLPIGLALFIIIFNNQLFMG-MWHDPMGFRLL 285


>gi|300697739|ref|YP_003748400.1| type II secretion system protein [Ralstonia solanacearum CFBP2957]
 gi|299074463|emb|CBJ54013.1| Type II secretion system protein [Ralstonia solanacearum CFBP2957]
          Length = 318

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 83/177 (46%), Gaps = 1/177 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G  L
Sbjct: 138 RRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGKDL 197

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS E
Sbjct: 198 DAAVLAVGQLYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALSAE 257

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRL 181
            + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +M+ RL
Sbjct: 258 TRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPVGKMLMMAAFGLEVMGSLMLARL 314


>gi|222834143|gb|EEE72620.1| predicted protein [Populus trichocarpa]
          Length = 194

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 61/107 (57%), Gaps = 3/107 (2%)

Query: 3   HLIKKRTAKFLD---DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ 59
           H+++ RT +        P+A+D+I R++RAG   + A+ ++  +   P+  EFR   E  
Sbjct: 69  HVMRLRTKRLKQMEVQLPDAVDMISRALRAGHSFAGALGMVGQEIKAPLGPEFRTTFEEI 128

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLS 106
           + G++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  + 
Sbjct: 129 NYGVALDEAMTNLAMRVPVGDLRYFVIAVLIQRESGGNLAEILDTIG 175


>gi|21223383|ref|NP_629162.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|8218172|emb|CAB92603.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 316

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 84/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   +G S+
Sbjct: 135 QKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELGKVADQLAIGASM 194

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 195 DDALGELAGRLPSRELVVLVTTLVLSNRAGGQVVGALRNLTETLEERKETRREVRTQLSQ 254

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   +  A A   +G +++R +   
Sbjct: 255 VTMTSYAVPVLGIGSLLLMNGVKDGALERMTGSPAGQAAVITAFALYAVGFVLIRRLSRI 314

Query: 186 DV 187
           DV
Sbjct: 315 DV 316


>gi|238750901|ref|ZP_04612398.1| Type II secretion system protein F domain protein [Yersinia rohdei
           ATCC 43380]
 gi|238710815|gb|EEQ03036.1| Type II secretion system protein F domain protein [Yersinia rohdei
           ATCC 43380]
          Length = 272

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 68/158 (43%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KK  + F  DFP  L +I  +  +G  ++  +     + + P+ SE R +    +LG S 
Sbjct: 91  KKHYSLFKQDFPEVLLMINMASSSGASINQVLERCGQEITGPLGSELRLICRRLNLGESP 150

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                   +     E  F  T+I +  Q GG L +    LS+I+   K  + K   ++ E
Sbjct: 151 ESVFHDAYQRFNFPEFYFLITIILLNLQQGGQLKDLTNRLSQIISKNKTAEQKKATMTAE 210

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
            + S  II  +P   S L+YF     +  + N P G +
Sbjct: 211 TRMSVNIISVMPIAFSLLLYFIDSTSIESMWNHPTGKL 248


>gi|332162958|ref|YP_004299535.1| type II secretion system protein F domain protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667188|gb|ADZ43832.1| Type II secretion system protein F domain protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 223

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 1/181 (0%)

Query: 4   LIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L +KR  +F   +FP +L +I  +  +G  ++  +     + S P+  EF  V    ++G
Sbjct: 39  LSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLNVG 98

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K   +
Sbjct: 99  ESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKAVM 158

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R M
Sbjct: 159 TAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIRKM 218

Query: 183 I 183
           +
Sbjct: 219 L 219


>gi|256785514|ref|ZP_05523945.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289769410|ref|ZP_06528788.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289699609|gb|EFD67038.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 316

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 84/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   +G S+
Sbjct: 135 QKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELGKVADQLAIGASM 194

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 195 DDALGELAGRLPSRELVVLVTTLVLSNRAGGQVVGALRNLTETLEERKETRREVRTQLSQ 254

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   +  A A   +G +++R +   
Sbjct: 255 VTMTSYAVPVLGIGSLLLMNGVKDGALERMTGSPAGQAAVITAFALYAVGFVLIRRLSRI 314

Query: 186 DV 187
           DV
Sbjct: 315 DV 316


>gi|330862290|emb|CBX72451.1| hypothetical protein YEW_HH31830 [Yersinia enterocolitica W22703]
          Length = 293

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 1/181 (0%)

Query: 4   LIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L +KR  +F   +FP +L +I  +  +G  ++  +     + S P+  EF  V    ++G
Sbjct: 109 LSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLNVG 168

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K   +
Sbjct: 169 ESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKAVM 228

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R M
Sbjct: 229 TAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIRKM 288

Query: 183 I 183
           +
Sbjct: 289 L 289


>gi|297568750|ref|YP_003690094.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924665|gb|ADH85475.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 305

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 85/174 (48%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R    +   P  +D ++R+V AG  +  A+      S  P+     +V     LG  +
Sbjct: 125 QRRRRLMVAQIPTFIDQLLRAVAAGHTLDAALLTATADSRLPLGEVLEQVTREIKLGGEI 184

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++S  +R   L+E+   +  I V  + G ++ E L +L  +++  +  + + +AL+ E
Sbjct: 185 DTALSEAIRLYDLEELRLLALAIRVNRRYGSSIQELLRSLVTLIQQEETSRQEFRALTGE 244

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           ++ +AW++G +P  +   +  T+P Y   L +DP G  +L +A      G++ +
Sbjct: 245 SRLTAWVLGLMPLLLVGFLLLTNPEYPAHLWHDPAGRTILLIALLLQSGGVLAL 298


>gi|302542848|ref|ZP_07295190.1| putative integral membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302460466|gb|EFL23559.1| putative integral membrane protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 312

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 86/182 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +F++  P    I+  + +AGL +  A+++   +   P   E  +V     +G S+
Sbjct: 131 QKRIERFINQLPELSRILANATQAGLALRTALSMAADEMEAPAGEELSKVSAKLAVGHSV 190

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+    +
Sbjct: 191 DDALGELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTHTLEERKETRREVRTQLSQ 250

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +A+++  +      L+   SPG ++ +     G   +  A A   IG  ++R M   
Sbjct: 251 VTVTAYVVPLMGIGTLLLMNRISPGSLDRMTASIWGQAAVIAAFALYGIGFFLIRRMSKI 310

Query: 186 DV 187
           DV
Sbjct: 311 DV 312


>gi|284029667|ref|YP_003379598.1| type II secretion system protein [Kribbella flavida DSM 17836]
 gi|283808960|gb|ADB30799.1| type II secretion system protein [Kribbella flavida DSM 17836]
          Length = 286

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 92/181 (50%), Gaps = 5/181 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   +KR A+F + +P+ +D I  +VRAGL +S+A+A +  +   P+R  FRR      
Sbjct: 95  LKSRARKRLAEFRELWPDVVDNIASAVRAGLSLSEALAQVGERGPLPLREPFRRFGADYA 154

Query: 61  LGLSLSESISRMVRYM--PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
                +ES+ R+   +  P+ +    +  I+ +   GG+L   L +LS  LRD    +++
Sbjct: 155 STGRFAESLDRLKARLADPVGDRVVEALRIAREVG-GGDLGRLLRSLSSFLRDDARTRSE 213

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +++    +   A +  + P+ V  L+ F   G +    N P G +++G+ AA  ++   V
Sbjct: 214 LESRQSWSVNGARVAVAAPWLVLGLLSFQ--GDVIQRYNSPVGALVIGIGAAVCVLAYRV 271

Query: 179 M 179
           M
Sbjct: 272 M 272


>gi|239943898|ref|ZP_04695835.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           15998]
 gi|239990352|ref|ZP_04711016.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           11379]
 gi|291447361|ref|ZP_06586751.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291350308|gb|EFE77212.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 314

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 85/181 (46%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT +F++  P    I+  + +AGL +  ++++   +  +P   E  RV     +G  L 
Sbjct: 134 KRTERFINQLPELSRILANATQAGLALRTSLSMAAEELENPAGEELARVARRLAVGEPLE 193

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++S +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+    + 
Sbjct: 194 DALSELTDRLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTETLEERKETRREVKTQLSQV 253

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             +A+ +         L+    PG ++ +     G   + VA     IG +V+R +   D
Sbjct: 254 TVTAYAVPIFGVGAMLLMNAVMPGALDRMTGAFIGQAAVVVAIVLYAIGFVVIRRLSRID 313

Query: 187 V 187
           V
Sbjct: 314 V 314


>gi|238793625|ref|ZP_04637248.1| Type II secretion system protein F domain protein [Yersinia
           intermedia ATCC 29909]
 gi|238727040|gb|EEQ18571.1| Type II secretion system protein F domain protein [Yersinia
           intermedia ATCC 29909]
          Length = 293

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 76/178 (42%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K     F  DFP  L +I  +  +G  ++  +     +   P+  E   +    ++G S 
Sbjct: 112 KNNHTIFKRDFPEVLLMINMAASSGTSINQVLERCGKEVGGPLGDELSLICRRLNVGESP 171

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                   +     E  F  T+I +  Q GG L E  + LS+++   K  + K   ++ +
Sbjct: 172 ETVFYDAYQRFHYPEFYFLITIILLNLQQGGQLRELTSRLSQVITKNKTSEQKKAVMTAQ 231

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + S  I+  +PF  S  +YF  P  +  + N P G ++     +  +IGI ++R M+
Sbjct: 232 TRMSVNILSIIPFVFSLFLYFMDPTAIESMWNHPTGRIIYYYIISSEIIGIALIRSML 289


>gi|153811266|ref|ZP_01963934.1| hypothetical protein RUMOBE_01658 [Ruminococcus obeum ATCC 29174]
 gi|149832764|gb|EDM87848.1| hypothetical protein RUMOBE_01658 [Ruminococcus obeum ATCC 29174]
          Length = 247

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 95/186 (51%), Gaps = 15/186 (8%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAV-------IVGQSSDPVRSEFRR 54
           K LI++R  K    F +AL+ +  +V+AG  V +AVA        +  + +D V+ EF  
Sbjct: 56  KGLIRERKRKLNYQFKDALNALSVAVQAGYSVENAVAACSRDLERLYPKETDIVK-EFH- 113

Query: 55  VIETQ-HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
            IETQ  + + + E +  +     +++V  F+ V     + GG+++  +   +R+L D+ 
Sbjct: 114 YIETQLRVSVPVEELLLSLGDRSGIEDVENFAAVFYTAKRTGGDMNRIIQTSARMLGDKI 173

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           +++ +++      KA   I+  +P  +   +  TSPG+++VL  +     L G+ A  + 
Sbjct: 174 DVRKEIETTLAAKKAEQMIMSLMPAGIILYLKLTSPGFLSVLYGN-----LFGMCAMTLC 228

Query: 174 IGIMVM 179
           +GI V+
Sbjct: 229 LGIYVL 234


>gi|297157607|gb|ADI07319.1| putative integral membrane protein [Streptomyces bingchenggensis
           BCW-1]
          Length = 312

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 87/182 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF+   P    I+  + +AGL +  A+ +   +   P   E  +V +   +G S+
Sbjct: 131 QKRIEKFISQLPELSRILANATQAGLALRTALGMAADEMEAPAGEELAKVADKLAVGHSI 190

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V+    +
Sbjct: 191 DDALGELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTQTLEERKETRREVRTQLSQ 250

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +A+++  +      L+   + G ++ + +   G   + VA A   +G  ++R M   
Sbjct: 251 VTVTAYVVPLMGIGTLLLMNRIATGSLDRMTSSFWGQAAVVVAFALYGVGFFLIRRMSKI 310

Query: 186 DV 187
           DV
Sbjct: 311 DV 312


>gi|123443824|ref|YP_001007795.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090785|emb|CAL13667.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 280

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 1/181 (0%)

Query: 4   LIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           L +KR  +F   +FP +L +I  +  +G  ++  +     + S P+  EF  V    ++G
Sbjct: 96  LSRKRYHRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGIEFNLVCRRLNVG 155

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K   +
Sbjct: 156 ESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKAVM 215

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + + S  II  +P   S L+YF  P  +  + + P G ++        LIG++V+R M
Sbjct: 216 TAQIRMSVNIISIMPIAFSLLLYFLDPITIESMWHHPIGKIVYYYIITSELIGMIVIRKM 275

Query: 183 I 183
           +
Sbjct: 276 L 276


>gi|257064724|ref|YP_003144396.1| Flp pilus assembly protein TadB [Slackia heliotrinireducens DSM
           20476]
 gi|256792377|gb|ACV23047.1| Flp pilus assembly protein TadB [Slackia heliotrinireducens DSM
           20476]
          Length = 332

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 8/189 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +   +  +  P+AL  +    +AGL +    A    ++  P+   F +V     LG
Sbjct: 147 HAADEEQNRLRELVPDALRCMESCFQAGLSLPQTFAETARETEPPLSQTFAQVSHDIELG 206

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN----MKAK 118
            S+ E++ R      L E++F +  + VQ   GG+ +  L    RI +D  +    ++  
Sbjct: 207 HSVDEALDRFRLGSGLPELAFVAVALDVQYVSGGDATSVL----RIAQDSVDHALELRRT 262

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++  + +AK SA I+ ++P  +  ++   SP + N       G  LL +AA+ +  GI++
Sbjct: 263 LRVQTAQAKLSAQIVSAMPLVLVGVLSLVSPHFFNPFFETGTGLALLAMAASMLAGGILI 322

Query: 179 MRLMINFDV 187
           +R M+  D+
Sbjct: 323 VRRMLAVDL 331


>gi|198284410|ref|YP_002220731.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666085|ref|YP_002427078.1| tight adherence protein TadB, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248931|gb|ACH84524.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518298|gb|ACK78884.1| tight adherence protein TadB, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 313

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 83/176 (47%), Gaps = 1/176 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R+A  L   P  LD +VR+ R G  +  A+      +  PVR  F +++  Q  G  + 
Sbjct: 135 RRSAAILA-LPGFLDAVVRASRVGASLPAALLSATKDAHGPVREVFNQIMRRQQSGTPID 193

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  + +   +QE++  +TV+ +  + GG     L  ++  LR R   +A+  ALS E 
Sbjct: 194 QAMLTVGKRYQMQELAIIATVLRLNMRYGGRTDVVLERIADWLRGRVMAQAEFNALSAET 253

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           +  A I+  +   ++  +   +  Y+  +     G MLL      ++ G++++  M
Sbjct: 254 RLGALILSLMIPGLALYIVLMNHSYLQGMWAVSTGRMLLVAGGTLLVTGVVLLNRM 309


>gi|254381955|ref|ZP_04997318.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194340863|gb|EDX21829.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 312

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 84/181 (46%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +F++  P    I+  + +AGL +  A+ +   +   P   E  RV +   +G S+ 
Sbjct: 132 RRNERFINQLPELARILANATQAGLALRTAIGMAADELEAPAGEELARVADRLAIGHSIE 191

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           ES+  +   +P +E+    + + + ++ GG +  +L NL+  L  RK  + +++    + 
Sbjct: 192 ESLGEITERLPSRELVVLVSTLVLSARAGGAIVGSLRNLTVTLEQRKETRREIRTQLSQV 251

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             +A+++  +      LV    PG ++ +     G   + VA     +G +++R +   D
Sbjct: 252 TVTAYLVPVMGLGSLLLVDAMMPGALDRMTGAVIGQTAVLVAIGLFTLGFVLIRRLSKID 311

Query: 187 V 187
           V
Sbjct: 312 V 312


>gi|283787696|ref|YP_003367561.1| tight adherence protein B [Citrobacter rodentium ICC168]
 gi|282951150|emb|CBG90841.1| putative tight adherence protein B [Citrobacter rodentium ICC168]
          Length = 300

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 87/184 (47%), Gaps = 2/184 (1%)

Query: 3   HLIKKRTAK--FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +L  K+ A+  F   F  AL+II  +V AG  +   +     + S  V  EF  + +   
Sbjct: 115 YLQSKKLARQAFETGFAEALNIIGGAVGAGNSLLHGIEQSGQKVSGIVGEEFTIISQRLE 174

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  +          +  +E  FF   + +  + GG + E +++L++++ + + M  +  
Sbjct: 175 IGEDVESVFMDSYERLFYREYFFFVIAVLINMRGGGEVKEIVSHLAKLISNARLMDRQKL 234

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + E +AS  I+  +P      + F SP   +VL++DP G MLL    A  L+G+  + 
Sbjct: 235 AKTAEPRASIKILMVIPVGFFFFLKFLSPENFDVLLHDPTGQMLLYYCIASELLGLFWVW 294

Query: 181 LMIN 184
            MIN
Sbjct: 295 TMIN 298


>gi|302558696|ref|ZP_07311038.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302476314|gb|EFL39407.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 314

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 84/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +F++  P    I+  + +AGL +  AV +   +   P   E  +V     +G S+
Sbjct: 133 QKRIERFINQLPELARILANATQAGLALRTAVGMAAEEMEAPAGEELAKVANQLAVGASM 192

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 193 DDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 252

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G ++ +   P G   + +A     +G +++R +   
Sbjct: 253 VSMTSYAVPVLGVGSLFLMNGVKDGALDRMTGSPAGQAAVIIAFGLYAVGFVLIRRLSRI 312

Query: 186 DV 187
           DV
Sbjct: 313 DV 314


>gi|303241928|ref|ZP_07328421.1| Flp pilus assembly protein TadB-like protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590483|gb|EFL60238.1| Flp pilus assembly protein TadB-like protein [Acetivibrio
           cellulolyticus CD2]
          Length = 305

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 1/185 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K  I KR     +     LD +     AG  +  A+   + +S DP++S   +V     
Sbjct: 112 LKQRISKRKDLMTEQLIEWLDYMSSMGTAGKALLTALDYSIEKSRDPLKSVLEKVSANIK 171

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKV 119
              SLSE+   + + +P+ E    S  ISV S++          N+S  +++  ++   +
Sbjct: 172 KSQSLSEAFENVTKQIPIPEFKMVSMAISVHSEITNEGWPRTFENISSQMKENGDLFNTI 231

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A + E+K +++IIG +P  +  ++    P Y+   +  P G +   +A    L G+ ++
Sbjct: 232 DASNTESKINSYIIGLMPLAMFIVIRLMQPEYVANSLESPIGKISYVIAGLLSLSGMYLV 291

Query: 180 RLMIN 184
           R + N
Sbjct: 292 RRISN 296


>gi|302384577|ref|YP_003820399.1| Type II secretion system F domain protein [Clostridium
           saccharolyticum WM1]
 gi|302195205|gb|ADL02776.1| Type II secretion system F domain protein [Clostridium
           saccharolyticum WM1]
          Length = 245

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 89/191 (46%), Gaps = 6/191 (3%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA------VIVGQSSDPVRSEFRRVI 56
            L KKR  +   +F   + ++   + AG  V +A +      VI+      V  EF  ++
Sbjct: 55  ELKKKRLQQLNLEFKEGILLLASFLSAGYSVENAFSASVKELVILYGEEGMVSMEFGHIV 114

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
               +  S+ +++S       L +V  F+ V +   + GG L   +++ + ++RD+  ++
Sbjct: 115 SQIRINRSVEQALSEFAGRSGLDDVKNFAEVFAAAKRSGGELVSIISHTAAVIRDKMQVR 174

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            ++  ++   +    I+  +PF +   +  TSPG+ N++ N   G +L+ +  A  +  I
Sbjct: 175 QEILTMTASKQFEQKIMTMIPFFIVLYIDMTSPGFFNIMYNTGIGRILMTLCLAVYIGAI 234

Query: 177 MVMRLMINFDV 187
            + R ++  ++
Sbjct: 235 AIARHIMKIEI 245


>gi|32477852|ref|NP_870846.1| protein secretion system or pilus assembly related protein TadB
           [Rhodopirellula baltica SH 1]
 gi|32448409|emb|CAD77924.1| probable protein secretion system or pilus assembly related protein
           TadB [Rhodopirellula baltica SH 1]
          Length = 297

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 68/136 (50%)

Query: 44  SSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALA 103
           ++ P+R +    +    LG S S     + R MP+  +  FST +SV  + GG+L+  LA
Sbjct: 154 TASPLRDQIHWCVRRIQLGDSGSSVFRELARRMPIDAMELFSTTMSVHWETGGSLAPVLA 213

Query: 104 NLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           +++R+ RDR+ +  ++++   +++ S   +  L + V+ +++   P +M    +   G  
Sbjct: 214 SVARVARDRQEVARRIRSNIAQSQFSTIAVLLLIYFVALVLWLDRPEWMKEFASSSLGSA 273

Query: 164 LLGVAAAFMLIGIMVM 179
            +        +GI+ M
Sbjct: 274 AIAATIVLQAVGIIWM 289


>gi|257139286|ref|ZP_05587548.1| hypothetical protein BthaA_08789 [Burkholderia thailandensis E264]
          Length = 301

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 70/147 (47%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V      G+ 
Sbjct: 155 MQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLRSGVE 214

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+S 
Sbjct: 215 IDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELVAMSA 274

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGY 151
           E + SAW++G+LP  + + V  T+P Y
Sbjct: 275 ETRLSAWVLGALPVGIGSFVIATNPKY 301


>gi|328884728|emb|CCA57967.1| putative integral membrane protein [Streptomyces venezuelae ATCC
           10712]
          Length = 315

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 84/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+++   +   P   E  +V +   +G SL
Sbjct: 134 QKRIEKFINQLPELSRILANATQAGLALRMALSLAADEMEAPAGDELEKVAQQLAVGTSL 193

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+    +
Sbjct: 194 DDALGELAERLPSRELVVLVTTLVLANRAGGTVVSSLRNLTETLEERKETRREVRTQLSQ 253

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +A+ +  +      L+    PG ++ +     G   +  A    ++G + +R     
Sbjct: 254 VSMTAYSVPVIGVGSLLLIDNMQPGALDRMTGSGLGQFAVVAAFGLYVVGFIAIRRFSKI 313

Query: 186 DV 187
           DV
Sbjct: 314 DV 315


>gi|239929199|ref|ZP_04686152.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 314

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 83/182 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V     +G S+
Sbjct: 133 QKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELSKVANQLAVGASM 192

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 193 DDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 252

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   + +A     +G +++R +   
Sbjct: 253 VSMTSYAVPVLGVGSLFLMNGVKDGALERMTGSPVGQAAVIIAFGLYAVGFVLIRRLSRI 312

Query: 186 DV 187
           DV
Sbjct: 313 DV 314


>gi|291437533|ref|ZP_06576923.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340428|gb|EFE67384.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 312

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 83/182 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V     +G S+
Sbjct: 131 QKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELSKVANQLAVGASM 190

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 191 DDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 250

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G +  +   P G   + +A     +G +++R +   
Sbjct: 251 VSMTSYAVPVLGVGSLFLMNGVKDGALERMTGSPVGQAAVIIAFGLYAVGFVLIRRLSRI 310

Query: 186 DV 187
           DV
Sbjct: 311 DV 312


>gi|187479015|ref|YP_787039.1| type IV pilus assembly protein [Bordetella avium 197N]
 gi|115423601|emb|CAJ50139.1| putative type IV pilus assembly protein [Bordetella avium 197N]
          Length = 305

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 82/174 (47%), Gaps = 2/174 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  + +   P+ +D +VR +  G  V+ A    +    DP+    +R       G  L 
Sbjct: 126 ERRQRMIKQLPDFIDGVVRLITIGNSVNAAFQGAMTSIDDPLLEVLQRAEALMRSGKDLD 185

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ ++ R   LQE+   S+VIS+  + GG     L  ++  +RD +  + ++ ALS E 
Sbjct: 186 SALLKVSRQYGLQELYLVSSVISLALRFGGRSDLVLERMAAFMRDLELAREELIALSAEV 245

Query: 127 KASAWIIGSLPFCVST-LVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           + S WI+  LP  +   ++ F +  +M  +  DP G  +L   A   ++G  ++
Sbjct: 246 RMSVWILSLLPIGLGLFIIVFNNDLFMG-MWRDPLGFKMLIGGAMLQVVGTYLL 298


>gi|238782878|ref|ZP_04626907.1| Type II secretion system protein F domain protein [Yersinia
           bercovieri ATCC 43970]
 gi|238716301|gb|EEQ08284.1| Type II secretion system protein F domain protein [Yersinia
           bercovieri ATCC 43970]
          Length = 181

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 74/174 (42%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
           A F  DFP  + +I  +  +G  ++  +     + + P+  E   +    +LG S     
Sbjct: 4   AIFHQDFPEVILMITMAASSGASINQILERCGYEINGPLGDELTLICRKLNLGESPETVF 63

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
               +     E  F  T+I +  Q GG L E    LS ++   K  + K   ++ + + S
Sbjct: 64  YDAYQRFHYPEFYFLITIILLNLQQGGQLRELTNRLSSVIAKNKTSEQKKAVMTAQTRMS 123

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
             II  +P   S L+YF  P  +  + N   G ++     A  LIG+ ++R M+
Sbjct: 124 VNIISLMPLAFSLLLYFIDPTTIESMWNHSIGKLIFYYIIASELIGLALIRKML 177


>gi|332970973|gb|EGK09947.1| integral membrane protein [Desmospora sp. 8437]
          Length = 315

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 85/159 (53%), Gaps = 1/159 (0%)

Query: 29  AGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVI 88
           AGL +   + ++V +   PV+ E  RV+    LG  L  +++ ++  +  Q++  F   +
Sbjct: 158 AGLSIPQGLRLVVQEMPAPVKIELGRVVREIELGRDLEGALNDLLERIHTQDMKVFINAL 217

Query: 89  SVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTS 148
            +Q + GG+L++ ++ ++  + +RK +   ++A++ +A+ SA+ +  +   ++ ++    
Sbjct: 218 IIQRRAGGDLAKVMSQMAATMEERKIIHQTIKAVTSQARTSAYALPIISLLIAFMLSKMI 277

Query: 149 PGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            G+ ++    P G ++L +     ++G++++R   N  V
Sbjct: 278 DGFYDLFTTLP-GMIVLALFVGLQVLGVVLVRKFSNIRV 315


>gi|307332438|ref|ZP_07611502.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306881907|gb|EFN13029.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 312

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 86/182 (47%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +F++  P    I+  + +AGL +  A+ +   +   P   E  +V     +G S+
Sbjct: 131 QKRIERFINQLPELSRILANATQAGLALRTALGMAADEMEAPAGEELAKVAAKLAVGHSI 190

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V+    +
Sbjct: 191 DDALEELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTQTLEERKETRREVRTQLSQ 250

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +A+++  L      L+   + G ++ + +   G   + VA     IG  ++R M   
Sbjct: 251 VTVTAYVVPLLGIGTLLLMNRIAAGSLDRMTSSFWGQAAVVVAFCLYGIGFFLIRRMSKI 310

Query: 186 DV 187
           DV
Sbjct: 311 DV 312


>gi|315650391|ref|ZP_07903462.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315487318|gb|EFU77629.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 269

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/192 (18%), Positives = 89/192 (46%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRRV 55
           K LI ++  + L +F  A+ I+   + AG  + ++V   + +        + +  EF  +
Sbjct: 78  KELIVEKKRRLLIEFKEAVMILSSLLNAGYSLENSVKEALVELRLLYVKDNLIIKEFEYI 137

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +  ++ +S+  +   +      +++  F+ V+ +  + GG L   +A+   ++ D+  +
Sbjct: 138 CQLIYMNISVERAFDDLAYRSHCEDIRSFAKVLRIAKRSGGELESIIAHTVSVIGDKVRI 197

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  ++   +    ++  LP  +   + F+SPG+ N++     G M + V     L  
Sbjct: 198 KEEIITMTAAKRFEQKVMNILPLLIVLYIDFSSPGFFNIMYTTIIGRMCMSVGLTVYLFA 257

Query: 176 IMVMRLMINFDV 187
           I + + ++N +V
Sbjct: 258 IYISKRLLNIEV 269


>gi|33152382|ref|NP_873735.1| tight adherence protein B [Haemophilus ducreyi 35000HP]
 gi|21326711|gb|AAL92471.1| TadB [Haemophilus ducreyi]
 gi|33148605|gb|AAP96124.1| tight adherence protein B [Haemophilus ducreyi 35000HP]
          Length = 295

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 81/183 (44%), Gaps = 9/183 (4%)

Query: 6   KKRTAKFLDD-FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF----RRVIETQH 60
           ++R  K  D+ FP  + I+  +  +G+ +  A+         P+  EF    +R+   + 
Sbjct: 113 QRRNKKMFDETFPEVIQILNAATSSGVSLLQAMERCGKDIRGPLGQEFTLIYKRLARGED 172

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
                 +S SR     P +   FF  +I      GG + E ++ L R + D   M+ K +
Sbjct: 173 AMAVFQDSYSRY----PYKSFYFFICIIRTNLSRGGQIREVVSRLGRAIADANKMEQKKK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S  I+   P      + F +P   + ++NDP G ++L       L+GI  + 
Sbjct: 229 AMTAEARMSVMIVACFPVFFFFFMKFMTPENFDFMMNDPGGRIILYYVVGSELLGIFTVW 288

Query: 181 LMI 183
            ++
Sbjct: 289 WLM 291


>gi|295107880|emb|CBL21833.1| hypothetical protein [Ruminococcus obeum A2-162]
          Length = 247

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 94/194 (48%), Gaps = 10/194 (5%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAV-------IVGQSSDPVRSEFRR 54
           K LI++R       F +AL+ +  +V+AG  V +AV         +  Q +D VR EF  
Sbjct: 56  KGLIRERKKNLNYQFKDALNALSVAVQAGYSVENAVMACSRDLERLYPQETDIVR-EFH- 113

Query: 55  VIETQ-HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
            +ETQ  + + + E +        ++++  F+ V     + GG+++  +   SR+L D+ 
Sbjct: 114 YMETQLKVSVPVEELLMSFGDRSGIEDIENFAAVFYTAKRTGGDMNRIIQTSSRMLGDKI 173

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           +++ +++      KA   I+  +P  +   +  TSPG++ VL  +P G + + +      
Sbjct: 174 DVRREIETTLAAKKAEQMIMSLMPAGIILYLKMTSPGFLEVLYGNPFGILAMSLCLGIYG 233

Query: 174 IGIMVMRLMINFDV 187
           +   + R +++ +V
Sbjct: 234 LSYWLGRRIVDIEV 247


>gi|254393102|ref|ZP_05008262.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294814749|ref|ZP_06773392.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326443128|ref|ZP_08217862.1| hypothetical protein SclaA2_18783 [Streptomyces clavuligerus ATCC
           27064]
 gi|197706749|gb|EDY52561.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294327348|gb|EFG08991.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 313

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 79/170 (46%), Gaps = 2/170 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KRT  F+   P    ++  + +AGL +  A+A+   +  DP   E   V +   +G SL 
Sbjct: 133 KRTEAFIAQLPELTRVLANATQAGLSLRTALAMAAEELDDPAGHELGIVADQLAVGQSLD 192

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V     + 
Sbjct: 193 DALGTLAERLPSRELIVLVTTLILANRAGGQVVTSLRNLTQSLEERKETRREVTTTLSQI 252

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
           K +A  +  L      ++   +PG ++ +     G       AAF L G+
Sbjct: 253 KVTALAVPLLGLGFLLMINGMTPGALDRMTGSVVGQG--ATLAAFGLYGL 300


>gi|303241709|ref|ZP_07328206.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590710|gb|EFL60461.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 306

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 62/123 (50%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K L+  P+ LD++  SV AGL    A+A ++ +   P+  EF  V++   +G  
Sbjct: 153 IAQRQKKILNSLPDVLDLLTVSVEAGLGFDGALAKVIDKMPGPIAIEFENVLQEMKVGKQ 212

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             +++  M   + L +++ F   I    QLG ++   L   S  +R+++  +AK +A+  
Sbjct: 213 KRDALKDMAERVGLHDLTTFVGSIIQADQLGVSIGNVLRIQSEQMREKRRQRAKEKAMKA 272

Query: 125 EAK 127
             K
Sbjct: 273 PVK 275


>gi|187478774|ref|YP_786798.1| pilus assembly protein [Bordetella avium 197N]
 gi|115423360|emb|CAJ49894.1| putative pilus assembly protein [Bordetella avium 197N]
          Length = 282

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 82/166 (49%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P  L  +  ++RAG  +  A+  +   +  P+  E   ++  Q LG+S  +++ R+  
Sbjct: 110 QLPAGLLSLASALRAGASLPAALRQLADLAQPPLAQEIGLMLREQRLGVSFDDALHRLEC 169

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            + L  V   +    V    GGNL++ L  +++ LR +   + +++AL+ + +  AW++ 
Sbjct: 170 RVDLPSVRLMTAAFRVAGSAGGNLAQTLEGIAQALRGQLLAEGRLKALTAQGRMQAWVLS 229

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LP  ++ ++Y   P  M  L     G +L+ +  A  ++G  ++R
Sbjct: 230 ALPLVLAVVLYLLRPEQMARLWQTEAGWILIALVMALQVLGWFLIR 275


>gi|327538077|gb|EGF24767.1| type II secretion system protein [Rhodopirellula baltica WH47]
          Length = 297

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 67/136 (49%)

Query: 44  SSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALA 103
           ++ P+R +    +    LG S S     + R MP+  +  FST +SV  + GG+L+  LA
Sbjct: 154 TASPLRDQIHWCVRRIQLGDSGSSVFRELARRMPIDAMELFSTTMSVHWETGGSLAPVLA 213

Query: 104 NLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           +++R+ RDR+ +  ++++   +++ S   +  L + V+ +++   P  M    +   G  
Sbjct: 214 SVARVARDRQEVARRIRSNIAQSQFSTIAVLLLIYFVALVLWLDRPEVMKEFASSSLGSA 273

Query: 164 LLGVAAAFMLIGIMVM 179
            +        +GI+ M
Sbjct: 274 AIAATIVLQAVGIVWM 289


>gi|332534352|ref|ZP_08410193.1| Flp pilus assembly protein TadB [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036171|gb|EGI72645.1| Flp pilus assembly protein TadB [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 291

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 83/183 (45%), Gaps = 10/183 (5%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-VRSEFRRVIETQHLG 62
           L   + AKF   F   ++ +   +  GL +  ++     + +DP ++ +   +++   +G
Sbjct: 108 LAHYKLAKFEHHFLEFIETVQSCLSTGLSLQQSMQ-FADEHADPYIKKQSSLLLQRMSMG 166

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR----DRKNMKAK 118
                S + ++     + V  F+  I   +Q   +L++ L ++  ++     DR+ +KAK
Sbjct: 167 SDAETSFAPLIERYNCETVRLFAHSIITHTQSQCDLTDMLKSVCNMMSLRTLDRQQLKAK 226

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +       K +A   G LP+ +  L  +T P +   L+NDP G   + VA    L G + 
Sbjct: 227 LSG----TKYAAVFSGFLPYALIPLFSYTDPTWFEPLLNDPNGIAFITVALLCQLFGFLW 282

Query: 179 MRL 181
           +RL
Sbjct: 283 LRL 285


>gi|302553854|ref|ZP_07306196.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471472|gb|EFL34565.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 314

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 85/182 (46%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   +G S+
Sbjct: 133 QKRIEKFINQLPEMARILANATQAGLALRTAIGMAAEEMEAPAGEELGKVSDQLAVGASM 192

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+    +
Sbjct: 193 DDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVRTQLSQ 252

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
              +++ +  L      L+     G ++ +     G   + +A +   +G +++R +   
Sbjct: 253 VTMTSYAVPVLGVGSLFLMNGVKDGALDRMTGSAFGQAAVIIAFSLYAVGFVLIRRLSRI 312

Query: 186 DV 187
           DV
Sbjct: 313 DV 314


>gi|311107628|ref|YP_003980481.1| type II secretion system protein F domain-containing protein 4
           [Achromobacter xylosoxidans A8]
 gi|310762317|gb|ADP17766.1| bacterial type II secretion system protein F domain protein 4
           [Achromobacter xylosoxidans A8]
          Length = 307

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 79/175 (45%), Gaps = 13/175 (7%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  + +   P  LD IVR +  G  +  A       + +P+R     V+ET     SLS
Sbjct: 129 KRQRRMISQLPAFLDNIVRLLTIGNSMGAAFQTAAAATDEPLRE----VVETAS---SLS 181

Query: 67  ES------ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            S      ++++ R   L+E+   + V+S+  + GG   + L  ++  +RD    + ++ 
Sbjct: 182 RSKELDAALAQVSRLYGLKELYMVAAVVSLAMRFGGRSDQVLERMAAFMRDVAQARNELT 241

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           A S E + SAWI+  LP  ++  +   +      L  DP+G  +L  A    + G
Sbjct: 242 ASSAEVRLSAWILALLPVGIAGFIIVANNNLFMGLWQDPQGFRMLLTAVCLQVGG 296


>gi|255658710|ref|ZP_05404119.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
 gi|260849099|gb|EEX69106.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
          Length = 307

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  +     P  LD++  SV+AGL    A++ I  +   P   E RR+ +   +G+ 
Sbjct: 156 IQRRQKQIEHQLPEVLDLLCVSVQAGLSFDAALSKITARMKGPFIDECRRMQDDIRMGVV 215

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
              ++  M     L++VS F T I    +LG ++ + L N +  +R+R+    K QA+  
Sbjct: 216 RRTAMRSMADRCGLEDVSLFMTSIIQAERLGTSMGKTLKNQADNIRERRRQYVKAQAMKA 275

Query: 125 EAK 127
             K
Sbjct: 276 PVK 278


>gi|291546643|emb|CBL19751.1| Flp pilus assembly protein TadB [Ruminococcus sp. SR1/5]
          Length = 260

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 74/152 (48%), Gaps = 6/152 (3%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVG------QSSDPVRSEFRRVIETQHLGLSLSESI 69
           F +AL  +  +V+AG    +AV   V       +    +  EFR +     L + + E  
Sbjct: 83  FRDALTAMNVAVQAGYSAENAVRASVKDLGRLYEKGSDILDEFRYIESQLRLSVPVEELF 142

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
             + +   ++++  F+ V     + GG++++ +  ++R+L D+  +K +++A     K+ 
Sbjct: 143 LDLGKRSGVEDIENFAAVFYTAKRTGGDMTQVIQKVARMLSDKIEVKKEIEATLAAKKSE 202

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
             ++  +P  +   +  TSPG+++VL  +P G
Sbjct: 203 QMVMSIMPAGIICYLKLTSPGFLDVLYGNPFG 234


>gi|163801323|ref|ZP_02195222.1| Flp pilus assembly protein TadB [Vibrio sp. AND4]
 gi|159174812|gb|EDP59612.1| Flp pilus assembly protein TadB [Vibrio sp. AND4]
          Length = 289

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    K +  F D F  +L +I R++ +G  ++ ++      +   +R EF R+I+  +
Sbjct: 102 LKEYHAKLSNYFEDKFAFSLRMISRNLISGRTIAASIESASRHTMGKIRIEFERIIKQIN 161

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +L E+++      P +  + FS  + +  + GG++ ++L  L++ L   + ++ K  
Sbjct: 162 AGNTLEEALTTGENIYPYKGYTVFSANVKMSLKRGGSIKDSLDELAQDLVASQVIRKKTL 221

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +L+ E++ +A I+  LPF +  ++   +      L  +  G  ++      + IG ++++
Sbjct: 222 SLTSESRGAAKILAVLPFIMLLVLKSFAVENFEYLFGEQYGKYIIIYVVTSVSIGFVLIK 281

Query: 181 LMIN 184
            MI+
Sbjct: 282 RMID 285


>gi|148655425|ref|YP_001275630.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567535|gb|ABQ89680.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 311

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKR    +   P+ALD++   V AGL    A+  +  +  DP+  EF+RV+    LG  
Sbjct: 155 IKKRKKAIVKALPDALDLLCICVEAGLSFDQAMQRLTEKWDDPLSKEFKRVLSDTRLGRP 214

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
             +++  M+    + +V  F   +    QLG ++   L   S  +R R+  +A+ +A
Sbjct: 215 RRDAMKDMIDRCGVDDVQTFIGAVIQAEQLGVSIGRILRIQSDQMRIRRRQRAEEEA 271


>gi|229816458|ref|ZP_04446759.1| hypothetical protein COLINT_03512 [Collinsella intestinalis DSM
           13280]
 gi|229808000|gb|EEP43801.1| hypothetical protein COLINT_03512 [Collinsella intestinalis DSM
           13280]
          Length = 247

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 78/171 (45%), Gaps = 3/171 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +K+  +       A   +  S+ +GL ++ A+  +   + +PVR+EF R       G  +
Sbjct: 67  RKKRERLEGAMVEAFGALAASMASGLSLAQAMRYVGSHAQEPVRTEFLRAEAQVACGAGM 126

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +E++  +V  +    + F +  + V  + G  LS+ L   +R++R+R  ++ K+   + +
Sbjct: 127 TEALDELVERLHAPGLDFVTLALKVSRRTGAPLSDVLGEATRLVRERVELRRKLDVRTAQ 186

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            + SA ++  +P  +   +   S  +   +   P       +A A +L GI
Sbjct: 187 VRMSARLVAGMPVAMVAFLAAASSDFREGIATVPGAA---SIAVALLLDGI 234


>gi|219850073|ref|YP_002464506.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544332|gb|ACL26070.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 61/117 (52%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IK+R    L   P+ALD++  SV AGL    A+  +  +  + +  EF+RV++   LG +
Sbjct: 151 IKERKKNILKALPDALDLLCISVEAGLAFDLALQRVAQKWDNELSHEFQRVLQDIRLGRT 210

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
             E++  M     +++V  F + +    QLG ++S+ L   S  LR R+  +A+  A
Sbjct: 211 RREALRDMAARTGVEDVQTFVSAVIQADQLGVSMSKILRIQSDQLRTRRRQRAEEAA 267


>gi|163846103|ref|YP_001634147.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523838|ref|YP_002568308.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
 gi|163667392|gb|ABY33758.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447717|gb|ACM51983.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
          Length = 311

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 79/165 (47%), Gaps = 13/165 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IK+R    L   P+ALD++  SV AGL    A+  +  +  + +  EF+RV++   LG +
Sbjct: 151 IKERKKNILKALPDALDLLCISVEAGLAFDLALQRVAQKWDNELSREFQRVLQDIRLGRT 210

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             E++  +V    +++V  F + +    QLG ++S+ L   S  LR R+  +A+      
Sbjct: 211 RREALRDLVTRTGVEDVQTFVSAVIQADQLGVSMSKILRIQSDQLRVRRRQRAE------ 264

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIND--PRGHMLLGV 167
           EA   A +   +P     +V+   P    V++    PR    LGV
Sbjct: 265 EAAQKAPVKMLIP-----MVFLIFPALFVVILGPAVPRIMQALGV 304


>gi|293606487|ref|ZP_06688845.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815110|gb|EFF74233.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
          Length = 307

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  + +   P  LD IVR +  G  +  A       + +P+R               L 
Sbjct: 128 KRRRRMIGQLPAFLDNIVRLITIGNSMGAAFQTAAATTDEPLREVVETAASLSRSAKELD 187

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ ++ R   L+E+   + V+S+  + GG   + L  ++  +RD    + ++ A S E 
Sbjct: 188 AALVQVSRMYGLKELYMVAAVVSLAMRFGGRSDQVLERMAAFMRDVAQARNELTASSAEV 247

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
           + SAWI+  LP  ++  +   +      L  DP G  +L
Sbjct: 248 RLSAWILALLPVGIAGFIIVANNKLFMGLWEDPLGFKML 286


>gi|295395664|ref|ZP_06805856.1| possible integral membrane protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971480|gb|EFG47363.1| possible integral membrane protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 308

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 82/181 (45%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L +++ AKF    P    I+  S  AGL +  A+ V   +  DP   EF  +     +G 
Sbjct: 125 LKERQRAKFFQQLPEFARIMANSTGAGLSIHTALGVAASELPDPASREFSALKRELEIGT 184

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++ RM   +  +++    + + +  + GG+L  +L N+S  L  RK  K +V+ L 
Sbjct: 185 PLDIALERMSERISGRDLDVLVSTLVIAQRSGGSLISSLRNMSDTLEFRKETKREVKTLV 244

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            ++  + +++ +       L+   + G +  L +   G + + +A     IG++ +  ++
Sbjct: 245 SQSSYTGYLVVAFGVGFVLLLASFNDGLLLKLTSTIIGQIAIVIATVCYAIGLVAINRLV 304

Query: 184 N 184
            
Sbjct: 305 K 305


>gi|315181052|gb|ADT87966.1| Flp pilus assembly protein TadC [Vibrio furnissii NCTC 11218]
          Length = 318

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 69/130 (53%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +  ++KKR ++     P+ALD++V    +GL  + A+  +  +   S   +  E   V  
Sbjct: 158 LDRMVKKRKSRIKGGIPDALDLLVVCTESGLGFNAALRRVADELMISHPDLADELDTVCA 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +SE+++++V    L E+S   ++++  S++GG++S+ L + +   RD++N + 
Sbjct: 218 KIKAGVEMSEAMAQLVERTGLTEISGLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEI 277

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 278 EEIAAKIPTK 287


>gi|261856881|ref|YP_003264164.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837350|gb|ACX97117.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 298

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAV--AVIVGQSSDPVRSEFRRVIETQHLGL 63
           K R    + D P  LD IV +V AGL ++  +  A + G    P+  EFRR++     GL
Sbjct: 145 KHRQRLVIKDLPVFLDFIVMAVEAGLNITGGIEQATLKGPKG-PLAQEFRRLLRDMRSGL 203

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           + +E++ RM   M + ++S F+  +    ++G +L  +L   +   R+ + ++A+  AL 
Sbjct: 204 ARAEALKRMAERMDMPQISSFTGTLIQADRVGASLGASLRVQADQRREERFLRAEKLALE 263

Query: 124 MEAK 127
              K
Sbjct: 264 APVK 267


>gi|260771470|ref|ZP_05880395.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
 gi|260613596|gb|EEX38790.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio furnissii CIP 102972]
          Length = 318

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 69/130 (53%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +  ++KKR ++     P+ALD++V    +GL  + A+  +  +   S   +  E   V  
Sbjct: 158 LDRMVKKRKSRIKGGIPDALDLLVVCTESGLGFNAALRRVADELMISHPDLADELDTVCA 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +SE+++++V    L E+S   ++++  S++GG++S+ L + +   RD++N + 
Sbjct: 218 KIKAGVEMSEAMAQLVERTGLTEISGLVSMLAHASRIGGSISQTLRDYTEDFRDKRNQEI 277

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 278 EEIAAKIPTK 287


>gi|260776710|ref|ZP_05885605.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607933|gb|EEX34198.1| flp pilus assembly protein TadC [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 314

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 67/130 (51%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           + HL+KKR ++     P+ALD++V    +GL  + A   VA  V  S      E   V  
Sbjct: 154 LGHLVKKRQSRIRGGIPDALDLMVVCTESGLGFNSALRRVADEVAISHPDFADELDTVCV 213

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
             + G+ +S++ + ++    L E++   T+++  S++GG+L++ L   +   RD++N + 
Sbjct: 214 KINAGVEMSDAFNDLIERTGLIEIAGLVTMLAHASRIGGSLAQTLREYTDDYRDKRNQEV 273

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 274 EEIAAKIPTK 283


>gi|54302281|ref|YP_132274.1| tight adherence TadC-like transmembrane protein [Photobacterium
           profundum SS9]
 gi|46915703|emb|CAG22474.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum SS9]
          Length = 322

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 78/169 (46%), Gaps = 18/169 (10%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQHLG 62
           KKR     + FP+ALD++V +  AGL    A   VA  +   S  + SE + V     LG
Sbjct: 166 KKRIQTLSNAFPDALDLLVVTTEAGLGFLAALNRVANEIDALSPELSSELQIVCRKVRLG 225

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L  ++S+ +    L E+    ++IS   +LG ++ + L   +   RDR+  KA+ +A 
Sbjct: 226 VPLPIALSQFIERTGLLELQGLVSIISQSVKLGSSMGDTLREYAIEFRDRRMQKAEEEA- 284

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF 171
              AK    +I  L  C+        PG+  V I    G  ++ V  AF
Sbjct: 285 ---AKIGTKMIFPLVTCI-------WPGFFTVAI----GPAIIAVLEAF 319


>gi|319788658|ref|YP_004148133.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467170|gb|ADV28902.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 296

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGLS 64
           K R    + D P  LD I  SV AGL V+  +   V +  +  +  EF R++     GL 
Sbjct: 143 KLRHKAVVRDLPVYLDFITMSVEAGLNVTGGIEQAVAKGPAGALSQEFSRMLRDIRAGLP 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++ RM   M + +++ F++ +    ++G NLS+ L   +   R+ + ++A+  AL  
Sbjct: 203 RAEALKRMSERMDISQITNFTSALIQADKVGANLSDTLRAQANQRREERFLRAEKLALEA 262

Query: 125 EAK 127
             K
Sbjct: 263 PVK 265


>gi|317403494|gb|EFV83999.1| hypothetical protein HMPREF0005_03141 [Achromobacter xylosoxidans
           C54]
          Length = 303

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 71/165 (43%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P  LD IVR V  G  ++ A       + +P+R               L  ++ ++ R
Sbjct: 138 QLPAFLDNIVRLVTIGNSMAAAFQTAAASTDEPLREVVETAAALSRSAKELDAALVQVSR 197

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
              ++E+   + V+SV  + GG   + L  ++  +RD    +A++ A S E + SAWI+ 
Sbjct: 198 QYDMKELYMVAAVVSVALRFGGRSDQVLERMAAFMRDIGQARAELSASSAEIRLSAWILA 257

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            LP  ++  +   +      L  DP G  +L  A    + G  ++
Sbjct: 258 LLPLGIAGFIMVANNDLFMGLWVDPLGFKMLLTAVCLQVAGSYIL 302


>gi|255020083|ref|ZP_05292154.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970445|gb|EET27936.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 337

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLS 64
           K+R  + L D P  LD I   V  GL ++ A+ + V +  + P+R+EFR ++     G+ 
Sbjct: 184 KRRQKRILKDLPVYLDFITLMVEGGLNLTGAIQIAVDKGPEGPLRNEFRIILRDLRSGMP 243

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             E   R    + +QE+    T I    + GG+L+  L   +   R+ + ++A+  AL  
Sbjct: 244 RVEVFRRFGDRVAMQELRSLVTAIIQAEERGGSLAPVLKAQAEQRREERFLRAEKAALEA 303

Query: 125 EAK 127
             K
Sbjct: 304 PVK 306


>gi|304405043|ref|ZP_07386703.1| Type II secretion system F domain protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304345922|gb|EFM11756.1| Type II secretion system F domain protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 274

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 90/189 (47%), Gaps = 10/189 (5%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA--------VIVGQSSDPVRSEFRRV 55
           L++KR  +    F  AL  +  S+ AG  V +A          +  G ++D VR EF  +
Sbjct: 84  LLEKRRVRLQLQFKEALYSVTSSLAAGRSVENAFIAAEADLQLLYPGGTADIVR-EFAMI 142

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G +L   +S+      L+E++ F  V S   + GG+L + +   S+++ ++ ++
Sbjct: 143 RHRMENGETLESGLSQFANRAQLEEITQFVDVFSTCKRTGGDLVDVIRRTSQVIGEKLDI 202

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM-LLGVAAAFMLI 174
           + ++  +  + +  + I+ ++PF     +   +P Y   L + P G++ L  +   F+  
Sbjct: 203 QQEIAVMLAQKRFESRILTAVPFVFIAGLNLAAPDYTGPLYSSPLGYVLLTLLLLGFVGC 262

Query: 175 GIMVMRLMI 183
           G ++ +LM+
Sbjct: 263 GALIRKLMM 271


>gi|302391033|ref|YP_003826853.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203110|gb|ADL11788.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 306

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 72/153 (47%), Gaps = 11/153 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K     P+ LD++  SV AGL    A+  +V + + P+  EF R+++   +G  
Sbjct: 152 ISERQKKMQQALPDVLDLLTVSVEAGLGFDSALVRVVDKIAGPISEEFERLLQEIRMGKP 211

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             +++  +     +++++ F T I    +LG ++ + L   S+ +R ++  +A+ QA+  
Sbjct: 212 RRDAMRDLGERTNVEDLTNFITAIVQADKLGVSIGKVLRVQSKQIRQKRRQRAEAQAMKA 271

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             K            +  LV+F  P    +L+ 
Sbjct: 272 PIK-----------MLLPLVFFIFPTLFIILLG 293


>gi|270487716|ref|ZP_06204790.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|270336220|gb|EFA46997.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
          Length = 217

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 31  LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 90

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 91  LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 150

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 151 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 210

Query: 181 LMI 183
            M+
Sbjct: 211 KML 213


>gi|323499916|ref|ZP_08104875.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
 gi|323315157|gb|EGA68209.1| Flp pilus assembly protein TadC [Vibrio sinaloensis DSM 21326]
          Length = 314

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 66/130 (50%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + +++KKR ++     P+ALD++V    +GL  S A+  +  +   S      E   V  
Sbjct: 154 LNYVVKKRQSRIRGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFADELDTVCV 213

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +S++   +V    ++E++   T++S  S++GG+LS+ L   +   RD++N + 
Sbjct: 214 KIKAGVEMSDAFEDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDFRDKRNQEI 273

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 274 EEIAAKIPTK 283


>gi|257790323|ref|YP_003180929.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|317489772|ref|ZP_07948271.1| hypothetical protein HMPREF1023_01970 [Eggerthella sp. 1_3_56FAA]
 gi|325830267|ref|ZP_08163724.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
 gi|257474220|gb|ACV54540.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|316911118|gb|EFV32728.1| hypothetical protein HMPREF1023_01970 [Eggerthella sp. 1_3_56FAA]
 gi|325487734|gb|EGC90172.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
          Length = 306

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 18  NALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMP 77
            AL  I  SVR+ L +  A+        DP+R E  RV+     G +L+ +  RM R   
Sbjct: 134 RALPQIAASVRSSLTLERALRTAASHVEDPLREELARVLADTAYGTTLAMAFERMARRTD 193

Query: 78  LQEVSFFSTVISVQSQLGGNLSEAL----ANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             +V   +  + +Q + GG ++  L    A+ +  LR  + +K ++    +    + W +
Sbjct: 194 SPDVRSLAAAVRIQQRFGGAVAPVLDLIAAHAAARLRTSRELKTELAGTRL----AKWFV 249

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
                 +  +++ T+  +       P G ++LGVA      G+   + +   D
Sbjct: 250 ALAMPAIFFIMFATNADFSQFYREQPLGWIVLGVAGCSEAFGLFACQRITAMD 302


>gi|295395665|ref|ZP_06805857.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971481|gb|EFG47364.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 297

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 64/129 (49%), Gaps = 4/129 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR     D  P+ LD++  +V AGL    A+A +  ++  P+  E   V+   ++G ++
Sbjct: 144 RKRQEAIEDSLPDFLDVLAVTVSAGLSFRSAIAKVTERTQGPLADELNTVLHQLNMGETV 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++ S + +    + +  F T +    +LG  L++ LA ++  +R     +A+ +A    
Sbjct: 204 YDAFSALRKRTTSESLDSFITTLLQAEELGAPLADTLATIALDMRQTTAQRARQKA---- 259

Query: 126 AKASAWIIG 134
           AKAS  I G
Sbjct: 260 AKASPKIAG 268


>gi|22127362|ref|NP_670785.1| hypothetical protein y3488 [Yersinia pestis KIM 10]
 gi|21960447|gb|AAM87036.1|AE013952_3 hypothetical [Yersinia pestis KIM 10]
          Length = 270

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 84  LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 143

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 144 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 203

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 204 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 263

Query: 181 LMI 183
            M+
Sbjct: 264 KML 266


>gi|51891535|ref|YP_074226.1| putative integral membrane protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855224|dbj|BAD39382.1| putative integral membrane protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 270

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 83/174 (47%), Gaps = 7/174 (4%)

Query: 1   MKHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS--DPVRSEFRRVIE 57
           ++  + +R A+ L D    AL  +  S++AG  +  A+     + S   P      R IE
Sbjct: 77  VRDTLARREAQALRDQLQEALLSLATSLKAGQSLPRALQRCAVELSRLHPGGGGLIREIE 136

Query: 58  TQ----HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
                  LG  + E++  +   +PL+E++     +    + GGN+ E + N+++++ DR 
Sbjct: 137 LTAREVELGTPVDEALLDLRARVPLEELAALVDALVTTRRRGGNIVEVMGNVAQMVADRL 196

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGV 167
            ++ ++Q L+ + +  A I+  +P  +  +V  T+P Y+ V      G   LG+
Sbjct: 197 AVEREIQVLTAQKRTEAAILAMIPLGIYLVVRVTNPAYLAVFHATLWGQAALGL 250


>gi|110626526|gb|ABG79010.1| TadB [Yersinia ruckeri]
          Length = 296

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/178 (17%), Positives = 79/178 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K++   F + FP  L I+  +  +G  ++  +     +    + +EF  +    +LG + 
Sbjct: 115 KQKNKHFNESFPEVLTIMNMAASSGANLNQILERCGKEIQGELGNEFNLIYRRLNLGEAP 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
               +   R     E  FF++VI +  + GG LS+ +  + + + +   +K +   ++ +
Sbjct: 175 EIVFNDAYRKFNYAEFHFFTSVILLNIKQGGQLSDLIKKMHKGITESNKLKQRKAIMTAQ 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +  ++  +P   +  +Y+  P  +  L +   G  ++       ++GI ++R MI
Sbjct: 235 IRMTTNVVSLIPIVFTAFLYYIDPNSIETLWSQDVGKEIISYIVISEILGIFIIRNMI 292


>gi|220927957|ref|YP_002504866.1| Flp pilus assembly protein TadB-like protein [Clostridium
           cellulolyticum H10]
 gi|219998285|gb|ACL74886.1| Flp pilus assembly protein TadB-like protein [Clostridium
           cellulolyticum H10]
          Length = 247

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 83/183 (45%), Gaps = 17/183 (9%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD----------PVRSE 51
           K +I+KR  +    F + L  +  S+ AG P+  A    VG  SD           +  E
Sbjct: 55  KQIIEKRKNELNLQFKDLLISLSSSLSAGKPLEKA---FVGALSDLYVLYPSDDAYIVRE 111

Query: 52  FRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRD 111
            + +I    L +S+ E++S       + ++  FS VI +  + GGNL +A+ N SRI+ +
Sbjct: 112 TKIIINKLSLNVSIEEAVSDFAERSDIDDIKNFSDVIIICKRTGGNLVDAIKNSSRIISE 171

Query: 112 RKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF 171
           +  M  +++ L    K    ++  +P  +  ++  T+  Y+N +     G     +AA  
Sbjct: 172 KIEMAQEIETLLSSRKLEQKVLNIMPIAMIFILSTTATEYINPVFTTVTGR----IAATL 227

Query: 172 MLI 174
            LI
Sbjct: 228 CLI 230


>gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722223|gb|ABC77166.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 317

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ----SSDPVRSEFRRVIETQH 60
           I  R  K ++ FP+ALD++V  V AG+ +  A+   VG+    S  P+  EFR +     
Sbjct: 160 IGARKEKIMEGFPDALDLMVICVEAGMGLDQAINR-VGEEMKLSCPPISDEFRTLNMEMR 218

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S  E++  M     L +V+   T++    Q G ++ +AL   S  +R ++  +A+ +
Sbjct: 219 MGKSRREALRNMANRTELDDVTSLVTLLIQTDQFGTSIGQALRVHSDSMRVQRRQRAEEK 278

Query: 121 A 121
           A
Sbjct: 279 A 279


>gi|269126091|ref|YP_003299461.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311049|gb|ACY97423.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 307

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 73/151 (48%), Gaps = 6/151 (3%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +     P+ LD++V SV AGL    A+  +   +S P+  E  RV++   +G S +
Sbjct: 155 RRQEELKRSLPDTLDLLVVSVEAGLGFDAALTRVAQHTSGPLAEELARVLQEIRIGKSRT 214

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + ++EV  F   +   S+LG ++   L   +R  R ++  +A+     M  
Sbjct: 215 EALRSMGERVAVEEVRTFIAALVQASELGMSIGVVLREQAREARLKRRQRAE----EMAQ 270

Query: 127 KASAWIIGSLPFCV--STLVYFTSPGYMNVL 155
           K    ++  +  C+  + ++    PG ++++
Sbjct: 271 KVPVKVMFPVVLCILPALIITVVGPGVLSIM 301


>gi|45442766|ref|NP_994305.1| hypothetical protein YP_3004 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597674|ref|YP_071865.1| integral membrane protein. [Yersinia pseudotuberculosis IP 32953]
 gi|108809094|ref|YP_653010.1| hypothetical protein YPA_3103 [Yersinia pestis Antiqua]
 gi|108810711|ref|YP_646478.1| hypothetical protein YPN_0546 [Yersinia pestis Nepal516]
 gi|145597783|ref|YP_001161859.1| hypothetical protein YPDSF_0473 [Yersinia pestis Pestoides F]
 gi|150260281|ref|ZP_01917009.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162418856|ref|YP_001604879.1| type II secretion system protein F domain [Yersinia pestis Angola]
 gi|165924990|ref|ZP_02220822.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165939873|ref|ZP_02228412.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008715|ref|ZP_02229613.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212189|ref|ZP_02238224.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399582|ref|ZP_02305106.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419108|ref|ZP_02310861.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167425112|ref|ZP_02316865.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167466379|ref|ZP_02331083.1| type II secretion system protein F domain protein [Yersinia pestis
           FV-1]
 gi|186896812|ref|YP_001873924.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927880|ref|YP_002345755.1| hypothetical protein YPO0689 [Yersinia pestis CO92]
 gi|229837371|ref|ZP_04457534.1| Flp pilus assembly protein TadB [Yersinia pestis Pestoides A]
 gi|229840583|ref|ZP_04460742.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842867|ref|ZP_04463019.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900908|ref|ZP_04516032.1| Flp pilus assembly protein TadB [Yersinia pestis Nepal516]
 gi|294502755|ref|YP_003566817.1| hypothetical protein YPZ3_0645 [Yersinia pestis Z176003]
 gi|45437632|gb|AAS63182.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590956|emb|CAH22614.1| Putative integral membrane protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108774359|gb|ABG16878.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781007|gb|ABG15065.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115346491|emb|CAL19365.1| putative membrane protein [Yersinia pestis CO92]
 gi|145209479|gb|ABP38886.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149289689|gb|EDM39766.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162351671|gb|ABX85619.1| type II secretion system protein F domain protein [Yersinia pestis
           Angola]
 gi|165912184|gb|EDR30822.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923190|gb|EDR40341.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992054|gb|EDR44355.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206935|gb|EDR51415.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166963102|gb|EDR59123.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167052086|gb|EDR63494.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167055875|gb|EDR65656.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|186699838|gb|ACC90467.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682247|gb|EEO78339.1| Flp pilus assembly protein TadB [Yersinia pestis Nepal516]
 gi|229690134|gb|EEO82191.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696949|gb|EEO86996.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705494|gb|EEO91504.1| Flp pilus assembly protein TadB [Yersinia pestis Pestoides A]
 gi|262360787|gb|ACY57508.1| hypothetical protein YPD4_0599 [Yersinia pestis D106004]
 gi|262364732|gb|ACY61289.1| hypothetical protein YPD8_0599 [Yersinia pestis D182038]
 gi|294353214|gb|ADE63555.1| hypothetical protein YPZ3_0645 [Yersinia pestis Z176003]
 gi|320016748|gb|ADW00320.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 291

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 225 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|238897545|ref|YP_002923224.1| putative tight adherance operon protein B [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465302|gb|ACQ67076.1| putative tight adherance operon protein B [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 300

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 82/182 (45%), Gaps = 10/182 (5%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K++   F + FP  L I      +G+ V++    I+ ++   ++    +  +     LS+
Sbjct: 119 KQKKIYFTETFPELLLIFNMGSVSGISVNE----ILKKAGQEIKGGLGKECDLIFRRLSI 174

Query: 66  SESISRMVRYMPLQEVSF-----FSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            E+I+  V Y   Q  S+     F  ++ +    GG L E +  L++++ +   M+ +  
Sbjct: 175 GENINT-VFYDAYQRFSYPEFYMFINILMLNINQGGQLRELMHRLNQVVTNYNKMEKRKM 233

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + S W++  +P       YF +P     + +   G +++    A   +GI +MR
Sbjct: 234 AMTGEIRMSIWVVTLIPVIFFAFSYFMNPLSFQKIFSYEIGKIIIYYCLASNTLGIFIMR 293

Query: 181 LM 182
            M
Sbjct: 294 YM 295


>gi|188586923|ref|YP_001918468.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351610|gb|ACB85880.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 317

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P  LD++  SV AGL    ++  +  + + P+  E +RV +   +G S  E++  +   +
Sbjct: 174 PEFLDLLTVSVEAGLGFESSLKKVAEEGTGPLAVEIKRVTQEISMGKSRKEALIDLKERI 233

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            LQ++S F   I    QLG  +S  L   S+  R ++  +A+ QA+    K
Sbjct: 234 DLQDLSTFINAIIQAEQLGVGISRVLKVESKEFRRKRRQRAEEQAMKAPVK 284


>gi|170022930|ref|YP_001719435.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
 gi|169749464|gb|ACA66982.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
          Length = 291

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 78/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYSRSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  + + P G  ++       +IGI+++R
Sbjct: 225 VMTAQIRMSVNIISIMPILFSFLLYLLDPTTIEFVWHHPTGRFIIYYIIISEVIGILIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|153950598|ref|YP_001399591.1| type II secretion system protein F domain [Yersinia
           pseudotuberculosis IP 31758]
 gi|152962093|gb|ABS49554.1| type II secretion system protein F domain protein [Yersinia
           pseudotuberculosis IP 31758]
          Length = 291

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 76/183 (41%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI ++R
Sbjct: 225 VMTAQIRMSVNIISIMPILFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGIFIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|254483273|ref|ZP_05096505.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
 gi|214036496|gb|EEB77171.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
          Length = 283

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 78/162 (48%)

Query: 26  SVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFS 85
           S+++G+ +  A + +V     P+  EF  + E    G  +  ++      + +  +S   
Sbjct: 122 SIKSGMTIEQAFSEMVDNMYPPISEEFALIRERIDAGQPVIAAVKSADERLQVPRLSLIF 181

Query: 86  TVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVY 145
             I +  + GG L+  +  L+   R+ + ++ +V+  +   + SA I+  +PF +  L+Y
Sbjct: 182 QTICISLERGGRLASLMDRLAESTREIERVEERVRTETAGLRLSARIMFLMPFFICGLLY 241

Query: 146 FTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
              P  + +L ++  G+++L +A A  +    +M+ +I  D+
Sbjct: 242 LIEPDQVMLLFDNLVGNIVLVIAIAMDISAYFIMKKLIELDI 283


>gi|110833083|ref|YP_691942.1| hypothetical protein ABO_0222 [Alcanivorax borkumensis SK2]
 gi|110646194|emb|CAL15670.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 268

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 80/182 (43%), Gaps = 6/182 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIETQHLG 62
           +KR     +  P  +D ++R + AG  +  A+   +  +     P+    R  +E+    
Sbjct: 85  QKRRRLIFESTPEVIDDVIRGIDAGRSLEQALVNALNDAPKVFFPLLFRLRSAVESGRDY 144

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L +  S++ R  PL   +F +  +   S  G  +   L  +SR LR ++ M+ +  A 
Sbjct: 145 TGLIDDFSKLYRIPPL---TFVAVALRTSSHYGSAVRPVLKKVSRSLRSQQEMRREFLAA 201

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A     LP  +   +   +  + +VL++   G  +L  +   +++G +++  M
Sbjct: 202 TAETRFTAMAFAVLPLVIGASLIGLNESFRDVLLDTESGQKMLMTSIGLIVVGTIIVFRM 261

Query: 183 IN 184
           + 
Sbjct: 262 VQ 263


>gi|37680835|ref|NP_935444.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
 gi|37199584|dbj|BAC95415.1| Flp pilus assembly protein TadC [Vibrio vulnificus YJ016]
          Length = 329

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + H +KKR        P+ALD++V    +GL  + A+  +  +   S      E   V  
Sbjct: 170 LNHFVKKRQRMIRAGVPDALDLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCA 229

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +S +   +V    L E++    ++S  S++GG+LS+ L + +   RD++N + 
Sbjct: 230 KIKAGVEMSTAFEELVTRTGLSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEV 289

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 290 EEIAAKIPTK 299


>gi|86147459|ref|ZP_01065771.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
 gi|85834752|gb|EAQ52898.1| Flp pilus assembly protein TadC [Vibrio sp. MED222]
          Length = 323

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 63/125 (50%), Gaps = 3/125 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHLG 62
           K R  K  +  P+ALD++V    +GL  + A+  +  +   S   +  E   V      G
Sbjct: 163 KDRQRKIKNGVPDALDLLVVCTESGLGFNAALGRVANELYISQPELADELDTVFAKIQAG 222

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +++ +++S++V    L E+    +++S  S++GG+L++ L + +   RD++   A+  A 
Sbjct: 223 VTMPDALSQLVERTGLHELDGLVSLLSHASRMGGSLAQTLRDYTEDFRDKRQQAAEEIAA 282

Query: 123 SMEAK 127
            +  K
Sbjct: 283 KIPTK 287


>gi|27365114|ref|NP_760642.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|320155497|ref|YP_004187876.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
 gi|27361260|gb|AAO10169.1| Flp pilus assembly protein TadC [Vibrio vulnificus CMCP6]
 gi|319930809|gb|ADV85673.1| type II/IV secretion system protein TadC, associated with Flp pilus
           assembly [Vibrio vulnificus MO6-24/O]
          Length = 314

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + H +KKR        P+ALD++V    +GL  + A+  +  +   S      E   V  
Sbjct: 155 LNHFVKKRQRMIRAGVPDALDLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCA 214

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +S +   +V    L E++    ++S  S++GG+LS+ L + +   RD++N + 
Sbjct: 215 KIKAGVEMSTAFEELVTRTGLSEINGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEV 274

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 275 EEIAAKIPTK 284


>gi|83749633|ref|ZP_00946616.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|207744163|ref|YP_002260555.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
 gi|83723694|gb|EAP70889.1| TRANSMEMBRANE TIGHT ADHERENCE TADC-RELATED PROTEIN; tadC1
           [Ralstonia solanacearum UW551]
 gi|206595567|emb|CAQ62494.1| pilus assembly protein tadc [Ralstonia solanacearum IPO1609]
          Length = 314

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 81/156 (51%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIETQ-HL 61
           I++R     + FP++LD+I+  V AGL +  AV  +V +  ++ P  +E   ++  +   
Sbjct: 153 IRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYEILTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL+  +++  +     +++VS    ++    + G +++E+L   S +LR +++M A+ +A
Sbjct: 213 GLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNVL 155
               AK S  I+  L FC+  S  V    P  + V+
Sbjct: 273 ----AKISTKILFPLIFCIFPSLFVVLLGPAAIQVV 304


>gi|323491540|ref|ZP_08096719.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
 gi|323314116|gb|EGA67201.1| Flp pilus assembly protein TadC [Vibrio brasiliensis LMG 20546]
          Length = 313

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQH 60
           ++ KR +K     P+ALD++V    +GL  + A+  +  +   S      E   V    +
Sbjct: 156 MVDKRQSKIRGGIPDALDLLVVCTESGLGFNAALRRVADELTISHPEFADELDTVCVKVN 215

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +S++ + +++   L+E++   T+++  S++GG+LS+ L   +   RD++N + +  
Sbjct: 216 AGVEMSDAFNDLIQRTGLKEIAGLVTMLAHASKIGGSLSQTLREYTEDYRDKRNQEIEEV 275

Query: 121 ALSMEAK 127
           A  +  K
Sbjct: 276 AAKIPTK 282


>gi|313902406|ref|ZP_07835809.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
 gi|313467337|gb|EFR62848.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
          Length = 326

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    +R  +     P+ +D++  +V AGL +  AV  +  +   PV +EFR+ ++   
Sbjct: 169 LKARATRRKRQLARALPDVMDLLSVAVEAGLGLDGAVQKVTEKFPAPVSTEFRQYLKELR 228

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+S  E++  +     L E+  F+  +    +LG +L+  L   +  LR ++  +A+ Q
Sbjct: 229 LGVSREEALRSLADRAELPELRSFAAAVIQADRLGVSLARVLRVQAEQLRFQRKQRAEEQ 288

Query: 121 ALSMEAK 127
           A+    K
Sbjct: 289 AMKTPIK 295


>gi|289643196|ref|ZP_06475323.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
 gi|289506967|gb|EFD27939.1| type II secretion system protein [Frankia symbiont of Datisca
           glomerata]
          Length = 349

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 78/183 (42%), Gaps = 37/183 (20%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R A+ ++D P ALD+I   + AG P+  A+ ++ G    P+ +E   V  +  LG S+
Sbjct: 165 QRRQARLVEDLPLALDLIAACLTAGAPIVAALDIVAGAVGGPLGTELGMVSRSLRLGASM 224

Query: 66  SESISRMV---------------RYMPL----------------QEVSFFSTVISVQSQL 94
           +E+  R++               R +P+                 E++ F+  +    + 
Sbjct: 225 AEACGRLLGPEPSSSRPAAKRWTRLVPVGPAPGGLGRPTATAEAHEIAAFARALHRSEES 284

Query: 95  GGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           G  L+ AL  L+   R R+  +    AL+   +A    +  L  C   L  F + G + V
Sbjct: 285 GARLAAALGRLADQTRARRQER----ALTAARRAGVTAVAPLGLCF--LPAFVALGVVPV 338

Query: 155 LIN 157
           ++ 
Sbjct: 339 VMG 341


>gi|291303312|ref|YP_003514590.1| type II secretion system protein [Stackebrandtia nassauensis DSM
           44728]
 gi|290572532|gb|ADD45497.1| type II secretion system protein [Stackebrandtia nassauensis DSM
           44728]
          Length = 220

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 11/143 (7%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P ALD+    + +G P+  A++      +  + + FRR   +  LG +L+E+++    +
Sbjct: 79  LPFALDVFAACLHSGAPLDRALSTCAEAVNPALANRFRRAARSLTLGATLAEALT---EF 135

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR-DRKNMKAKVQALSMEAKASAWIIG 134
             L +       I   +  G  L+++L  L++ LR DR+       ALS   +A  W++ 
Sbjct: 136 DSLADGHRLVQTIGRSADTGARLADSLHLLAKELRFDREQ-----AALSHAHRAGVWMV- 189

Query: 135 SLPFCVSTLVYFTSPGYMNVLIN 157
            LP C+  L  F + G + V+I+
Sbjct: 190 -LPLCLCFLPAFIAAGLLPVVIS 211


>gi|237733160|ref|ZP_04563641.1| predicted protein [Mollicutes bacterium D7]
 gi|229383704|gb|EEO33795.1| predicted protein [Coprobacillus sp. D7]
          Length = 315

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 68/162 (41%), Gaps = 15/162 (9%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           PNALD I++                  +S  + +E   V +  +LG  LS+S      ++
Sbjct: 161 PNALDEIIKE---------------QNTSQVLINELITVKQNLNLGYPLSKSFMLAYEHL 205

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
            ++E+  F+  +SV  + GGN+ E L       + +  +K   +      K S  +   +
Sbjct: 206 QIEEIKTFAMTLSVYEETGGNIIEVLKANDNFFQSKIKIKNTQKVYISSLKTSQKLTVGI 265

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           P     LV F +P +         G ++  +A +F+L GI +
Sbjct: 266 PLGFIVLVIFINPSFFGDFYGTAVGELVGIIAISFLLFGIFL 307


>gi|46143337|ref|ZP_00204444.1| COG2064: Flp pilus assembly protein TadC [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208032|ref|YP_001053257.1| tight adherence protein C [Actinobacillus pleuropneumoniae L20]
 gi|126096824|gb|ABN73652.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 281

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 77/157 (49%), Gaps = 6/157 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           ++K +  + ++D P  +D++  +V+ G+ +  A   VA+     +  +     R+I    
Sbjct: 126 ILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDFEHLNADLTYVILRIIRKAE 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  SLS ++  M   +P +E+  F TV+      G +L E L  LS  +R+ + +  + +
Sbjct: 186 LT-SLSTALQDMAISLPTKEIRMFCTVMQQSLNFGSSLYEHLTQLSADIREMQLLVMEEK 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             ++ AK S  +I  + F +  L+   +PG M VL N
Sbjct: 245 LGTLSAKMSIPLILFIMFPIIILI--VAPGAMRVLPN 279


>gi|207728101|ref|YP_002256495.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
 gi|206591346|emb|CAQ56958.1| pilus assembly protein tadc [Ralstonia solanacearum MolK2]
          Length = 314

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 81/156 (51%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIETQ-HL 61
           I++R     + FP++LD+I+  V AGL +  AV  +V +  ++ P  +E   ++  +   
Sbjct: 153 IRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYEILTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL+  +++  +     +++VS    ++    + G +++E+L   S +LR +++M A+ +A
Sbjct: 213 GLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNVL 155
               AK S  I+  L FC+  S  V    P  + V+
Sbjct: 273 ----AKISTKILFPLIFCIFPSLFVVLLGPAAIQVV 304


>gi|125973853|ref|YP_001037763.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|256004307|ref|ZP_05429289.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum DSM 2360]
 gi|281418015|ref|ZP_06249035.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|125714078|gb|ABN52570.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991741|gb|EEU01841.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum DSM 2360]
 gi|281409417|gb|EFB39675.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|316939949|gb|ADU73983.1| Type II secretion system F domain [Clostridium thermocellum DSM
           1313]
          Length = 268

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 86/193 (44%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRR 54
           K +I+KR ++    F + L  I  S+ AG  V  A       + ++       +  E   
Sbjct: 76  KDIIEKRKSELNLQFKDLLYSISASLTAGKSVETAFKEALNDLCILYPDPDTYIIREVEY 135

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    +  ++ +++  + +   L+++  F+ V     + GGNL   + N + I+ D+  
Sbjct: 136 IVRRLEMNETIEDALEDLAKRSHLEDIQNFTDVFKTCKRTGGNLVNVIRNSTNIINDKIE 195

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  L    K    ++  +PF +  ++  T+  YM  + +   G +++  A   + I
Sbjct: 196 IKEEINTLLAAKKFEQKVLSVMPFIMILILSLTTEDYMAPVFDTIVGRIVMTFAIIIIAI 255

Query: 175 GIMVMRLMINFDV 187
           G  V + +++  +
Sbjct: 256 GYFVSKKIMDIKI 268


>gi|165975969|ref|YP_001651562.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190149860|ref|YP_001968385.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251577|ref|ZP_07337751.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252182|ref|ZP_07338350.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245407|ref|ZP_07527495.1| hypothetical protein appser1_6120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247522|ref|ZP_07529567.1| hypothetical protein appser2_5180 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249754|ref|ZP_07531732.1| hypothetical protein appser4_5560 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252110|ref|ZP_07534009.1| hypothetical protein appser6_6280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254362|ref|ZP_07536200.1| hypothetical protein appser9_6100 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256569|ref|ZP_07538350.1| hypothetical protein appser10_5740 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258820|ref|ZP_07540552.1| hypothetical protein appser11_6180 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260999|ref|ZP_07542681.1| hypothetical protein appser12_5660 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307263184|ref|ZP_07544805.1| hypothetical protein appser13_6060 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|165876070|gb|ABY69118.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189914991|gb|ACE61243.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302648965|gb|EFL79153.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302649575|gb|EFL79757.1| tight adherence protein C [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853748|gb|EFM85965.1| hypothetical protein appser1_6120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856025|gb|EFM88183.1| hypothetical protein appser2_5180 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858169|gb|EFM90247.1| hypothetical protein appser4_5560 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860410|gb|EFM92424.1| hypothetical protein appser6_6280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862661|gb|EFM94617.1| hypothetical protein appser9_6100 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864979|gb|EFM96881.1| hypothetical protein appser10_5740 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867171|gb|EFM99027.1| hypothetical protein appser11_6180 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869301|gb|EFN01096.1| hypothetical protein appser12_5660 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871546|gb|EFN03269.1| hypothetical protein appser13_6060 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 281

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 77/157 (49%), Gaps = 6/157 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           ++K +  + ++D P  +D++  +V+ G+ +  A   VA+     +  +     R+I    
Sbjct: 126 ILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDFEHLNADLTYVILRIIRKAE 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  SLS ++  M   +P +E+  F TV+      G +L E L  LS  +R+ + +  + +
Sbjct: 186 LT-SLSAALQDMAISLPTKEIRMFCTVMQQSLNFGSSLYEHLTQLSADIREMQLLVMEEK 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             ++ AK S  +I  + F +  L+   +PG M VL N
Sbjct: 245 LGTLSAKMSIPLILFIMFPIIILI--VAPGAMRVLPN 279


>gi|170725110|ref|YP_001759136.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810457|gb|ACA85041.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 287

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQ 59
           +  L KKR A  +   P  LD +  S+ AGL ++ A++  V +  S P+R EF +VI   
Sbjct: 131 LNDLRKKRQALIVKSLPVYLDYLTMSIEAGLNMTGAISQAVERGPSGPLRIEFEKVIRDM 190

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G+S ++S   M   + + E++   + ++   + G +L + L   S   R  +  +A+ 
Sbjct: 191 RAGMSRAQSFRNMAERVQITEINSLVSALAQAEKTGASLGQTLRVQSDQRRIERFQRAEK 250

Query: 120 QALSMEAK 127
           +AL    K
Sbjct: 251 KALEAPVK 258


>gi|261409010|ref|YP_003245251.1| Type II secretion system F domain-containing protein [Paenibacillus
           sp. Y412MC10]
 gi|261285473|gb|ACX67444.1| Type II secretion system F domain protein [Paenibacillus sp.
           Y412MC10]
          Length = 290

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 77/158 (48%), Gaps = 10/158 (6%)

Query: 2   KHLIKKRTAKFLD---DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRV 55
           K L KK T +  D   + P  L+ IV  V AG  V  A+   V ++ D   P+ +E +R+
Sbjct: 132 KDLHKKVTLREQDIVMELPELLNKIVLLVGAGETVQRAIIHCVERNEDASHPLYAELKRM 191

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKN 114
           +     G    ++  +  +   +QEVS F+T + +  + GGN    AL +LSR+L +++ 
Sbjct: 192 VLEWEGGHPFQQAFEQFNKRCGVQEVSIFTTTVLLNFRRGGNDFVLALRDLSRVLWEKRK 251

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYM 152
             A+ +    E  +S  ++  +   +  +V   +P +M
Sbjct: 252 AIARTRG---EQASSKLVLPMVVIFMIVIVLLGAPAFM 286


>gi|254506677|ref|ZP_05118817.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
 gi|219550258|gb|EED27243.1| Flp pilus assembly protein TadC [Vibrio parahaemolyticus 16]
          Length = 314

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + + + KR ++     P+ALD++V    +GL  S A+  +  +   S      E   V  
Sbjct: 154 LNYFVNKRQSRIRGGVPDALDLLVVCTESGLGFSAALRRVADELMISHPDFADELDTVCV 213

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +S++   +V    ++E++   T++S  S++GG+LS+ L   +   RD++N + 
Sbjct: 214 KIKAGVEMSDAFDDLVERTGIKELAGLVTMLSHASRIGGSLSQTLREYTEDFRDKRNQEI 273

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 274 EEIAAKIPTK 283


>gi|89053483|ref|YP_508934.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863032|gb|ABD53909.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 326

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 10/150 (6%)

Query: 2   KHLIKKRTAKFLDD----FPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRR 54
           K+ I KR     D     FP+ALD+++  V AG  +  A+  +  +   S  P+  EF  
Sbjct: 163 KYWITKRAQTREDQINSGFPDALDLMLVCVEAGQSLDQAIIKVANEIKTSYPPLAEEFEI 222

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V      G   ++ +  M   + +Q+V+ F T +   S  G +++EAL   S  +RD++ 
Sbjct: 223 VSYEMKAGKDKTKVLRDMGERVGIQDVNSFITTLIQSSTFGTSVAEALKVYSDEMRDKRI 282

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLV 144
            +A+ +A  +  K + +   ++ FCV  L+
Sbjct: 283 SRAEEKANKLPTKLTLF---TMLFCVPPLL 309


>gi|291460200|ref|ZP_06599590.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417147|gb|EFE90866.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 256

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 88/191 (46%), Gaps = 8/191 (4%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRRVI 56
           L K+R  K L +F  AL ++   + AG  + +A       ++ ++G+++  +  EF+++ 
Sbjct: 67  LRKQRQRKLLLEFREALSVLSSFLGAGYSLENAFRLSGRELSSLLGENA-MISREFQKIS 125

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
           E     L + + +        L E+  FS + SV  + GG L   +   S ++ D+  + 
Sbjct: 126 EGLEQKLPIEDLLFDFSTRSGLDEIRNFSELFSVARKSGGELETIIRRSSELIHDKIGIS 185

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            ++  LS   +    I+  +PF +   +  +SP ++ +L     G +L+       L+ +
Sbjct: 186 EEILTLSAARRYEQRIMNLIPFLLLLYMKLSSPDFLRILYETAAGRILMSFCLFLYLLAV 245

Query: 177 MVMRLMINFDV 187
            +   +++ +V
Sbjct: 246 RLSERILDIEV 256


>gi|84685156|ref|ZP_01013055.1| Putative Flp pilus assembly protein TadC [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666888|gb|EAQ13359.1| Putative Flp pilus assembly protein TadC [Rhodobacterales bacterium
           HTCC2654]
          Length = 329

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVI 56
           +K  I+ R A+    FPNALD++  S  AG+   DA    VGQS    S  +  EF    
Sbjct: 169 LKRKIRARQAEIEAGFPNALDLLQISTEAGMGF-DAAMTRVGQSLATVSPAISEEFLLCQ 227

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                     ++++ M   M + EVS F+ V+S   + G ++++AL   +  +R+ + MK
Sbjct: 228 AEILASRDRRQALADMAERMGVAEVSAFAQVVSQSMEYGTSIAKALNAYAAEMREMREMK 287

Query: 117 A 117
           A
Sbjct: 288 A 288


>gi|300856045|ref|YP_003781029.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
 gi|300436160|gb|ADK15927.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 306

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I+ R  K L D P  LD+I  SV AGL    A+A ++      +  EF + ++   +G+ 
Sbjct: 152 IQNRKNKILKDLPYTLDLITVSVEAGLSFDGAIARVISNIRGELCDEFAKSLKEITMGIE 211

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL----ANL---SRILRDRKNMKA 117
              ++  M     ++E+S F + +    +LG +LS+ L    ANL    R +   K MKA
Sbjct: 212 RKAALKNMSERCDVKELSMFISSLIQADELGVSLSKVLRIESANLREHRRQVSREKAMKA 271

Query: 118 KVQAL 122
            ++ L
Sbjct: 272 PIKML 276


>gi|148976656|ref|ZP_01813343.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
 gi|145964007|gb|EDK29265.1| putative tight adherence TadC-related transmembrane protein
           [Vibrionales bacterium SWAT-3]
          Length = 323

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 66/130 (50%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +  + K+R  K  +  P+ALD++V    +GL  + A+  +  +   S   +  E   V  
Sbjct: 158 LNKMQKERQRKIRNGVPDALDLLVVCTESGLGFNAALGRVANELYISQPELADELDTVCA 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+++ ++++++V    L E+    +++S  S++GG+L++ L + +   RD++   A
Sbjct: 218 KIQAGVTMPDALTQLVERTGLHELEGLVSLLSHASRMGGSLAQTLRDYTDDFRDKRQQAA 277

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 278 EEIAAKIPTK 287


>gi|297618076|ref|YP_003703235.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145913|gb|ADI02670.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 295

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R+   L   P+ LD++  SV AGL    A+  +V +S  P+  EF   +    +G   
Sbjct: 144 RQRSEGILKSLPDVLDLLSVSVEAGLGFDAALQKVVEKSQGPLADEFDTALNEIRMGKPR 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
            E++  M R + + +VS F   +     LG ++S  L   +  +R ++  +A+ +A
Sbjct: 204 REALRDMARRVEVDDVSTFVGAVVQADTLGVSISNVLTVQAEQVRQKRRQRAEEKA 259


>gi|289675689|ref|ZP_06496579.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           FF5]
          Length = 96

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 50/89 (56%)

Query: 95  GGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           GGN SE + NL +++RDR+    +++A++ E + +A ++  LP  ++      +P Y+  
Sbjct: 5   GGNASELMENLIKLIRDREQAGRQLRAMTGETRMTAVVLALLPISMAGYFLAVNPNYLLH 64

Query: 155 LINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           + +D  G ++L  A A    G +V+  M+
Sbjct: 65  MWDDESGKIMLSAAFALQATGCVVLWRML 93


>gi|87310969|ref|ZP_01093094.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
 gi|87286259|gb|EAQ78168.1| probable integral membrane protein [Blastopirellula marina DSM
           3645]
          Length = 288

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 3/124 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI---VGQSSDPVRSEFRRVIE 57
           ++   ++R  +  +  P+ +D++V  +  G+  ++A++ +   +  +   +  E   V  
Sbjct: 115 LRSCTQQRQKRLRESLPDFVDLVVTCLEGGMGAAEAISHVHQELTSTHADLSYELGLVAR 174

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              LG+SL +S  RM     ++EV   ST +    + G  + EA+  LS +LR ++  +A
Sbjct: 175 DGTLGISLDKSFRRMAERTGVEEVRTLSTFLEHSQRFGSAMGEAMHELSDMLRYQREQRA 234

Query: 118 KVQA 121
           + +A
Sbjct: 235 EERA 238


>gi|225572861|ref|ZP_03781616.1| hypothetical protein RUMHYD_01052 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039787|gb|EEG50033.1| hypothetical protein RUMHYD_01052 [Blautia hydrogenotrophica DSM
           10507]
          Length = 247

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 88/177 (49%), Gaps = 25/177 (14%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAV-------IVGQSSDPVRSEFRRVIE 57
           I+++  +    F + LD +  +++AG  V +A+++       + G+ +D  R E R + +
Sbjct: 59  IREQQRELNYQFKDMLDSLNVTLQAGYSVENAISLCARELERLYGREADLTR-ELREMED 117

Query: 58  TQHLGLSLSESISRMVRYMPL------QEVSFFSTVISVQSQLGGNLSEALANLSRILRD 111
                L LS  + R+  +M L      ++V  F+ V     + GG++ + L   +++L D
Sbjct: 118 K----LKLSVPVERL--FMDLGSRSHSEDVENFAVVFQTAKRSGGDMRKILEKSAQMLGD 171

Query: 112 RKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
           +  +K +++A+    K+   ++  +PF +   +  TSPG++ VL  +     L GVA
Sbjct: 172 KIEVKKEIEAVLTAKKSEQRLMSVMPFGIILYMSLTSPGFLEVLYGN-----LFGVA 223


>gi|315649137|ref|ZP_07902228.1| Type II secretion system F domain protein [Paenibacillus vortex
           V453]
 gi|315275453|gb|EFU38810.1| Type II secretion system F domain protein [Paenibacillus vortex
           V453]
          Length = 290

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 10/158 (6%)

Query: 2   KHLIKK---RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRV 55
           K L KK   R  + + + P  L+ IV  V AG  V  AV   V ++ D   P+ +E +R+
Sbjct: 132 KDLHKKVMLREQEIIMELPELLNKIVLLVGAGETVQRAVIHCVERNKDMNHPLYAELKRM 191

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKN 114
           +     G    ++  +  +   +QEVS F+T + +  + GGN    AL +LSR+L +++ 
Sbjct: 192 VLEWEGGHPFQQAFEQFNKRCGVQEVSIFTTTVLLNFRRGGNDFVMALRDLSRVLWEKRK 251

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYM 152
              + +    E  +S  ++  +   +  +V   +P +M
Sbjct: 252 AIGRTRG---EQASSKLVLPMVVIFMIVIVLLGAPAFM 286


>gi|56460010|ref|YP_155291.1| Flp pilus assembly protein TadB [Idiomarina loihiensis L2TR]
 gi|56179020|gb|AAV81742.1| Flp pilus assembly protein TadB [Idiomarina loihiensis L2TR]
          Length = 233

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 11/187 (5%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +HL K+R  K     P  L  +   +R+G  V  A+  + G    P+  E   ++  + +
Sbjct: 46  RHLKKQRYIKIEKQLPGMLIGLSNQLRSGTSVGAALKNLKGTLLAPLGQEVDELLRQEKV 105

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQS-----QLGGNLSEALANLSRILRDRKNMK 116
           G  L++ +    R +P+     FS  + VQS     + GG  S+    L+  L+ ++++K
Sbjct: 106 GKPLTDCLEDWQRRVPV-----FSIKLVVQSLVLGLKSGGQQSDLFLRLADNLQQQQHIK 160

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI-G 175
            +   L+ +A+  A I+  +P  +  L+ +    +  +      G  +L VA   M+I G
Sbjct: 161 ERQITLTSQARMQAKILVMMPVGLYFLLSWMKSEHTALFTESRVGIFMLIVALILMIIGG 220

Query: 176 IMVMRLM 182
            MV R+M
Sbjct: 221 WMVKRIM 227


>gi|186473167|ref|YP_001860509.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184195499|gb|ACC73463.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 292

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 1/128 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQ 59
           M+ + ++  A  L   P  LD +  +V AGL V+ A+   V +  D P+R EF  V+   
Sbjct: 134 MRDVRRRYVATVLRQLPIYLDFLTLAVEAGLNVNGAIQKAVEKGPDGPLRREFEHVLRDL 193

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             GL   +++ R      + EVS     I+   ++G  L++ L   S   R  +  +A+ 
Sbjct: 194 KSGLKRGDALRRFDERQQIGEVSNLVRTIAQAERMGSGLAKTLRFQSEQRRAERFQRAEK 253

Query: 120 QALSMEAK 127
           QA+    K
Sbjct: 254 QAMEAPVK 261


>gi|121534350|ref|ZP_01666174.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307120|gb|EAX48038.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 308

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 76/156 (48%), Gaps = 13/156 (8%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K  ++KR+ +   D P+ LD++  SV AGL    A+A +  +    +  EF R ++   +
Sbjct: 153 KIAMRKRSIQ--KDLPDVLDLLTVSVEAGLGFDGALAKLSEKMKGALVDEFTRALQEMRM 210

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+   E++  M     + ++S F+T +    QLG ++ + L   S  +R+++  + + Q 
Sbjct: 211 GVPRREALRAMGLRCDVPDLSLFTTSLIQADQLGVSIGQVLRVQSASMREKR--RQRTQE 268

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           L+M+A         LP     LV+F  P    V++ 
Sbjct: 269 LAMKAPVKML----LP-----LVFFIFPAIFVVVLG 295


>gi|330893149|gb|EGH25810.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 179

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%)

Query: 47  PVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLS 106
           P++    R+     LG+SL ++           E   F+  + V  + GGN SE + NL 
Sbjct: 2   PLKDGMSRIERNVQLGVSLPDAARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLI 61

Query: 107 RILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
           +++RDR+    +++A++ E + +A ++  LP
Sbjct: 62  KLIRDREQAGRQLRAMTGETRMTALVLALLP 92


>gi|218847958|ref|YP_002454864.1| conserved membrane protein, putative [Bacillus cereus G9842]
 gi|218546089|gb|ACK98482.1| conserved membrane protein, putative [Bacillus cereus G9842]
          Length = 327

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 82/169 (48%), Gaps = 14/169 (8%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGL----PVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +R  KF+++  + + I ++++   L     V DA+  +       +R E  +      
Sbjct: 141 VHRRKYKFVEN--DRISIYMKTMTNSLHILGTVIDAIEEVKPLVHSSIREELDKATFKLK 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G S++E++S + +  P +E+ FF  ++ V  + GG  +EAL +++    DRK  + ++ 
Sbjct: 199 QGKSVAEALSSLDKKYPYKELMFFHEMLDVADKNGGKNTEALESIALDFEDRKVKQMQLY 258

Query: 121 ALSMEA----KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLL 165
           A + +     + +A I+ +LPF       F  P   ++L+  P G ++ 
Sbjct: 259 AETTQGMKAFRNTAAIVIALPFIFK----FFMPQAYSILMRTPLGSIVF 303


>gi|323486496|ref|ZP_08091819.1| hypothetical protein HMPREF9474_03570 [Clostridium symbiosum
           WAL-14163]
 gi|323400199|gb|EGA92574.1| hypothetical protein HMPREF9474_03570 [Clostridium symbiosum
           WAL-14163]
          Length = 257

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 83/192 (43%), Gaps = 12/192 (6%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRV 55
           K L  +R  +    F  A+ I+  S+ AG  V +A A  + +  +       +  EF  +
Sbjct: 66  KELALQRQEELRRQFKEAVLILSSSLGAGYSVENAFAGSLRELEELYGREGMITKEFSYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                +  ++   ++       L+E+  FS + +V  +  G L   + +   ++ DR  +
Sbjct: 126 AHQLRMNRTVETLLAEFADRSGLEEIKNFSDIFAVSKRSRGELVSVVNHTVHVISDRLQV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH------MLLGVAA 169
           + ++  ++ E +    I+  +P+C+   + F+SPG+   +     G       +L+  A+
Sbjct: 186 REEILTMTAEKQFEQKIMNLVPYCIVIYIEFSSPGFFRQMYGTAAGRVVMTGCLLIYCAS 245

Query: 170 AFMLIGIMVMRL 181
            F+   I+ + L
Sbjct: 246 CFLAFKILDIEL 257


>gi|303238718|ref|ZP_07325251.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302593837|gb|EFL63552.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 264

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 88/193 (45%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRR 54
           K +I+KR  +    F + L  +  S+ AG  +  +       +++I   S+  +  E   
Sbjct: 72  KEIIEKRKNELNLQFRDMLYSLSSSLSAGKSIESSFKEVLKDLSIIYPDSNSFIIKEVEY 131

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    +  ++  ++        L+++  F  V+    + GGN+ + + N S I+ D+  
Sbjct: 132 IVRKIEMNETIESALEDFAARSHLEDIENFVDVLQTSKRTGGNIVDIIKNSSNIISDKIE 191

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  L    K    I+  +P  +   +  ++  YM  + +D RG +++ ++ A ++I
Sbjct: 192 VKEEIDTLLASRKFEQKILALMPVMLILFLSLSTGDYMYPVFHDLRGRLVMTLSLALIII 251

Query: 175 GIMVMRLMINFDV 187
              + + ++N  V
Sbjct: 252 AYFISKKIMNIKV 264


>gi|90411198|ref|ZP_01219211.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
 gi|90328044|gb|EAS44365.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Photobacterium profundum 3TCK]
          Length = 224

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 7/138 (5%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQHLG 62
           KKR  K  + FP+ALD++V +  AGL    A   VA  +   S  + +E + V     LG
Sbjct: 68  KKRIRKLSNAFPDALDLLVVTTEAGLGFLAALNRVANEIDAISPELSNELQIVCRKVRLG 127

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + +  ++++ +    L E+    ++IS   +LG ++ + L   +   RDR+  KA+ +A 
Sbjct: 128 VPMPIALAQFIERTGLLELQGLVSIISQSVKLGSSMGDTLREYAIEFRDRRMQKAEEEA- 186

Query: 123 SMEAKASAWIIGSLPFCV 140
              AK    +I  L  C+
Sbjct: 187 ---AKIGTKMIFPLVTCI 201


>gi|156741661|ref|YP_001431790.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232989|gb|ABU57772.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 311

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ALD++   V AGL    A+  +  +  DP+  EF+RV+    LG    +++  M+  
Sbjct: 166 LPDALDLLCICVEAGLSFDQAMQRLTEKWEDPLSKEFKRVLSDTRLGRPRRDAMKDMIDR 225

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
             + +V  F   +    QLG ++   L   S  +R R+  +A+ +A
Sbjct: 226 CGVDDVQTFIGAVIQAEQLGVSIGRILRIQSDQMRIRRRQRAEEEA 271


>gi|323694363|ref|ZP_08108536.1| hypothetical protein HMPREF9475_03400 [Clostridium symbiosum
           WAL-14673]
 gi|323501603|gb|EGB17492.1| hypothetical protein HMPREF9475_03400 [Clostridium symbiosum
           WAL-14673]
          Length = 257

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 83/192 (43%), Gaps = 12/192 (6%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRV 55
           K L  +R  +    F  A+ I+  S+ AG  V +A A  + +  +       +  EF  +
Sbjct: 66  KELALQRQEELRRQFKEAVLILSSSLGAGYSVENAFAGSLRELEELYGREGMITKEFSYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                +  ++   ++       L+E+  FS + +V  +  G L   + +   ++ DR  +
Sbjct: 126 AHQLRMNRTVETLLAEFADRSGLEEIKNFSDIFAVSKRSRGELVSVVNHTVHVISDRLQV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH------MLLGVAA 169
           + ++  ++ E +    I+  +P+C+   + F+SPG+   +     G       +L+  A+
Sbjct: 186 REEILTMTAEKQFEQKIMNLVPYCIVIYIEFSSPGFFRQMYGTAAGRVVMTGCLLIYCAS 245

Query: 170 AFMLIGIMVMRL 181
            F+   I+ + L
Sbjct: 246 CFLSFKILDIEL 257


>gi|294102185|ref|YP_003554043.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617165|gb|ADE57319.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
          Length = 296

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 59/116 (50%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K+R  +  +  P+ +D++V SV AGL +  A++ +  +   P+   F R +    LG S 
Sbjct: 143 KQRQVEARNQLPDVMDLMVVSVEAGLGLDAAMSRVADRLRGPMGENFARALHEISLGESR 202

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
             +   ++  +P++EV  F   +    +LG  +SE L + +  L+  + +KA+  A
Sbjct: 203 QAAFRGIMERLPIEEVRHFIASLIQAEELGVAVSEVLRSQAGTLKRLRRLKAEEHA 258


>gi|53723215|ref|YP_112200.1| hypothetical protein BPSS2198 [Burkholderia pseudomallei K96243]
 gi|76819357|ref|YP_336475.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|126455503|ref|YP_001076997.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167744183|ref|ZP_02416957.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167821382|ref|ZP_02453062.1| type II secretion system protein [Burkholderia pseudomallei 91]
 gi|167829724|ref|ZP_02461195.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167851191|ref|ZP_02476699.1| type II secretion system protein [Burkholderia pseudomallei B7210]
 gi|167899821|ref|ZP_02487222.1| type II secretion system protein [Burkholderia pseudomallei 7894]
 gi|167916485|ref|ZP_02503576.1| type II secretion system protein [Burkholderia pseudomallei 112]
 gi|167924342|ref|ZP_02511433.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
 gi|217424204|ref|ZP_03455703.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226194113|ref|ZP_03789713.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237510430|ref|ZP_04523145.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254182575|ref|ZP_04889169.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|254187127|ref|ZP_04893642.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254192523|ref|ZP_04898962.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254296491|ref|ZP_04963947.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52213629|emb|CAH39683.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76583830|gb|ABA53304.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Burkholderia pseudomallei 1710b]
 gi|126229271|gb|ABN92684.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157806389|gb|EDO83559.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934810|gb|EDO90480.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169649281|gb|EDS81974.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|184213110|gb|EDU10153.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|217392669|gb|EEC32692.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225933806|gb|EEH29793.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002635|gb|EEP52059.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 319

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 158 IAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 211

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FST++    + G ++  +L  LS  LR ++ M
Sbjct: 212 LLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRM 271

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 272 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 308


>gi|329928959|ref|ZP_08282769.1| type II secretion system protein F domain protein [Paenibacillus
           sp. HGF5]
 gi|328937211|gb|EGG33638.1| type II secretion system protein F domain protein [Paenibacillus
           sp. HGF5]
          Length = 290

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 10/158 (6%)

Query: 2   KHLIKKRTAKFLD---DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRV 55
           K L KK T +  D   + P  L+ IV  V AG  V  A+   V ++ D   P+ +E +R+
Sbjct: 132 KDLHKKVTLREQDIVMELPELLNKIVLLVGAGETVQRAIIHCVERNKDTSHPLYAELKRM 191

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKN 114
           +     G    ++  +  +   +QEVS F+T + +  + GGN    AL +LSR+L +++ 
Sbjct: 192 VLEWEGGHPFQQAFEQFNKRCGVQEVSIFTTTVLLNFRRGGNDFVLALRDLSRVLWEKRK 251

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYM 152
              + +    E  +S  ++  +   +  +V   +P +M
Sbjct: 252 AITRTRG---EQASSKLVLPMVVIFMIVIVLLGAPAFM 286


>gi|317491688|ref|ZP_07950123.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920122|gb|EFV41446.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 279

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 73/156 (46%), Gaps = 6/156 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIETQHL 61
           I  R    LD  P  +D+I   V+AG+ V  +V  I  +S+D    +      +++   +
Sbjct: 124 INTRIKLMLDALPYFVDLIAVCVQAGMTVESSVKFIAERSADLDKNLADLMLHLVKRAEV 183

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
              L E +  + R M + E+  F   +      G +L E L  LS+ +RD + + ++ + 
Sbjct: 184 S-GLEEGLMDLYRSMDMTEMRMFCATLQQSVHYGTSLYENLMELSKDIRDMQLLNSEEKI 242

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             + AK S  +I  + F ++ L+   +PG + ++ N
Sbjct: 243 GKLSAKMSVPLILFIMFPITILI--AAPGILRIMQN 276


>gi|322384399|ref|ZP_08058085.1| hypothetical protein PL1_0931 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321150757|gb|EFX44217.1| hypothetical protein PL1_0931 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 223

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 77/153 (50%), Gaps = 8/153 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD----PVRSEFRRVIETQH 60
           +KK+    L + P  L+ I+  V AG  V  +    +   ++    P+++E  +      
Sbjct: 71  LKKKKHSILIELPEFLNKIILLVDAGETVQASFIRCIDDRAEKPLSPLQAELIKCKRELL 130

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
           + +SL++S+  + R   +QE+S F+T + +  + GG +L+ AL NLS+ L +R+  KA  
Sbjct: 131 MNVSLNKSLGELTRRCSMQEISMFTTTVLLNYKRGGHDLTVALRNLSKDLWERR--KAVS 188

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYM 152
           + L  EA +      +L F +  +V   +P  M
Sbjct: 189 RILGEEASSKLVFPMALIFLI-VIVIVAAPAMM 220


>gi|317500896|ref|ZP_07959107.1| hypothetical protein HMPREF1026_01050 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897694|gb|EFV19754.1| hypothetical protein HMPREF1026_01050 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 205

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 78/174 (44%), Gaps = 6/174 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI------VGQSSDPVRSEFRR 54
           ++ L +KR  +F   F NA+  +  +++AG  V +A+         + + +  +R EFR+
Sbjct: 13  LRDLCRKREKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 72

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 73  MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 132

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + + 
Sbjct: 133 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENAAGRCFMTIC 186


>gi|326205012|ref|ZP_08194862.1| Flp pilus assembly protein TadB-like protein [Clostridium
           papyrosolvens DSM 2782]
 gi|325984817|gb|EGD45663.1| Flp pilus assembly protein TadB-like protein [Clostridium
           papyrosolvens DSM 2782]
          Length = 247

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 66/134 (49%)

Query: 51  EFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR 110
           E + +I    L +S+ ++IS       + ++  FS VI +  + GGNL EA+ N SRI+ 
Sbjct: 111 ETKIIINKLSLNVSIEDAISEFADRSDIDDIKNFSDVIIICKRTGGNLVEAIKNSSRIIS 170

Query: 111 DRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAA 170
           ++  MK +++ L    +    I+  +P  +  ++  T+  Y+  +     G + + +   
Sbjct: 171 EKIEMKQEIETLLSSRRFEQKILNIMPIAMIFILSTTAGEYIKPVFITVTGRIAVTLCLV 230

Query: 171 FMLIGIMVMRLMIN 184
            +++  ++   ++N
Sbjct: 231 LLIVAYLISNKIMN 244


>gi|167463709|ref|ZP_02328798.1| type II secretion system protein [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 288

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 68/130 (52%), Gaps = 7/130 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD----PVRSEFRRVIETQH 60
           +KK+    L + P  L+ I+  V AG  V  +    +   ++    P+++E  +      
Sbjct: 136 LKKKKHSILIELPEFLNKIILLVDAGETVQASFIRCIDDRAEKPLSPLQAELIKCKRELL 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
           + +SL++S+  + R   +QE+S F+T + +  + GG +L+ AL NLS+ L +R+  KA  
Sbjct: 196 MNVSLNKSLGELTRRCSMQEISMFTTTVLLNYKRGGHDLTVALRNLSKDLWERR--KAVS 253

Query: 120 QALSMEAKAS 129
           + L  EA + 
Sbjct: 254 RILGEEASSK 263


>gi|119962497|ref|YP_948623.1| type II secretion system protein F [Arthrobacter aurescens TC1]
 gi|119949356|gb|ABM08267.1| putative bacterial type II secretion system protein F domain
           [Arthrobacter aurescens TC1]
          Length = 296

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 68/153 (44%), Gaps = 6/153 (3%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R      + PN LD ++ SV AGL    A+A      S P+  E  R ++    G S  
Sbjct: 143 ERQKAIQTELPNTLDQMLISVEAGLGFEGAMARAGQNGSGPLAMEMLRTLQDMQAGRSRK 202

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E+   +   + + ++  F   I      G  ++  L   ++ +R ++  +A+ QA+ +  
Sbjct: 203 EAYVALAERVDVHDLRAFVGAIVQADTYGIAIANVLRTQAKQMRIKRRQRAEEQAMKLPV 262

Query: 127 KASAWIIGSLPFCVSTLVYFT--SPGYMNVLIN 157
           K    ++  L FC+  +++     P  +NV+ N
Sbjct: 263 K----VLFPLMFCILPVLFIVIMGPAVLNVMTN 291


>gi|260574611|ref|ZP_05842614.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023028|gb|EEW26321.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 326

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 78/157 (49%), Gaps = 7/157 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIETQHL 61
           +KKR A+ +  FP+ALD+++  V AG  +  ++  +  +S      +  EF  V +    
Sbjct: 167 VKKRQAEIVSGFPDALDMMLVCVEAGQSMDQSIIRVARESRAGYPALADEFDMVAQEIKA 226

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  +  M   + + +V+ F T +   +  G +++EAL   S  +RD++ M+A+ +A
Sbjct: 227 GKERTTVMRDMSERVGIADVASFVTTLVQSATFGTSIAEALRVYSAEMRDKRVMRAEEKA 286

Query: 122 LSMEAKASAWIIGSLPFCVST-LVYFTSPGYMNVLIN 157
            ++  K +   +G++ F +   L+    P   N+ + 
Sbjct: 287 NTLPTKLT---LGTMLFTLPPLLIILIGPSIHNIAVT 320


>gi|242311994|ref|ZP_04811011.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254265316|ref|ZP_04956181.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|242135233|gb|EES21636.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254216318|gb|EET05703.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 313

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 152 IAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 205

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FST++    + G ++  +L  LS  LR ++ M
Sbjct: 206 LLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRM 265

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 266 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 302


>gi|91777214|ref|YP_552422.1| putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
 gi|91689874|gb|ABE33072.1| Putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
          Length = 293

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLS 64
           ++R A+ L   P  LD +  +V AGL ++ A+   V +  + P+R E   V+     GL+
Sbjct: 140 RRRVAQILRHLPIYLDFLTLAVEAGLNINGAIQKAVEKGPEGPLRRELEHVLRDLKSGLN 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++ R+   + ++EV+     +    ++G  L+++L   S   R  +  +A+ QA+  
Sbjct: 200 RTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEA 259

Query: 125 EAK 127
             K
Sbjct: 260 PVK 262


>gi|149175457|ref|ZP_01854078.1| putative tight adherence tadb-related transmembrane protein
           [Planctomyces maris DSM 8797]
 gi|148845725|gb|EDL60067.1| putative tight adherence tadb-related transmembrane protein
           [Planctomyces maris DSM 8797]
          Length = 285

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 80/177 (45%), Gaps = 1/177 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K  D   + +D + R+ + G  ++     +  ++  P+  E +       +G+S+ 
Sbjct: 103 RRQNKINDQLSDMIDELARAAKTGRSLTHCFINVAEKTPAPLGDELKEASRRLQMGVSMK 162

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  +     +  ++  S  + V  + GG+L + L  L+R +RDR     +++  +  +
Sbjct: 163 AALDGLYERTGVASLNILSMALIVHQETGGDLVKVLERLARTIRDRVLFLGRLRTATAGS 222

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG-IMVMRLM 182
           +A+A ++  LP  +        P Y+  L+    G      A A  +IG + V+R++
Sbjct: 223 RATAVLMILLPPLILGFFILRDPTYLTTLMASSWGRGATFTAIALQVIGSLWVLRVL 279


>gi|260892669|ref|YP_003238766.1| Flp pilus assembly protein TadB-like protein [Ammonifex degensii
           KC4]
 gi|260864810|gb|ACX51916.1| Flp pilus assembly protein TadB-like protein [Ammonifex degensii
           KC4]
          Length = 285

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 84/173 (48%), Gaps = 3/173 (1%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFR---RVIETQHLGLSLSESISR 71
            +P AL  +  +++ G     A+  +      P+R  F    R + T     +  E++  
Sbjct: 106 QYPMALAALASAMQGGCSFYQALEQVTPTLRPPMRDVFADVLRRVRTSTSPRAYEEAVLE 165

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           + +     +++  +  + +  + GGNL E L +L + L +R++ +  V A++ EA+ +A 
Sbjct: 166 VAKAAGFPDLNSLAMSVGLYQRTGGNLVEVLDHLVKCLYERESDRRYVAAVTAEARVTAA 225

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + +LPF +  +    +P +M  + +   G+ L+   A  +L+G  V+R M++
Sbjct: 226 FLSALPFALMGVFRAVNPEFMRPVFHTLWGNALVVWVALMVLLGNAVVRRMVS 278


>gi|328954941|ref|YP_004372274.1| Type II secretion system F domain protein [Coriobacterium glomerans
           PW2]
 gi|328455265|gb|AEB06459.1| Type II secretion system F domain protein [Coriobacterium glomerans
           PW2]
          Length = 320

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/149 (18%), Positives = 69/149 (46%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P A   +  ++ +G  ++  +  +   + +PVR+EF R   +   G+S + ++ 
Sbjct: 145 KLASAMPEAFGALAIALGSGHSLAQGMRFVGSHAEEPVRTEFLRASFSIVCGMSATSALD 204

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            ++  +P   +   +  + V  + G  L + LA  S ++ DR  +  +++  + +A+ SA
Sbjct: 205 ELLARLPAPGLDLVALALKVSQRTGAPLKDLLAEASEMVGDRIELVRRLEVKTAQARMSA 264

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
            ++  +P  ++ ++   S  +   L   P
Sbjct: 265 RMVALMPVAMTCILALLSKDFQRGLTTAP 293


>gi|171921006|gb|ACB59189.1| TadC [Actinobacillus suis ATCC 33415]
          Length = 281

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 76/155 (49%), Gaps = 6/155 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           ++K +  + ++D P  +D++  +V+ G+ +  A   VA+     +  +     R++    
Sbjct: 126 ILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVAIDFEHLNADLTYVILRIMRKAE 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  SLS ++  M   +P +E+  F TV+      G +L E L  LS  +R+ + +  + +
Sbjct: 186 LT-SLSAALQDMAISLPTKEIRMFCTVMQQSLNFGSSLYEHLTQLSADIREMQLLVMEEK 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
             ++ AK S  +I  + F +  L+   +PG M VL
Sbjct: 245 LGTLSAKMSIPLILFIMFPIIILI--VAPGAMRVL 277


>gi|332798625|ref|YP_004460124.1| Type II secretion system F domain-containing protein
           [Tepidanaerobacter sp. Re1]
 gi|332696360|gb|AEE90817.1| Type II secretion system F domain protein [Tepidanaerobacter sp.
           Re1]
          Length = 307

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 62/126 (49%), Gaps = 3/126 (2%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +++IK++TA +    P+ LD++  SV AGL    A++ +V     P+  E         +
Sbjct: 151 RNIIKRKTAIY-HQLPDTLDLLSVSVSAGLGFDQALSYVVEHMEGPLIQELDTTQREISM 209

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR--DRKNMKAKV 119
           G+   E++ R+       E+  F   I+   +LG ++   +   +  +R   ++N++ + 
Sbjct: 210 GIPRKEALERLAARCECDEIYIFVGAINQADELGASIKNVMETQAAAIRLTHKQNVEEQA 269

Query: 120 QALSME 125
           Q LS++
Sbjct: 270 QKLSVK 275


>gi|317124420|ref|YP_004098532.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315588508|gb|ADU47805.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 291

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 3/175 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  K  D +P+A+D I   VRAGL + +A+A +  +  + +R  F R  E        
Sbjct: 105 RKRRGKLRDLWPDAVDNITSGVRAGLALPEALAQLAVRGPEELRPPFARFAEDYRATGRF 164

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKVQALSM 124
            + + R+   M           + +  ++GG +L   L  LS  LR+    +A+++A   
Sbjct: 165 HDCLDRLKDAMSDPVADRLIESLRIAREVGGSDLGRLLRTLSAFLREDARTRAELEARQS 224

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
               +A +  + P+ V  ++     G +      P G ++L   A   ++   +M
Sbjct: 225 WTINAARLAVAAPWVVLAMLALRG-GSLQAYAT-PTGWLVLAFGAGLCIVAYRLM 277


>gi|292491527|ref|YP_003526966.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580122|gb|ADE14579.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 320

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS--SDPVRS-EFRRVIE 57
           ++ LIKKR  +  + FP+ LD+++    AGL ++ A+  +  +   S PV S E   V  
Sbjct: 159 LERLIKKRQRQIYNGFPDVLDLLITCTEAGLGLNAALKRVAEECAVSHPVLSGELTLVNM 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G++  E++        ++E+  F   +S   + G ++++ L   S   RD++  +A
Sbjct: 219 EIRAGVNRVEALKNFSARAGIEEIHSFVAFLSQSLRFGTSIADTLRIYSDEFRDKRMQRA 278

Query: 118 KVQALSMEAKASAWIIGSLPFCV 140
           +     M AK    +I  L FC+
Sbjct: 279 E----EMAAKMGTKMIFPLIFCI 297


>gi|261252092|ref|ZP_05944665.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
 gi|260935483|gb|EEX91472.1| flp pilus assembly protein TadC [Vibrio orientalis CIP 102891]
          Length = 314

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 64/127 (50%), Gaps = 3/127 (2%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQH 60
           ++ KR ++     P+ALD++V    +GL  + A+  +  +   S      E   V     
Sbjct: 157 MVDKRQSRIRSGIPDALDLLVVCTESGLGFNAALRRVADELTISHPDFADELDTVCVKIS 216

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +S++ + +++   L E++   T+++  S++GG+LS+ L   +   RD++N + +  
Sbjct: 217 AGVEMSDAFNDLIKRTGLSEIAGLVTMLAHASRIGGSLSQTLREYTEDYRDKRNQEIEEI 276

Query: 121 ALSMEAK 127
           A  +  K
Sbjct: 277 AAKIPTK 283


>gi|84387237|ref|ZP_00990258.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
 gi|84377884|gb|EAP94746.1| Flp pilus assembly protein TadC [Vibrio splendidus 12B01]
          Length = 323

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +  L K+R  K  +  P+ALD++V    +GL  + A+  +  +   S      E   V  
Sbjct: 158 LSKLQKERQKKIRNGVPDALDLLVVCTESGLGFNAALGRVASELYVSQPEFADELETVFA 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+++ +++ +++    L E+    +++S  S++GG+L++ L + +   RD++   A
Sbjct: 218 KIQAGVTMPDALRQLIERTGLVELEGLVSLLSHASRMGGSLAQTLRDYTEDFRDKRQQAA 277

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 278 EEIAAKIPTK 287


>gi|302669441|ref|YP_003829401.1| Flp pilus assembly protein TadB [Butyrivibrio proteoclasticus B316]
 gi|302393914|gb|ADL32819.1| Flp pilus assembly protein TadB [Butyrivibrio proteoclasticus B316]
          Length = 254

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 84/179 (46%), Gaps = 8/179 (4%)

Query: 16  FPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
           F +A+  ++ S++AG  + +A       + ++ G++SD +     R+ +     + L + 
Sbjct: 77  FKDAIFSVLTSLKAGFSIENAFMEARRDMDLLYGKNSD-ISFYLSRISKGLRNNVPLEKL 135

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           I  M +     ++  F+ V SV  + GGN++E +     ++  +  ++ +++ L    + 
Sbjct: 136 IFGMGKETTNTDIQDFALVFSVAKRNGGNMTEIIDRTISVISGKLEVEKEIEVLISAKRL 195

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            A I+  +PF +   +  TSPG+ + L ++  G  L+ V      I   +   ++N  +
Sbjct: 196 EARIMNMVPFFIIFYISITSPGFFDALYHNVLGICLMAVCMVIYCISYYLSEKIVNISI 254


>gi|167725257|ref|ZP_02408493.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 275

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 114 IAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 167

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FST++    + G ++  +L  LS  LR ++ M
Sbjct: 168 LLEMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRM 227

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 228 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 264


>gi|254466278|ref|ZP_05079689.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
 gi|206687186|gb|EDZ47668.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
          Length = 326

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 75/154 (48%), Gaps = 4/154 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           I++R  K  + FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V      
Sbjct: 168 IEERKQKITEGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPDLAEEFEVVAYEMKA 227

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G      +  M     +Q++S F TV+   +  G ++++AL   +  +RD++ M+A+  A
Sbjct: 228 GKEKDRVLRDMGTRCGVQDISSFVTVMIQSASFGTSIADALRVYAGEMRDKRVMRAEEAA 287

Query: 122 LSMEAKASAWIIG-SLPFCVSTLVYFTSPGYMNV 154
             +  K +   +G ++P  +  LV  +  G MN+
Sbjct: 288 NKLPVKMTLATMGLTVPPLLIILVGPSIQGIMNM 321


>gi|167840869|ref|ZP_02467553.1| hypothetical protein Bpse38_29619 [Burkholderia thailandensis
           MSMB43]
          Length = 279

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I+ R  K ++DFP+ALD++   V AGL +  A+  +    +D +R   R  I    LGL 
Sbjct: 118 IRLRQRKIIEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPIVADELGLM 171

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  F  ++    + G ++  +L  LS  LR ++ M
Sbjct: 172 LLEIRSGFAKDAALRNLALRTGAEDVDAFCAMLIQADRFGTSIGASLRVLSDTLRTQRRM 231

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 232 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 268


>gi|226325182|ref|ZP_03800700.1| hypothetical protein COPCOM_02974 [Coprococcus comes ATCC 27758]
 gi|225206530|gb|EEG88884.1| hypothetical protein COPCOM_02974 [Coprococcus comes ATCC 27758]
          Length = 301

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 81/182 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K R A+F +    +L ++  ++RAG  +  A+  +   S DP++SE         +   +
Sbjct: 119 KSRKARFDEQLARSLPMVAENMRAGSSIERALRSVGENSDDPLKSELLACAGAMQIDGDI 178

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++  M +    +++      ++   ++GG+L+++L  +   +  R +++  +++ +  
Sbjct: 179 VAALDDMAKRTGSKDLVLLQAAVASHKEVGGSLADSLERIGDTIDARLSLRRHIESETSS 238

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             AS   +  +   +  ++    P   +    DP G  +L V   F   G +++  M + 
Sbjct: 239 VIASMKALIVMLLILFAIIMVGIPQAYDFYTQDPLGIPVLIVVVLFAATGSVIIYKMADI 298

Query: 186 DV 187
           DV
Sbjct: 299 DV 300


>gi|254486075|ref|ZP_05099280.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214042944|gb|EEB83582.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 308

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 75/154 (48%), Gaps = 7/154 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           ++KR  +    FP+ALD+++  V AG  +  ++  +  +   S   +  EF  V      
Sbjct: 153 VEKRKEEITRGFPDALDMMLVCVEAGQSLDQSIVRVAKELHASYPALAEEFEVVAYEMKA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G      ++ M     +Q+VS F TV+   +  G ++S+AL   +  +RD++ M+A+  A
Sbjct: 213 GKDKVGVLTDMGDRCGVQDVSSFVTVLCQSAAFGTSISDALRVYAEEMRDKRVMRAEEAA 272

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
             +  K + A ++ ++P     L+   +P  MN+
Sbjct: 273 NKLPTKMTLATMMLTVP---PLLIILVAPSVMNI 303


>gi|317122043|ref|YP_004102046.1| type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
 gi|315592023|gb|ADU51319.1| Type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
          Length = 331

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 71/156 (45%), Gaps = 15/156 (9%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ +D++  SV AGL    A+  +  +   PV +EFR+ ++   LG+   E++  +   
Sbjct: 189 LPDVMDLLSVSVEAGLGFDGAIQKVSEKFPAPVSTEFRQYLKELRLGVEREEALRSLADR 248

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
             L E+  F+  +    +LG +L+  L   +  LR ++  +A+ QA+    K        
Sbjct: 249 CELPELRSFAAAVIQADRLGVSLARVLRVQAEQLRFQRKQRAEEQAMKTPIK-------- 300

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF 171
               +  LV F  P    VL+    G  L+ + AAF
Sbjct: 301 ---MLLPLVLFIFPTLFIVLL----GPALIQILAAF 329


>gi|251795274|ref|YP_003010005.1| type II secretion system protein [Paenibacillus sp. JDR-2]
 gi|247542900|gb|ACS99918.1| type II secretion system protein [Paenibacillus sp. JDR-2]
          Length = 282

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA-VIVGQSS--DPVRSEFRRVIETQ 59
            L+++R    + + P AL  ++  V AG PV  A +  + G+     P+  E+ RV+   
Sbjct: 129 RLVERRKQAIVSELPEALSKLMLLVGAGEPVLQAFSRCLEGKDPAVQPLYKEWDRVVIAL 188

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN 97
             G S S ++ R  R   +QEVS F+TVI +  + GG+
Sbjct: 189 RNGESFSTALERFNRSCAVQEVSIFTTVILLNYRRGGD 226


>gi|228989138|ref|ZP_04149156.1| hypothetical protein bthur0001_57510 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228770565|gb|EEM19112.1| hypothetical protein bthur0001_57510 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 324

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 86/177 (48%), Gaps = 14/177 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGL----PVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +R  KF+++  + + I ++++   L     V DA+  +       +R E  +      
Sbjct: 138 VHRRKYKFVEN--DRISIYMKTMTNSLHILGTVIDAIEEVKPLVHSSIREELDKATFKLK 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G S++E++S + +  P +E+ F+  ++ V  + GG  +EAL +++    DRK  + ++ 
Sbjct: 196 QGKSVAEALSSLDKKYPYKELIFYHEMLDVADKNGGRNTEALESIALDFEDRKVKQMQLY 255

Query: 121 ALSMEA----KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           A + +     + +A I+ +LPF       F  P   ++L+  P G ++  + +  +L
Sbjct: 256 AETTQGVKSFRNTASIVIALPFIFK----FFMPQAYSILMRTPLGSIVFVLTSLIIL 308


>gi|134299964|ref|YP_001113460.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052664|gb|ABO50635.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 310

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 2/122 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I+ R  +     P+ALD++  SV AGL    A+  +  ++   +  EF  +++  H+G  
Sbjct: 157 IRNRKTQVEKSLPDALDLLTVSVEAGLGFDGALMKVAEKTKGIMADEFILMLQECHMGKP 216

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             E++  M   + + ++S F   I +   LG ++   L   S+ +R ++  + K + L+M
Sbjct: 217 RREALRDMATRLDVDDLSSFCGSIILADTLGISIGNVLRTQSQQMRQKR--RQKTEELAM 274

Query: 125 EA 126
           +A
Sbjct: 275 KA 276


>gi|317498624|ref|ZP_07956917.1| hypothetical protein HMPREF0996_01899 [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316894111|gb|EFV16300.1| hypothetical protein HMPREF0996_01899 [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 252

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 73/168 (43%), Gaps = 13/168 (7%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI-----VGQSSDPVRSEFRRVIE 57
           H + +   K   +F   +  I  S+ AG  + +A+        + +    +  E + +I 
Sbjct: 63  HKVHREKKKLRKEFREMMISIGNSLSAGYSIENALKTAKNDLEMYEEHSLLAKELQLLIN 122

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALAN----LSRILRDRK 113
              +   +   +  M  ++ L+E   F+ VIS+  + GGNL E   N    LS+ ++ ++
Sbjct: 123 KLKMNEPVDNLLFDMAEHVGLEEFYQFAQVISIAKKSGGNLIEITENTIEHLSQAIQTKE 182

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            +   + A  ME K    I+  +P+ +   V   +PGY ++L     G
Sbjct: 183 EIHTMIAAKQMEKK----IMSVMPYFILLYVRIANPGYFDILYESFAG 226


>gi|153815434|ref|ZP_01968102.1| hypothetical protein RUMTOR_01669 [Ruminococcus torques ATCC 27756]
 gi|145847293|gb|EDK24211.1| hypothetical protein RUMTOR_01669 [Ruminococcus torques ATCC 27756]
          Length = 205

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/193 (18%), Positives = 85/193 (44%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI------VGQSSDPVRSEFRR 54
           ++ L +K+  +F   F NA+  +  +++AG  V +A+         + + +  +R EFR+
Sbjct: 13  LRDLCRKKEKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 72

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 73  MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 132

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + +     + 
Sbjct: 133 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENAAGRCFMTICLIVYIA 192

Query: 175 GIMVMRLMINFDV 187
                R +I+ +V
Sbjct: 193 AYSFGRKIIHIEV 205


>gi|89899611|ref|YP_522082.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89344348|gb|ABD68551.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 312

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 75/159 (47%), Gaps = 9/159 (5%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG--QSSDPVRSEFRRVIET 58
           + HL+  R  +  + FP+ALD++   V AGL    A+  +    Q   P  ++  R++  
Sbjct: 147 LSHLVMVRQREIFESFPDALDLMTVCVEAGLGTEAAMMRVADDLQFKSPALADEMRLVNL 206

Query: 59  Q-HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
           +   G     ++  +     ++EV  F T+IS   + G +++ +L   + +LR R+  +A
Sbjct: 207 ELRAGAVRERALRNLAIRTGVEEVDGFVTMISQAERFGTSIAASLRIHAELLRTRRRQRA 266

Query: 118 KVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +  A    AK +  ++  L FC+  S +V    P  + +
Sbjct: 267 EEAA----AKIALKLLFPLIFCIFPSLMVVLMGPAMIQI 301


>gi|331089204|ref|ZP_08338106.1| hypothetical protein HMPREF1025_01689 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330405756|gb|EGG85285.1| hypothetical protein HMPREF1025_01689 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 249

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/174 (18%), Positives = 78/174 (44%), Gaps = 6/174 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA------VIVGQSSDPVRSEFRR 54
           ++ L +K+  +F   F NA+  +  +++AG  V +A+         + + +  +R EFR+
Sbjct: 57  LRDLCRKKEKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 116

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 117 MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 176

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + + 
Sbjct: 177 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENATGRCFMTIC 230


>gi|228949329|ref|ZP_04111592.1| hypothetical protein bthur0007_54450 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228810312|gb|EEM56670.1| hypothetical protein bthur0007_54450 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 327

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 86/177 (48%), Gaps = 14/177 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGL----PVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +R  KF+++  + + I ++++   L     V DA+  +       +R E  +      
Sbjct: 141 VHRRKYKFVEN--DRISIYMKTMTNSLHILGTVIDAIEEVKPLVHPSIREELDKATFKLK 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G S++E++S + +  P +E+ F+  ++ V  + GG  +EAL +++    DRK  + ++ 
Sbjct: 199 QGKSVAEALSSLDKKYPYKELIFYHEMLDVADKNGGRNTEALESIALDFEDRKVKQMQLY 258

Query: 121 ALSMEA----KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
           A + +     + +A I+ +LPF       F  P   ++L+  P G ++  + +  +L
Sbjct: 259 AETTQGVKSFRNTASIVIALPFIFK----FFMPQAYSILMRTPLGSIVFVLTSLIIL 311


>gi|262165914|ref|ZP_06033651.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
 gi|262025630|gb|EEY44298.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus VM223]
          Length = 314

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + H +K+R        P+ALD++V    +GL  + A+  +  +   S      E   V  
Sbjct: 155 LHHFVKERQRTIRAGVPDALDLLVVCTESGLGFNAALRKVADELTISHPEFADELDTVCA 214

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +  +   +V    L E+     ++S  S++GG+LS+ L + +   RD++N + 
Sbjct: 215 KIKAGVEMHTAFDELVARTGLTEIRGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEV 274

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 275 EEIAAKIPTK 284


>gi|258621455|ref|ZP_05716489.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|258627496|ref|ZP_05722277.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|262171240|ref|ZP_06038918.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
 gi|258580302|gb|EEW05270.1| Flp pilus assembly protein TadC [Vibrio mimicus VM603]
 gi|258586843|gb|EEW11558.1| Flp pilus assembly protein TadC [Vibrio mimicus VM573]
 gi|261892316|gb|EEY38302.1| type II/IV secretion system protein TadC associated with Flp pilus
           assembly [Vibrio mimicus MB-451]
          Length = 314

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + H +K+R        P+ALD++V    +GL  + A+  +  +   S      E   V  
Sbjct: 155 LHHFVKERQRTIRAGVPDALDLLVVCTESGLGFNAALRKVADELAISHPEFADELDTVCA 214

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+ +  +   +V    L E+     ++S  S++GG+LS+ L + +   RD++N + 
Sbjct: 215 KIKAGVEMHTAFDELVARTGLTEIRGLVNMLSHASKIGGSLSQTLRDYTEDFRDKRNQEV 274

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 275 EEIAAKIPTK 284


>gi|157961842|ref|YP_001501876.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846842|gb|ABV87341.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 320

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           ++ L K+R  K    FP+ALD++V    AGL +  A   VA  +  S   + SE   V  
Sbjct: 158 LQSLSKRRMRKLRVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELELVCS 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  ++        L+++   ++ IS   +LG  ++E L   S   R+++   A
Sbjct: 218 KVRAGLTIKVALQEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRNKRLQAA 277

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 278 EEQAAKLAVK 287


>gi|167617239|ref|ZP_02385870.1| type II secretion system protein [Burkholderia thailandensis Bt4]
 gi|257141112|ref|ZP_05589374.1| type II secretion system protein [Burkholderia thailandensis E264]
          Length = 319

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 158 IASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 211

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FS ++    + G ++  +L  LS  LR ++ M
Sbjct: 212 LLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRM 271

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 272 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 308


>gi|167579124|ref|ZP_02371998.1| type II secretion system protein [Burkholderia thailandensis TXDOH]
          Length = 319

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 158 IASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 211

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FS ++    + G ++  +L  LS  LR ++ M
Sbjct: 212 LLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRM 271

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 272 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 308


>gi|323529156|ref|YP_004231308.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386158|gb|ADX58248.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 293

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGLS 64
           ++R A+ L      LD +  +V AGL ++ A+   V +  + P R E   V+     GL+
Sbjct: 140 RRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVEKGPAGPFRWELEHVLRDLKSGLN 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++ R+   + ++EV+ F   +    ++G  L+++L   S   R  +  +A+ QA+  
Sbjct: 200 RTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLAKSLRFQSEQRRSERFQRAEKQAMEA 259

Query: 125 EAK 127
             K
Sbjct: 260 PVK 262


>gi|153812903|ref|ZP_01965571.1| hypothetical protein RUMOBE_03310 [Ruminococcus obeum ATCC 29174]
 gi|149830981|gb|EDM86071.1| hypothetical protein RUMOBE_03310 [Ruminococcus obeum ATCC 29174]
          Length = 275

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 72/160 (45%), Gaps = 10/160 (6%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRRVIETQ 59
           +R    L  F + L+ +  S   G     A       +A I G+ +D V  E   ++   
Sbjct: 91  RRQKGLLIQFRDMLESLTASYSTGKNTQGAFEDAYGDLADIYGKKADIVH-EIEMIVNGI 149

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
           + G ++   +        L +V  F+T+  V S+ GGNL +A+ +  RI+ ++  M+ ++
Sbjct: 150 YNGQNIEALLKNFAERSHLDDVESFATIFEVSSRYGGNLKKAVGDTYRIINEKIEMEMEI 209

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           + L    K    I+  +P  +  +V  +  G M+++ N P
Sbjct: 210 RTLLTANKNELNIMMLMPLII--MVTLSGMGSMSIVQNTP 247


>gi|126443620|ref|YP_001064084.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|167908138|ref|ZP_02495343.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
 gi|126223111|gb|ABN86616.1| type II secretion system protein [Burkholderia pseudomallei 668]
          Length = 319

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 158 IAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 211

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FS ++    + G ++  +L  LS  LR ++ M
Sbjct: 212 LLEMRSGFTKETALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRM 271

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 272 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 308


>gi|309780755|ref|ZP_07675496.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308920437|gb|EFP66093.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 313

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 7/144 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIETQHL 61
           IK+R     + FP++LD+I+  V AGL +  AV  +V    D    +  E+  +      
Sbjct: 153 IKRRKRDIFEAFPDSLDLIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYELLTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL+  +++        +++VS    ++    + G +++E+L   S +LR ++ M A+ +A
Sbjct: 213 GLAREKALRNFAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRQMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCVSTLVY 145
               AK    ++  L FC+   +Y
Sbjct: 273 ----AKIGTKVLFPLIFCLFPALY 292


>gi|241662160|ref|YP_002980520.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864187|gb|ACS61848.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 313

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 7/144 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIETQHL 61
           IK+R     + FP++LD+I+  V AGL +  AV  +V    D    +  E+  +      
Sbjct: 153 IKRRKRDIFEAFPDSLDLIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYELLTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL+  +++        +++VS    ++    + G +++E+L   S +LR ++ M A+ +A
Sbjct: 213 GLAREKALRNFAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRQMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCVSTLVY 145
               AK    ++  L FC+   +Y
Sbjct: 273 ----AKIGTKVLFPLIFCLFPALY 292


>gi|163751752|ref|ZP_02158970.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
 gi|161328404|gb|EDP99563.1| hypothetical putative tight adherence TadC-related transmembrane
           protein [Shewanella benthica KT99]
          Length = 322

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++HL  +R       FP+ALD++V    AGL +  A+  +  +   S   + SE   V  
Sbjct: 160 LQHLASRRMKNLRAGFPDALDLLVVCCEAGLGLLAALQRVANELAISHASLASELDLVCS 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  ++        L+++   ++ IS   +LG  ++  L   S   RD++   A
Sbjct: 220 KVRAGLTIKVALQEFTERTGLEDIKGLNSAISQSIRLGTGIAATLRIFSDEYRDKRLQDA 279

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 280 EEQAAKLAVK 289


>gi|296158517|ref|ZP_06841347.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891085|gb|EFG70873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 293

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 61/123 (49%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLS 64
           ++R  + L   P  LD +  +V AGL ++ A+   V +  + P+R E   V+     GL+
Sbjct: 140 RRRVGQILRHLPIYLDFLTLAVEAGLNINGAIQKSVEKGPEGPLRRELEHVLRDLKSGLN 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++ R+   + ++EV+     +    ++G  L+++L   S   R  +  +A+ QA+  
Sbjct: 200 RTEALRRLDDRLRIKEVTNLVGTVVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEA 259

Query: 125 EAK 127
             K
Sbjct: 260 PVK 262


>gi|187921509|ref|YP_001890541.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719947|gb|ACD21170.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 293

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSLSESISR 71
           L   P  LD +  +V AGL ++ A+   V +  + P+R EF  V+     GL+  E++ R
Sbjct: 147 LKHLPIYLDFLTLAVEAGLNINGAIQKAVEKGPEGPLRWEFEHVLRDLKSGLNRMEALYR 206

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           M   + ++EV+     +    ++G  LS++L   S   R  +  +A+ QA+    K
Sbjct: 207 MDDRLRIKEVTNLVGTVVQAERMGSGLSKSLRFQSEQRRSERFQRAEKQAMEAPVK 262


>gi|239814537|ref|YP_002943447.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801114|gb|ACS18181.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 301

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 73/147 (49%), Gaps = 3/147 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++ +IK R  +  ++FP+A D+++  V AGL +  A+  +  +    S+ +  E      
Sbjct: 135 LRMMIKSRQREIFENFPDAADLMLVCVEAGLGLDAALVKVTEEIRVKSEALAQELHWTNL 194

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +  +S+  +     ++E+  F+T+++   + G ++ E+L   S  LR ++ ++A
Sbjct: 195 EMRAGSTREKSLRNLALRTGVEEIGTFATMLTQADRFGTSIGESLRVFSEDLRHKRQVRA 254

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLV 144
           +  A  +  K    ++  +  C+S ++
Sbjct: 255 EELAAKVPTKMLLPLVVCIFPCISAVI 281


>gi|212635449|ref|YP_002311973.1| Tight adherence TadC-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556933|gb|ACJ29387.1| Tight adherence TadC-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 321

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           ++ L K+R       FP+ALD++V    AGL +  A   VA  +  S   + SE   V  
Sbjct: 159 LQSLAKRRMRLLRVGFPDALDLLVVCCEAGLGLMAALQRVAKELAFSHPSLASELELVCS 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  ++        L+++   ++ IS   +LG  ++E L   S   RD++   A
Sbjct: 219 KVRAGLTIKVALQEFTERTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAA 278

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 279 EEQAAKLAVK 288


>gi|294676064|ref|YP_003576679.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474884|gb|ADE84272.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 337

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 7/157 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHL 61
           +  RT +  D FP+ALD+++  V AG  +   +  +  +  SS P +  EF  V      
Sbjct: 176 VAARTQEIQDGFPDALDMLLVCVEAGQSLDQGIIRVSKELSSSYPALAEEFATVAHEIKA 235

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL     +        + +V+ F TV+    Q G +++EAL   +  +RD++ M+A+  A
Sbjct: 236 GLDKPTVLRAFAERSGVSDVASFVTVMIQSQQFGTSIAEALRLYAADMRDKRIMRAEEAA 295

Query: 122 LSMEAKASAWIIGSLPFCVST-LVYFTSPGYMNVLIN 157
             +  K +   +G++ F V   L+    P   +++ N
Sbjct: 296 NKIPTKMT---LGTMMFTVPPLLIILVGPSVHDMMEN 329


>gi|134281772|ref|ZP_01768479.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|134246834|gb|EBA46921.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 313

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 152 IAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 205

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FS ++    + G ++  +L  LS  LR ++ M
Sbjct: 206 LLEMRSGFTKETALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRM 265

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 266 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 302


>gi|256810975|ref|YP_003128344.1| Type II secretion system F domain protein [Methanocaldococcus
           fervens AG86]
 gi|256794175|gb|ACV24844.1| Type II secretion system F domain protein [Methanocaldococcus
           fervens AG86]
          Length = 299

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 69/127 (54%), Gaps = 3/127 (2%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE-TQHLGLSLSESISRM 72
           ++ P AL I++ S+ +G  +++A+  +V  +   V   FR+VI   +H  +S  E+I+ +
Sbjct: 85  NNIPQALYIMILSLESGRSLNEALEEVVKSNIKEVSDIFRKVIYLIEHQKISFEEAITVV 144

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
                 + +   + ++    + GG+LS++L  L++ L D K+ K ++ +++    A  +I
Sbjct: 145 STLYGSRVLMMLARIMIENRKYGGDLSDSLRILAKTLEDFKSYKRQLLSVTASGLAVGFI 204

Query: 133 I--GSLP 137
           I  G +P
Sbjct: 205 ILCGVIP 211


>gi|218710398|ref|YP_002418019.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
 gi|218323417|emb|CAV19594.1| Flp pilus assembly protein TadC [Vibrio splendidus LGP32]
          Length = 323

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +  L K+R  K  +  P+ALD++V    +GL  + A+  +  +   S   +  E   V  
Sbjct: 158 LSKLQKERQKKIRNGVPDALDLLVVCTESGLGFNAALGRVASELYVSQPELADELETVFA 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+++ +++ + +    L E+    +++S  S++GG+L++ L + +   RD++   A
Sbjct: 218 KIQAGVTMPDALRQFIDRTGLVELEGLVSLLSHASRMGGSLAQTLRDYTVDFRDKRQQAA 277

Query: 118 KVQALSMEAK 127
           +  A  +  K
Sbjct: 278 EEIAAKIPTK 287


>gi|119717342|ref|YP_924307.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538003|gb|ABL82620.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 304

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 6/150 (4%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R+ +     P+A+D++  SV AGL    AV  +   +  P+  E  RV+    LG S S 
Sbjct: 156 RSERIRRALPDAIDLLTISVEAGLGFDAAVQQVAQHTEGPLADELSRVLREMQLGQSRSA 215

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  +     + E+  F   +     LG  +++ L   SR +R ++   A+ +A  +  K
Sbjct: 216 ALRSLSARTTVPELRGFVGAMVQADALGIPIAQVLRVQSREIRVKRRQHAEERAQQVPVK 275

Query: 128 ASAWIIGSLPFCVSTLVYFT--SPGYMNVL 155
            +  +I    FC+   ++     P  +N++
Sbjct: 276 ITVPLI----FCILPCLFVVVLGPAVLNIM 301


>gi|325678255|ref|ZP_08157883.1| type II secretion system protein F domain protein [Ruminococcus
           albus 8]
 gi|324110018|gb|EGC04206.1| type II secretion system protein F domain protein [Ruminococcus
           albus 8]
          Length = 290

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I+K    ++ DFPNA+  I   V  G+ + +A   +   S +P+  + R V++  + G+S
Sbjct: 141 IEKMNETYMRDFPNAVSTIALLVNGGMFLREAWKQVAISSDEPLYVQMRGVVDDMNNGVS 200

Query: 65  LSESISRMVRYMPLQEVSFFSTVIS--VQSQLGGNLSEALANLSRILRDRK 113
             +++ R       +E+  FST I+  ++S  G +L++ L   + +L + K
Sbjct: 201 EIDALFRFANRCSTKEIRKFSTTITQAIESD-GTHLADTLIKQADLLLNEK 250


>gi|309792339|ref|ZP_07686809.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225654|gb|EFO79412.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 309

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKR        P+ALD++  SV AGL    A+  +  +  D +  EF++V+    LG +
Sbjct: 156 IKKRKKSITKALPDALDLLCISVEAGLAFDLALQRVTQKWDDELSREFKKVLSDIRLGRT 215

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
             E++  +     + +V  F+  +    QLG ++S+ L
Sbjct: 216 RREALKDLGVRTGVDDVQTFTAAVIQADQLGVSMSKIL 253


>gi|197302281|ref|ZP_03167340.1| hypothetical protein RUMLAC_01008 [Ruminococcus lactaris ATCC
           29176]
 gi|197298712|gb|EDY33253.1| hypothetical protein RUMLAC_01008 [Ruminococcus lactaris ATCC
           29176]
          Length = 197

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/193 (16%), Positives = 85/193 (44%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ- 59
           ++ +  K+  +F   F +++ I+  +++AG    +A+           +SE R + E + 
Sbjct: 5   LEEMTDKKEEEFRVQFKDSIQIMAGALKAGYSAENAIRETCHDLKPMYKSESRIIKEYEI 64

Query: 60  -----HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
                 + + + + +S     +  ++V  F TV +   + GG+    + +  +++ ++  
Sbjct: 65  MIRKLKIHIPVGQVLSEFAENVEQEDVDNFVTVFTTAQKSGGDSIVIIKDAVKVISEKME 124

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+  +PF +   +  T   ++ VL  +P G +++ +  A    
Sbjct: 125 TEKEIQTMIASKKLEFEIMSMIPFGMIGYMKLTFGDFLKVLYGNPAGIIVMSICLALYFT 184

Query: 175 GIMVMRLMINFDV 187
             +  + MI  +V
Sbjct: 185 AYIWGKKMIKIEV 197


>gi|251795273|ref|YP_003010004.1| type II secretion system protein [Paenibacillus sp. JDR-2]
 gi|247542899|gb|ACS99917.1| type II secretion system protein [Paenibacillus sp. JDR-2]
          Length = 287

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ----SSDPVRS---EFRRVI 56
           L+ +R  +    F  AL  +  S+ AG  V +A    +        DP      EFR V 
Sbjct: 98  LLVRRKERLQLQFKEALYSLASSLAAGRSVENAFLATIDDLKLLYPDPNTELLLEFRIVK 157

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                G  L +++  + +   L +++ FS V +V  + GG+L E +   S+ + ++  +K
Sbjct: 158 YRLDNGEPLEQALRSLAKRTHLDDITQFSDVFAVCKRSGGDLVEVMKRTSQTIGEKLEVK 217

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVA 168
            ++  L  + +  A I+ ++PF     +   +P YM  L     G++LL + 
Sbjct: 218 QEISVLLAQKRFEARIMMAVPFAFLGFLSAFAPDYMKPLYGGG-GYVLLTIG 268


>gi|225174956|ref|ZP_03728953.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169596|gb|EEG78393.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 306

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 11/155 (7%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K    +R  +     P+ LD+++ SV AGL    A+  +  +    +  E  + ++   +
Sbjct: 149 KRKATERQKEIQRSLPDMLDLLLVSVDAGLAFDMALKKVADKMPGELSREIGKALDEIRM 208

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +  E++  M     + ++S F + +    QLG N+++ L   +  +R R+ M+A+ +A
Sbjct: 209 GKTRIEALRSMANRTGVPDISTFISAVIQAEQLGSNIAKTLDVQANTMRQRRRMRAEEEA 268

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLI 156
           +    K            +  LV+F  P    VL+
Sbjct: 269 MRAPIK-----------MLFPLVFFIFPALFVVLL 292


>gi|83718164|ref|YP_440464.1| hypothetical protein BTH_II2276 [Burkholderia thailandensis E264]
 gi|83651989|gb|ABC36053.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 296

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R    ++DFP+ALD++   V AGL +  A+  +    +D +R   R  +    LGL 
Sbjct: 135 IASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKV----ADELR--LRSPVVADELGLM 188

Query: 65  LSESISRMVRYMPL---------QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           L E  S   +   L         ++V  FS ++    + G ++  +L  LS  LR ++ M
Sbjct: 189 LLEMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRM 248

Query: 116 KAKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           +A+ +A    AK +  ++  L FC+  + L     P ++++
Sbjct: 249 RAEERA----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 285


>gi|149200852|ref|ZP_01877827.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
 gi|149145185|gb|EDM33211.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
          Length = 326

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 79/155 (50%), Gaps = 6/155 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHLG 62
           +KR  +  D FP++LD+++  + AG  +  ++  +  +   S   +  EF  V      G
Sbjct: 169 QKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALADEFEIVALQIKAG 228

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQA 121
                 +  M     +Q++S F TV+ VQSQ  G ++ EAL   +  +RD++ M+A+ +A
Sbjct: 229 RDKPSVLGEMAERCGVQDISSFVTVL-VQSQTFGTSIGEALRVYAGEMRDKRVMRAEEKA 287

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
             +  K + A ++ ++P  +  LV  +  G M++L
Sbjct: 288 NKLPTKMTLATMMLTVPPLLIILVGPSVLGIMDLL 322


>gi|294012231|ref|YP_003545691.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675561|dbj|BAI97079.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 322

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 71/142 (50%), Gaps = 4/142 (2%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVS---DAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           +R  + +  FP+ALD+++  V AGL +    D V   +  S   V +   +V+     G 
Sbjct: 164 RRQEEIVHGFPDALDLMLVCVEAGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGR 223

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S  +++ RM   + + E+  F+T++    QLG ++ + L   +  +R+++ M+A+ +A  
Sbjct: 224 SRQDALRRMADDVDVDEIRSFATLLIQSDQLGSSVGQTLRVYAAEMREKRRMRAEEKAHR 283

Query: 124 MEAKASAWIIGS-LPFCVSTLV 144
           +    S  ++   LP  +  L+
Sbjct: 284 LPVLLSVPLVACMLPVMIGVLM 305


>gi|300692336|ref|YP_003753331.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
 gi|299079396|emb|CBJ52067.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum PSI07]
          Length = 313

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 71/144 (49%), Gaps = 7/144 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRS-EFRRVIETQHL 61
           IK R     + FP++LD+I+  V AGL +  A+  +V +  ++ PV + E+  +      
Sbjct: 153 IKYRQRDVFESFPDSLDLIMVCVEAGLGLDAAILRVVDEMRAARPVMAQEYELLTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GLS  +++        + +VS    ++    + G +++ +L   S +LR ++ M A+ +A
Sbjct: 213 GLSREKALRHFAARTGVDDVSLLVAMLIQADRFGTSIAASLRVHSDMLRTKRQMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCVSTLVY 145
               AK    I+  L FC+   +Y
Sbjct: 273 ----AKIGTKILFPLIFCIFPSIY 292


>gi|260427288|ref|ZP_05781267.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
 gi|260421780|gb|EEX15031.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
          Length = 324

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 65/126 (51%), Gaps = 3/126 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +++R  +  + FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +      
Sbjct: 165 VEERKKQIEEGFPDALDMMLVCVEAGQSLDQSIVRVSKELRASYPALADEFEIISHEMRA 224

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   S  ++ M     +Q+VS F TV++  +  G ++++AL   +  +RD++ M+A+ +A
Sbjct: 225 GKDKSNVLNDMGERCGVQDVSSFVTVLNQAANFGTSIADALRIYASEMRDKRVMRAEEKA 284

Query: 122 LSMEAK 127
             +  K
Sbjct: 285 NKLPTK 290


>gi|113867007|ref|YP_725496.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525783|emb|CAJ92128.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 293

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 1/112 (0%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSLSESISRMVRY 75
           P  LD +  SV AGL ++ A+   V +  + P+R EF  V+     GLS ++++ RM   
Sbjct: 151 PVFLDFLTLSVEAGLNINGALLQAVEKGPEGPLRREFEHVLRDLKSGLSRADALRRMDDR 210

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           + ++EV+ F   +    ++G  L+  L   S   R  +  +A+ QA+    K
Sbjct: 211 LRVKEVTNFVGAVIQAERMGSGLAATLRFQSEQRRTERFQRAEKQAMEAPVK 262


>gi|187919329|ref|YP_001888360.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717767|gb|ACD18990.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 318

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 74/160 (46%), Gaps = 14/160 (8%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           M+ L++ R  K  +D P+ALD++   V AGL +  A   V   +G  S  ++ EF  V+ 
Sbjct: 150 MRRLVESRQRKLFEDLPDALDLMTVCVEAGLGLDAAMLRVTQEIGVKSHALKDEFDMVLL 209

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    +++  +     ++++   + ++    + G ++ ++L   +  LR ++ ++A
Sbjct: 210 ELRAGSGREKALRNLSLRTGVEDIDTLAAMLIQADRFGTSVGDSLRVYTDNLRTKRRLRA 269

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           + QA  +  K            +  L++F  P  + VL+ 
Sbjct: 270 EEQAAKIALK-----------LLFPLMFFIFPTLLAVLVG 298


>gi|311111714|ref|YP_003982936.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
 gi|310943208|gb|ADP39502.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
          Length = 284

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 3/180 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  K R  K    +P+A+D +  ++RAGL + +A+  +  +    +R  F R      
Sbjct: 93  VNHRAKVREGKLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           + +  ++GG +L   L  LS  LR+    +A++
Sbjct: 153 ATGDFVASLNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           QA       +A +    P+ V  L+  T P   N+  N   G +L+   A   +I   +M
Sbjct: 213 QARQSWTVNAARLACVAPWVVLMLMA-TQPAVRNIY-NSFAGFVLMFAGAGLSVIAYRIM 270


>gi|218887822|ref|YP_002437143.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758776|gb|ACL09675.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 326

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 76/156 (48%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRS-EFRRVIETQHL 61
           IK R    ++  P+ALD++V  V AG+ +  A + +  +  +++PV + E   VI     
Sbjct: 167 IKARRLDIINSLPDALDLLVVCVEAGMGLDQAFSRVAREMAATNPVLAEELNLVILELRA 226

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S +E++  +   + L++V+   T+I      G ++S  L   S  +R  +  +A+  A
Sbjct: 227 GKSRAEALKNLAARVALEDVNSLVTLIVQADAFGTSISSTLRVYSDTMRTTRFQRAEEIA 286

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFT--SPGYMNVL 155
             M  K    ++  L FC+   ++ T   P ++ ++
Sbjct: 287 AKMPVK----LLFPLVFCILPALFVTIMGPAFIKLM 318


>gi|300741823|ref|ZP_07071844.1| putative bacterial type II secretion system protein F domain
           protein [Rothia dentocariosa M567]
 gi|300381008|gb|EFJ77570.1| putative bacterial type II secretion system protein F domain
           protein [Rothia dentocariosa M567]
          Length = 284

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 3/180 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  K R  K    +P+A+D +  ++RAGL + +A+  +  +    +R  F R      
Sbjct: 93  VNHRAKVREGKLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           + +  ++GG +L   L  LS  LR+    +A++
Sbjct: 153 ATGDFVASLNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           QA       +A +    P+ V  L+  T P   N+  N   G +L+   A   +I   +M
Sbjct: 213 QARQSWTVNAARLACVAPWVVLMLMA-TQPAVRNIY-NSFAGFVLMFAGAGLSVIAYRIM 270


>gi|328943878|ref|ZP_08241343.1| hypothetical protein HMPREF0091_10568 [Atopobium vaginae DSM 15829]
 gi|327491847|gb|EGF23621.1| hypothetical protein HMPREF0091_10568 [Atopobium vaginae DSM 15829]
          Length = 296

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 75/170 (44%), Gaps = 1/170 (0%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
           D P+   ++  ++ AG   S A+A +           F++       G S+SE ++ M  
Sbjct: 122 DMPDIFRMLGMALAAGQTFSQAIAYVGQHQPGEAGKAFQKASLKLRCGSSISEVLNDMAH 181

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +    V F  T + +  + G  L       ++++  ++  K  +   + +A+ S  ++ 
Sbjct: 182 TLQAPGVKFLITALFISQRTGAPLKSLFRQSAQLVEQQEKFKKLLSVKTAQARLSIRVVS 241

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           SLP  + +++   S  +    I  P G + LG+AA    I +M++R ++ 
Sbjct: 242 SLPLVLISVLSCISLDFQKG-ITRPAGLISLGIAAFLDFIALMIIRSLLK 290


>gi|126729093|ref|ZP_01744907.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710083|gb|EBA09135.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 324

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 3/126 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           ++KR  +    FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +      
Sbjct: 165 MEKRKEEIQQGFPDALDMMLVCVEAGQSMEQSIIRVAKELRASYPALADEFEIISHEMKA 224

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   S+ ++ M      Q+VS F TV++     G ++S+AL   +  +RD++ M+A+  A
Sbjct: 225 GKDRSQVLNDMSERCGSQDVSSFVTVLNQAQTFGTSISDALRVYAGEMRDKRVMRAEEAA 284

Query: 122 LSMEAK 127
             +  K
Sbjct: 285 NKLPTK 290


>gi|307726638|ref|YP_003909851.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307587163|gb|ADN60560.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 293

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 62/123 (50%), Gaps = 1/123 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGLS 64
           ++R A+ L      LD +  +V AGL ++ A+   V +  + P+R E   V+     GL+
Sbjct: 140 RRRVAQILKHLSIYLDFLTLAVEAGLNINGAIQKAVEKGPAGPLRWELEHVLRDLKSGLN 199

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++ R+   + ++EV+ F   +    ++G  L+++L   S   R  +  +A+ +A+  
Sbjct: 200 RTEALRRLDDRLRIKEVTNFVGAVVQAERMGAGLAKSLRFQSEQRRSERFQRAEKKAMEA 259

Query: 125 EAK 127
             K
Sbjct: 260 PVK 262


>gi|331003046|ref|ZP_08326558.1| hypothetical protein HMPREF0491_01420 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413090|gb|EGG92465.1| hypothetical protein HMPREF0491_01420 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 227

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/192 (15%), Positives = 85/192 (44%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAV------IVGQSSDPVRSEFRRV 55
           K LI  +  K + +F  A+ II   + AG  + +++        ++    + +  EF  +
Sbjct: 36  KELINVKKRKLVLEFKEAIMIISSLLSAGYSLENSIKEALVELRLLYSKDNLIIKEFEYI 95

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +  ++ +S+  +   +      +++  F+ V+ +  + GG L   +++   ++ D+  +
Sbjct: 96  NQLIYMNISVERAFDDLAYRSHSEDIRSFAKVLRIAKRSGGELVSIISHTVNVIADKVRI 155

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  ++   +    ++   P  +   +  +SPG+ N++     G + +       L  
Sbjct: 156 KEEIITMTAAKRFEQSVMNVFPLFIVLYIDISSPGFFNIMYTTIIGRICMSFGLIMYLFA 215

Query: 176 IMVMRLMINFDV 187
           I + + ++N +V
Sbjct: 216 IYISKGLLNIEV 227


>gi|85705157|ref|ZP_01036257.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670479|gb|EAQ25340.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 325

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 68/128 (53%), Gaps = 5/128 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIETQ-HLG 62
           +KR  +  D FP++LD+++  + AG  +  ++  +  +  +S P  +E   ++  Q   G
Sbjct: 167 QKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALAEEFEIVSLQIKAG 226

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQA 121
                 ++ M     +Q+++ F TV+ VQSQ  G ++ EAL   +  +RD++ M+A+ +A
Sbjct: 227 RDKPSVLNEMAERCGVQDITSFVTVM-VQSQTFGTSIGEALRVYAAEMRDKRVMRAEEKA 285

Query: 122 LSMEAKAS 129
             +  K +
Sbjct: 286 NKLPTKMT 293


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  + L   P+ALD++  SV AGL    A+  IV +  + +  EF  V+    LG S
Sbjct: 487 ITQRRRRILLQMPDALDLLTISVEAGLGFDAAMLEIVQKWDNDIAREFALVLSEMKLGKS 546

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
             +++  M   + L E+    + I    ++G ++   L+  S  +R R+  +A+
Sbjct: 547 RRDALRSMAERVQLDEMKLLVSSIVQADEIGASIGRTLSIQSEQMRLRRRQRAE 600


>gi|317122038|ref|YP_004102041.1| hypothetical protein Tmar_1201 [Thermaerobacter marianensis DSM
           12885]
 gi|315592018|gb|ADU51314.1| hypothetical protein Tmar_1201 [Thermaerobacter marianensis DSM
           12885]
          Length = 274

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 11/182 (6%)

Query: 11  KFLDDFPNALD----IIVRSVRAGLPVS----DAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           K +D    AL+     ++  ++AG P+     +A   +V    +P ++EF   +     G
Sbjct: 87  KAVDAAAEALESVLVTVIAHLQAGRPLRQAWVEAAREVVAPVLEPAKAEF---VAGLSAG 143

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LSL E++ +      L+ +     V +   + GG+ +     +   LR+++   A V A 
Sbjct: 144 LSLDEALGQWYERTRLRALRRCQAVAAAHRRTGGDATGPTLAVIHGLREQRLAWADVAAR 203

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA ++  LP  V+       P ++  L NDP G   L    A  L GI ++R +
Sbjct: 204 TAEARLSARLLALLPVVVTAYALALDPAFVRPLWNDPLGRWGLSYGVASWLAGIYLLRRL 263

Query: 183 IN 184
             
Sbjct: 264 AG 265


>gi|307294432|ref|ZP_07574276.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880583|gb|EFN11800.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 322

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 3/118 (2%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVS---DAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           +R    +  FP+ALD+++  V AGL +    D V   +  S   V +   +V+     G 
Sbjct: 164 RRQEAIVHGFPDALDLMLVCVEAGLGLEAAMDRVGRELALSHPLVSAALGKVVLELRAGR 223

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           S  +++ RM   + + E+  F+T++    QLG ++ + L   +  +R+++ M+A+ +A
Sbjct: 224 SRQDALRRMADDVDVDEIRSFATLLIQSDQLGSSVGQTLRIYAAEMREKRRMRAEEKA 281


>gi|163738365|ref|ZP_02145780.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742218|ref|ZP_02149606.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384548|gb|EDQ08929.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388286|gb|EDQ12640.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 326

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 76/154 (49%), Gaps = 4/154 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           I++R  +    FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V +    
Sbjct: 168 IEERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALADEFDIVAQEMKA 227

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    + +  M     +Q+VS F TV+   +  G +++EAL   +  +RD++ M+A+  A
Sbjct: 228 GKDKDKVMRDMGTRCGVQDVSSFVTVMIQSATFGTSIAEALRVYAGEMRDKRVMRAEEAA 287

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
             +  K + A +  ++P  +  LV  ++ G  N+
Sbjct: 288 NKLPTKMTLATMTLTVPPLLIILVGPSAQGIANL 321


>gi|56477520|ref|YP_159109.1| type II secretion system protein [Aromatoleum aromaticum EbN1]
 gi|56313563|emb|CAI08208.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Aromatoleum aromaticum EbN1]
          Length = 315

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 14/160 (8%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           +  LI  R  +  + FP+ALD++   V AGL V  A   VA  +   S+ +  E   V  
Sbjct: 147 LNRLIFVRQREIFETFPDALDLMTVCVEAGLGVEAALVRVADEMQHKSEALAEELHLVTL 206

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL  + ++  +     ++EV  F  ++    + G +++ +L   S +LR R+  +A
Sbjct: 207 ELRAGLERARALRNLAARTGVEEVEGFVAMVIQAERFGTSIATSLRIHSDMLRTRRRQRA 266

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +        +A+A I   L F    L++F  P  M VL+ 
Sbjct: 267 E--------EAAAKIALKLLF---PLIFFIFPSLMLVLLG 295


>gi|308234326|ref|ZP_07665063.1| Type II secretion system F domain protein [Atopobium vaginae DSM
           15829]
          Length = 314

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 75/171 (43%), Gaps = 1/171 (0%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
            D P+   ++  ++ AG   S A+A +           F++       G S+SE ++ M 
Sbjct: 139 HDMPDIFRMLGMALAAGQTFSQAIAYVGQHQPGEAGKAFQKASLKLRCGSSISEVLNDMA 198

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             +    V F  T + +  + G  L       ++++  ++  K  +   + +A+ S  ++
Sbjct: 199 HTLQAPGVKFLITALFISQRTGAPLKSLFRQSAQLVEQQEKFKKLLSVKTAQARLSIRVV 258

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            SLP  + +++   S  +    I  P G + LG+AA    I +M++R ++ 
Sbjct: 259 SSLPLVLISVLSCISLDFQKG-ITRPAGLISLGIAAFLDFIALMIIRSLLK 308


>gi|46580529|ref|YP_011337.1| hypothetical protein DVU2124 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449948|gb|AAS96597.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 284

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 77/156 (49%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG--QSSDPV-RSEFRRVIETQHL 61
           IK+R  + ++  P+ALD++V  V AG+ +  A+A +    QS+ PV   E +  I     
Sbjct: 125 IKERRQEIINALPDALDLLVVCVEAGMGLDQALARVAKELQSTSPVLAEELQLSILELRA 184

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S ++++  +   + +++V+   T+I      G +++  L   S  +R  +  +A+  A
Sbjct: 185 GKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSIASTLRVYSDTMRTTRFQRAEEIA 244

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFT--SPGYMNVL 155
             M  K    ++  L FC+   ++ T   P ++ ++
Sbjct: 245 AKMPVK----LLFPLVFCILPALFVTIMGPAFIKLM 276


>gi|73542334|ref|YP_296854.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119747|gb|AAZ62010.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 323

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 82/159 (51%), Gaps = 9/159 (5%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS--DPVRS-EFRRVIE 57
           + H + +R     ++FP+ +D++   V AGL +  A+  +  + +   PV + E + ++ 
Sbjct: 157 LSHKVAERQRAVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLL 216

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++S +     +++V  F++++    + G +L ++L  LS +LR ++ M+A
Sbjct: 217 ELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGDSLRVLSDMLRTKRRMRA 276

Query: 118 KVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           + QA    AK +  ++  L F +  S L+    P ++ +
Sbjct: 277 EEQA----AKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|320161469|ref|YP_004174693.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995322|dbj|BAJ64093.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  +     P+ALD++   V AGL    A+A +  +    +   F RVI+   LG +
Sbjct: 162 ISRRQKEIRKSMPDALDLLTICVEAGLGFDAAMAKVAEKWESELSLAFARVIQEIQLGKT 221

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
             +++  M   + + E++ F   +    QLG ++++ L   S  +R R+   A+ +A
Sbjct: 222 RRDALRDMAERIGIPEMTSFVAAVIQSEQLGVSMAKVLRIQSDQMRVRRRQAAEEEA 278


>gi|296109005|ref|YP_003615954.1| Type II secretion system F domain protein [Methanocaldococcus
           infernus ME]
 gi|295433819|gb|ADG12990.1| Type II secretion system F domain protein [Methanocaldococcus
           infernus ME]
          Length = 299

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRV---IETQH 60
           L + +  K  ++ P AL IIV ++ +G  +++A+  +V  +   V   F RV   IE Q 
Sbjct: 74  LYESKMEKLEENLPKALYIIVLALDSGRSINEALHEVVRANIKEVSPVFARVLYLIEKQK 133

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  S  ++++ +  +   + +     ++    + GGNLSE L  L++ L D +  K ++ 
Sbjct: 134 L--SFEDAMTIVSTFYDSKILRMLGKIMIENRKFGGNLSETLKTLAKTLEDFRLYKRQLM 191

Query: 121 ALSMEAKASAWII 133
           +++  + A  +I+
Sbjct: 192 SVTANSLAMGFIM 204


>gi|149915637|ref|ZP_01904163.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
 gi|149810529|gb|EDM70372.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
          Length = 328

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 72/134 (53%), Gaps = 9/134 (6%)

Query: 2   KHLIKKRTAKFLDD----FPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRV 55
           K+ + KR  +  +D    FP++LD+++  V AG  +  ++  +  +  +S P  +E  ++
Sbjct: 162 KYWVTKRQQQRQEDITNGFPDSLDMMLTCVEAGQSLDQSIVRVSNEIAASYPALAEEYQI 221

Query: 56  IETQ-HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRK 113
           +  Q   G      ++ M     +Q++S F TV+ VQSQ  G ++++AL   +  +RD++
Sbjct: 222 VANQIKAGRDKPSVLNEMAERCGVQDISSFVTVL-VQSQTFGTSIADALRVYAGEMRDKR 280

Query: 114 NMKAKVQALSMEAK 127
            M+A+ +A  +  K
Sbjct: 281 VMRAEEKANKLPTK 294


>gi|254441173|ref|ZP_05054666.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251251|gb|EDY75566.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 326

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 65/124 (52%), Gaps = 3/124 (2%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHLGL 63
           +R  + ++ FP++LD+++  V AG  +  ++  +  +  S  P +  E++ V      G 
Sbjct: 169 ERQLEMINGFPDSLDMMLVCVEAGQSLDQSIIRVAHELKSGFPALAEEYQMVSHEMKAGK 228

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
             ++ +  M     + ++S F TV+    Q G +++EAL   S  +RD++ M+A+ +A +
Sbjct: 229 DKTQVLRDMAERTGVADISSFVTVLIQSQQFGTSIAEALRVFSAEMRDKRVMRAEEKANT 288

Query: 124 MEAK 127
           +  K
Sbjct: 289 LPTK 292


>gi|120602154|ref|YP_966554.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|120562383|gb|ABM28127.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|311234268|gb|ADP87122.1| Type II secretion system F domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 323

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 77/156 (49%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG--QSSDPV-RSEFRRVIETQHL 61
           IK+R  + ++  P+ALD++V  V AG+ +  A+A +    QS+ PV   E +  I     
Sbjct: 164 IKERRQEIINALPDALDLLVVCVEAGMGLDQALARVAKELQSTSPVLAEELQLSILELRA 223

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S ++++  +   + +++V+   T+I      G +++  L   S  +R  +  +A+  A
Sbjct: 224 GKSRADTLKNLAARVAIEDVNSLVTLIIQADAFGTSIASTLRVYSDTMRTTRFQRAEEIA 283

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFT--SPGYMNVL 155
             M  K    ++  L FC+   ++ T   P ++ ++
Sbjct: 284 AKMPVK----LLFPLVFCILPALFVTIMGPAFIKLM 315


>gi|221633000|ref|YP_002522225.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
 gi|221157259|gb|ACM06386.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
          Length = 303

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 68/141 (48%), Gaps = 4/141 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R        P+A+D++V SV AGL    A+  +V +  + +  EF R +    +G+ 
Sbjct: 151 IAQRKRAIQRALPDAIDLLVISVEAGLGFDQALLRVVEKWDNELTREFARTLSEMRMGIP 210

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             +++  + R + + +++ F   +    QLG ++S+ L   +  +R R+  +A+     +
Sbjct: 211 RRQALRDLARRVNVDDLNVFIASLVQADQLGVSISQVLRAQANQMRLRRRQRAQ----EL 266

Query: 125 EAKASAWIIGSLPFCVSTLVY 145
             KA   +I  + F +   +Y
Sbjct: 267 AHKAPIKMIFPMVFLIFPALY 287


>gi|127511576|ref|YP_001092773.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636871|gb|ABO22514.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 287

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 1/128 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQ 59
           +  L KKR    +   P  LD +  S+ AGL ++ A++  V +  + P+R EF +VI   
Sbjct: 131 LNDLRKKRQGLIVKSLPVYLDYLTMSIEAGLNMTGALSQAVERGPAGPLRIEFEKVIRDM 190

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G+S +++   M   + + EV+   + ++   + G +L + L   S   R  +  +A+ 
Sbjct: 191 RAGMSRAQAFRNMADRVQVTEVNSLVSALAQAERTGASLGQTLRIQSDQRRIERFQRAEK 250

Query: 120 QALSMEAK 127
           +AL    K
Sbjct: 251 KALEAPVK 258


>gi|197106493|ref|YP_002131870.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
 gi|196479913|gb|ACG79441.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
          Length = 300

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL------ 61
           R  ++ D FP+ LD++V SV AGL +  AV  +    +D +   +  +  T HL      
Sbjct: 148 REREYADGFPDLLDLLVASVEAGLSLDAAVTRV----TDELERRYPNL--TVHLRFLVLE 201

Query: 62  ---GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G +  ++ S     + +++    +T++    ++G +L + L   S+ +R ++ ++A+
Sbjct: 202 LRAGRARKDAWSAFADRLAIEDARALATMLRQAEEMGTSLGDTLQVFSQDMRQKRMLRAE 261

Query: 119 VQALSMEAKASAWII 133
            +AL++ AK +  +I
Sbjct: 262 EKALALSAKLTVPLI 276


>gi|121607251|ref|YP_995058.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121551891|gb|ABM56040.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 313

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 3/127 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQ 59
           +K  I  R  + L   P  LDII   V AGL +  A+A  V +     VR EF+RV+   
Sbjct: 156 LKDRIALRRRELLRMMPFFLDIITLCVEAGLNMHGAIAQAVAKGPQGTVREEFQRVLRDV 215

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G + +ES+  M   +    V+ F   +    ++G NL   L   +   R  + ++A  
Sbjct: 216 RAGKARTESLRDMAERLNEPGVTQFVMAVIQAERMGMNLGPVLRAQADQQRSERFLRA-- 273

Query: 120 QALSMEA 126
           + L+MEA
Sbjct: 274 EKLAMEA 280


>gi|167767552|ref|ZP_02439605.1| hypothetical protein CLOSS21_02071 [Clostridium sp. SS2/1]
 gi|167710844|gb|EDS21423.1| hypothetical protein CLOSS21_02071 [Clostridium sp. SS2/1]
 gi|291558489|emb|CBL37289.1| Flp pilus assembly protein TadB [butyrate-producing bacterium
           SSC/2]
          Length = 252

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI-----VGQSSDPVRSEFRRVIE 57
           H   +   K   +F   +  I  S+ AG  + +A+        + +    +  E + +I 
Sbjct: 63  HKGHREKEKLRKEFREMMISIGNSLSAGYSIENALKTAKNDLEMYEEHSLLAKELQLLIN 122

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALAN----LSRILRDRK 113
              +   +   +  M  ++ L+E   F+ VIS+  + GGNL E   N    LS+ ++ ++
Sbjct: 123 KLKMNEPVDNLLFDMAEHVGLEEFYQFAQVISIAKKSGGNLIEITENTIEHLSQAIQTKE 182

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
            +   + A  ME K    I+  +P+ +   V   +PGY ++L     G
Sbjct: 183 EIHTMIAAKQMEKK----IMSVMPYFILLYVRIANPGYFDILYESFAG 226


>gi|167624197|ref|YP_001674491.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354219|gb|ABZ76832.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 320

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           ++ L  +R  +    FP+ALD++V    AGL +  A   VA  +  S   + SE   V  
Sbjct: 158 LQSLANRRMRQLRVGFPDALDLLVVCCEAGLGLMAAMQRVARELAFSHPSLASELDLVCS 217

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  ++        L+++   ++ IS   +LG  ++E L   S   RD++   A
Sbjct: 218 KVRAGLTIKVALQEFTDRTGLEDIKGLNSAISQSMRLGTGIAETLRVFSDEYRDKRLQAA 277

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 278 EEQAAKLAVK 287


>gi|99082191|ref|YP_614345.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038471|gb|ABF65083.1| hypothetical protein TM1040_2351 [Ruegeria sp. TM1040]
          Length = 323

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 78/155 (50%), Gaps = 6/155 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG---QSSDP-VRSEFRRVIETQH 60
           I++R       FP+ALD+++  V AG  +  ++ V VG   Q+S P +  EF  V     
Sbjct: 168 IEERKQAITRAFPDALDMMLVCVEAGQSLDQSI-VRVGKELQASYPELAEEFEIVAHEMK 226

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G    + +  M     +Q+V+ F TV+   +  G ++++AL   +  +RD++ M+A+  
Sbjct: 227 AGKEKDKVLRDMATRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRAEEA 286

Query: 121 ALSMEAKASAWIIG-SLPFCVSTLVYFTSPGYMNV 154
           A  +  K +   +G ++P  ++ L+  +  G  N+
Sbjct: 287 ANKLPTKMTLATMGLTVPPLLAILIAPSVQGLGNI 321


>gi|139438671|ref|ZP_01772155.1| Hypothetical protein COLAER_01156 [Collinsella aerofaciens ATCC
           25986]
 gi|133775751|gb|EBA39571.1| Hypothetical protein COLAER_01156 [Collinsella aerofaciens ATCC
           25986]
          Length = 308

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/174 (17%), Positives = 84/174 (48%), Gaps = 1/174 (0%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           +  P A   +  S+ +G  ++  +  +   + +PV +EF RV      G+S ++++  ++
Sbjct: 136 EAMPEAFTALSMSLASGHSLAQGMRFVGAHAQEPVHTEFLRVAAAIDCGISATDALDDLL 195

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             +    +S  +  + V  + G  L++ L+  S ++ +R  +K ++   + +A+ SA ++
Sbjct: 196 VRIDAPGLSLVTLALKVSQRTGAPLADLLSEASSMVGERIELKRRLDVKTSQARMSAHMV 255

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
            ++P  +  ++   S  +   L   P G   + +  A   + ++V+R ++  ++
Sbjct: 256 AAMPTGMCAVLALLSADFRRGLAT-PAGAGAVVLGLALNAVALVVIRRIMRVEL 308


>gi|264678228|ref|YP_003278135.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262208741|gb|ACY32839.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 303

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R  +  ++FP+A D+++  V AG+ +  A    +G+ +D +R +   + E  H
Sbjct: 137 LRWMASRRKREIFENFPDAADLMLVCVEAGMGLDAA----LGKVTDEIRIKSEALAEELH 192

Query: 61  L-------GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
                   G +  +S+  +     + E+  F+ +++   + G ++ E+L   S  LR ++
Sbjct: 193 WTNLEMRAGSTREKSLRNLAARTGVDEIHTFTAMLTQADRFGTSIGESLRVFSDDLRHKR 252

Query: 114 NMKAKVQALSMEAK 127
            M+A+  A  +  K
Sbjct: 253 QMRAEELAAKIPTK 266


>gi|159901127|ref|YP_001547374.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894166|gb|ABX07246.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 301

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IKKR    L   P+ALD++  SV AGL    A+  +  +  + +  EFRR +    LG  
Sbjct: 149 IKKRQKLILKALPDALDLLSISVTAGLGFDAALQRVAEKWDNELCREFRRALSDIRLGTQ 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
             E+   M     +++++ F + +    QLG ++ + L
Sbjct: 209 RHEAFRSMTVRTGVEDLTSFVSAVIQADQLGVSMGKML 246


>gi|167463710|ref|ZP_02328799.1| Flp pilus assembly protein TadB-like protein [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322384398|ref|ZP_08058084.1| hypothetical protein PL1_0930 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321150756|gb|EFX44216.1| hypothetical protein PL1_0930 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 304

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 79/181 (43%), Gaps = 8/181 (4%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRRVI 56
           L+++R  +    F  AL  +  S+ AG  V +A       + ++    S  +  EF  ++
Sbjct: 115 LMRRRKEEMNQQFKQALQCLSTSLSAGKSVENAFRDTLQDLELLYPDPSAMIVQEFGVMV 174

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                G  +   I        L++++ F+ V     + GGNL E +   S ++ ++  + 
Sbjct: 175 RRLDNGEPIEACILGFAERAGLEDITNFADVFITCKRTGGNLIEVIRRTSHLISEKLQIV 234

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP-RGHMLLGVAAAFMLIG 175
            ++  +  + K  + I+ + P  +  ++ F+SP YM  L     R  M +G+   F+ + 
Sbjct: 235 QEISVMVAQKKFESKIMLTAPVAIIGILCFSSPDYMKPLYEGAGRLIMTIGLTVLFLCLW 294

Query: 176 I 176
           I
Sbjct: 295 I 295


>gi|323341960|ref|ZP_08082193.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464385|gb|EFY09578.1| flp pilus assembly protein TadC [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 306

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P  +DI+  SV AGL    A+  +  ++  P+  EFR       LG    E+++R+   
Sbjct: 163 LPEVMDILSVSVVAGLSFDQALGHVTTKAEGPLIEEFRICQREIMLGKPRKEALNRLSER 222

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
             ++EV  F+  I    +LG +L   L + S+++R       + +A  +  K
Sbjct: 223 TEIEEVKSFTNAIIQADELGISLQNVLMSQSQMIRTSHRQDVEERAAKIPVK 274


>gi|91788419|ref|YP_549371.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697644|gb|ABE44473.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 314

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 77/159 (48%), Gaps = 9/159 (5%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI---VGQSSDPVRSEFRRVIE 57
           +K+LI +R  +  + FP+ALD++   V AGL +  A+A +   +G  S  +  E + V  
Sbjct: 148 LKNLISRRQREIFESFPDALDLMTVCVEAGLAMDAALARVASEIGLKSAVLSEELQLVTL 207

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++  +     + +V     ++    + G +++++L   S  LR ++  +A
Sbjct: 208 ELRAGSSKEKALRNLALRTGVDDVDALVAMLIQSERFGTSIADSLRVQSDQLRTKRRQRA 267

Query: 118 KVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           + QA    AK +  ++  L F +  S LV    P ++ +
Sbjct: 268 EEQA----AKIALKLLFPLIFFIFPSLLVVLMGPAFIQI 302


>gi|225386975|ref|ZP_03756739.1| hypothetical protein CLOSTASPAR_00725 [Clostridium asparagiforme
           DSM 15981]
 gi|225046987|gb|EEG57233.1| hypothetical protein CLOSTASPAR_00725 [Clostridium asparagiforme
           DSM 15981]
          Length = 308

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/192 (16%), Positives = 89/192 (46%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA------VIVGQSSDPVRSEFRRV 55
           + L ++R  +   +F + + ++   + AG  + +AVA       ++  +   +  EF  +
Sbjct: 117 EDLKRQRLCRLNLEFKDGILVLASFLSAGYSIENAVAASGRELTLLYGADGLMAGEFEEM 176

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                L  ++      +     L++V+ F+ V +   + GG+L E +++ + ++RD+  +
Sbjct: 177 ARGLRLNRTVESVFLDLGGRSGLEDVNNFAQVFAAAKRSGGDLVEIISHTAGVIRDKVQV 236

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  ++        I+  +P  +   +  TSPG+ +++     G +++    A   I 
Sbjct: 237 QEEIHTMTASKAFEQKIMSLVPVLIVLYIDLTSPGFFDIMYRTMAGRLVMSGCLAVYGIS 296

Query: 176 IMVMRLMINFDV 187
           +++ R ++  ++
Sbjct: 297 LLLARRILQVEI 308


>gi|119715489|ref|YP_922454.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119536150|gb|ABL80767.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 284

 Score = 43.9 bits (102), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 11/160 (6%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  +  + +P A+D +  +VRAG+ + DA+A +  +  +P+R  F +      +    
Sbjct: 98  RRRQRELAEVWPEAVDNLTSAVRAGMSLPDALAGLGSRGPEPLRDAFDQFALDYQVTGRF 157

Query: 66  SESISRMVRYM--PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            E + R+   +  P+ +       I+ +   GG L   L NLS  LRD    +++++A  
Sbjct: 158 GECLDRLKERLADPVGDRVVEGLRIAREVG-GGELGRLLRNLSSYLRDDARTRSELEARQ 216

Query: 124 ME-------AKASAW-IIGSLPFCVSTLVYFTSPGYMNVL 155
                    A AS W ++  + F    +  + SPG + VL
Sbjct: 217 AWTVNGARLAVASPWLVLLFMSFQSEVIHRYASPGGVLVL 256


>gi|156744077|ref|YP_001434206.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235405|gb|ABU60188.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 309

 Score = 43.9 bits (102), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 50/98 (51%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  + L+  P+ALD++  +  AGL   +A+  I  + ++ +  EF RV+    +G+ 
Sbjct: 155 IGQRQTELLNALPDALDLLAIATAAGLSFENAIQEITSKWTNELAREFSRVLRDMSMGVP 214

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
             ++++ M     + +++ F + I     LG ++   L
Sbjct: 215 RRQALTDMAERTGVPDIASFVSAIKQAEALGVSIGRVL 252


>gi|197117442|ref|YP_002137869.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197086802|gb|ACH38073.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 302

 Score = 43.5 bits (101), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 71/160 (44%), Gaps = 17/160 (10%)

Query: 3   HL-IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIE 57
           HL +K R  +     P+ LD++   V AGL + DA  +   ++     +P+  E R+V  
Sbjct: 144 HLKVKARQLEIFHPLPDILDLVTLCVEAGLSI-DAALIRTTETPQFRDNPLAIEIRQVTM 202

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    ES+  M     ++++  F+T+++   + G +LS AL   S  LR ++   A
Sbjct: 203 EVRAGKPRVESLKDMAVRTRVEDIGSFTTMVAQAERFGTSLSHALRTFSDELRTKRRQMA 262

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +      EA A   I    P     L+ F  P  + V++ 
Sbjct: 263 E------EAAAKTTIKLIFP-----LIMFIFPALLVVILG 291


>gi|108756874|ref|YP_632816.1| type II secretion system protein F domain [Myxococcus xanthus DK
           1622]
 gi|108460754|gb|ABF85939.1| type II secretion system protein F domain protein [Myxococcus
           xanthus DK 1622]
          Length = 296

 Score = 43.5 bits (101), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRRVIETQHLGL 63
           +KKR        P +LD++  SV AGL  + A+A +V +    P+R E + V++   +G 
Sbjct: 141 VKKRHLLISRALPYSLDLLTLSVEAGLDFTAALAKVVEKGKPGPLREELQLVLKQLKMGK 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
           +  E +  M+  + L  ++ F T +    ++G +L + L   S  +R  +  +A+
Sbjct: 201 TREEGLKSMIVRVDLPPLTTFVTALIQADKMGTSLGKVLRIQSTQMRIDRTQRAE 255


>gi|21223384|ref|NP_629163.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|8218173|emb|CAB92604.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 300

 Score = 43.5 bits (101), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  E+ + + R 
Sbjct: 154 LPDFLDVLAVVVSAGLGFRQALDRVSTRYEGPWADELRITLRQMDLGMSRREAFTELRRR 213

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 214 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 267


>gi|332284566|ref|YP_004416477.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
 gi|330428519|gb|AEC19853.1| hypothetical protein PT7_1313 [Pusillimonas sp. T7-7]
          Length = 291

 Score = 43.5 bits (101), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 61/143 (42%), Gaps = 5/143 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLG 62
           L ++R  + L +FP  LD+    V AGL +  A+        D P+R E R  +     G
Sbjct: 137 LARQRQFQMLREFPFLLDMTTLCVEAGLNLHGALQQAAQHGPDGPLRGELRHALADMRAG 196

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +   +++  +     L  V    T ++   QLG +L   L + S   R  + ++A+  AL
Sbjct: 197 VPRIQALQELADRCGLPAVQSLVTALAQADQLGMSLGPLLRSQSEQRRAERFLRAEKLAL 256

Query: 123 SMEAKASAWIIGSLPFCVSTLVY 145
               K    ++  + FC+    +
Sbjct: 257 EAPVK----MLFPMVFCIFPCTF 275


>gi|113866736|ref|YP_725225.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525512|emb|CAJ91857.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 324

 Score = 43.5 bits (101), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 80/155 (51%), Gaps = 9/155 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS--DPVRS-EFRRVIETQHL 61
           + +R     ++FP+ +D++   V AGL +  A+  +  + +   PV + E + ++     
Sbjct: 161 VAQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRS 220

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S  +++S +     +++V  F++++    + G +L E+L  LS +LR ++ M+A+ QA
Sbjct: 221 GFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQA 280

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
               AK +  ++  L F +  S L+    P ++ +
Sbjct: 281 ----AKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|269836553|ref|YP_003318781.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785816|gb|ACZ37959.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 307

 Score = 43.5 bits (101), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 72/141 (51%), Gaps = 4/141 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           IK+R +  +   P+A+D++  SV AGL    A+  +V +  + +  EF R++    +G S
Sbjct: 154 IKRRKSAIIRALPDAIDLLTISVEAGLGFDPALQRVVEKWDNELTREFARMLSEIRMGQS 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             E++  +     + +++ F + +    QLG ++++ L   S+ +R R+  +A+ QA   
Sbjct: 214 RREALRDLAERTNVDDLNVFVSAVVQADQLGVSITQVLRVQSKQMRMRRRQRAEEQA--- 270

Query: 125 EAKASAWIIGSLPFCVSTLVY 145
             KA   +I  + F +   +Y
Sbjct: 271 -HKAPVKMIFPMVFLIFPALY 290


>gi|255281814|ref|ZP_05346369.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267487|gb|EET60692.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 245

 Score = 43.5 bits (101), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/196 (16%), Positives = 86/196 (43%), Gaps = 14/196 (7%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS----------E 51
           +  +KKR  +    F   +  +  ++ AG  V +A     G++   +R           E
Sbjct: 54  ESCMKKRQRELSAQFLAGMQSVSVALSAGCSVENAF----GEALRELRQLYEEDAMIVRE 109

Query: 52  FRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRD 111
           FR ++    +  SL + ++ +     ++++  F+ + S   + GGNL   + N  + +  
Sbjct: 110 FRYIVVQLGMNRSLEQLLTGLAVRSGIEDIRNFADIFSAAKRTGGNLIAIIRNTVQCISQ 169

Query: 112 RKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF 171
           ++  + ++       +    I+  +P  +   V   SPG+++V+ ++P G +++ +    
Sbjct: 170 KEETRREINTCLSAKRLEQNIMSIVPCMILVYVQMVSPGFLDVMYHNPAGILIMSICLLV 229

Query: 172 MLIGIMVMRLMINFDV 187
             +  +  R +++ +V
Sbjct: 230 YFLAWLWGRKIVSIEV 245


>gi|253701804|ref|YP_003022993.1| type II secretion system protein [Geobacter sp. M21]
 gi|251776654|gb|ACT19235.1| type II secretion system protein [Geobacter sp. M21]
          Length = 302

 Score = 43.5 bits (101), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 3   HL-IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIE 57
           HL +K R  +     P+ LD++   V AGL + DA  +   ++     +P+  E R+V  
Sbjct: 144 HLKVKARQLEIFHTLPDILDLVTLCVEAGLSM-DAALIRTTETPQFRDNPLAIEIRQVTM 202

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    ES+  M     ++++  F+T+++   + G +LS AL   S  LR ++   A
Sbjct: 203 EVRAGKPRVESLKDMALRTRVEDIGSFTTMVTQAERFGTSLSHALRTFSDELRTKRRQTA 262

Query: 118 KVQA 121
           +  A
Sbjct: 263 EEAA 266


>gi|322419939|ref|YP_004199162.1| Type II secretion system F domain-containing protein [Geobacter sp.
           M18]
 gi|320126326|gb|ADW13886.1| Type II secretion system F domain protein [Geobacter sp. M18]
          Length = 303

 Score = 43.5 bits (101), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 15/162 (9%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVI 56
           + H   +R  K     P+ LD+I   V AGL + DA  +   ++    +DP+  E +   
Sbjct: 143 LYHQYNERQLKIFHTLPDILDLITVCVDAGLSM-DAALIKTTETPQFANDPLAKEIKIAT 201

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                G    ES+  M     + +V  F T++S   + G +LS+AL+  +  LR ++   
Sbjct: 202 METRAGKPRIESLKDMAERTMVDDVRAFVTMLSQTERFGTSLSQALSVHAESLRTKRRQM 261

Query: 117 AKVQALSMEAKASAWIIGSLPFCV----STLVYFTSPGYMNV 154
           A+      EA A   I    P  +    + LV    P Y+ +
Sbjct: 262 AE------EAAAKTTIKMVFPLILFIFPALLVVILGPAYVQI 297


>gi|20808466|ref|NP_623637.1| hypothetical protein TTE2067 [Thermoanaerobacter tengcongensis MB4]
 gi|20517084|gb|AAM25241.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 309

 Score = 43.5 bits (101), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 81/182 (44%), Gaps = 4/182 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ + +KR  KF   F  A+  I   ++    + +A+  ++  + +P++ E ++++    
Sbjct: 121 LEKIAQKRYVKFNLQFAEAVQDIADYLKISGNIVNALEKVIDTTENPLKDEIKKIVAKVD 180

Query: 61  LGLSLSESISRMVRY--MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
            G+SL E++    +    PL E    S V +   Q+  N ++    +S  +++R     K
Sbjct: 181 AGISLYEALKDFAKESGSPLVEAWVDSMVFA--GQMKANTADICQKMSAKIKERIRQNNK 238

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           + +     K++  +I ++   +    Y + P Y           +LL +  ++++  + V
Sbjct: 239 ISSFMKSTKSTVIMIIAITILLMLSTYTSGPMYAEAFTTTAGKLVLLYIIISYVVTTVFV 298

Query: 179 MR 180
            R
Sbjct: 299 FR 300


>gi|87199542|ref|YP_496799.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135223|gb|ABD25965.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 322

 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVS---DAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           +R     + FPN LD+I+  V AGL +    D V+  + ++   V     R       G 
Sbjct: 164 RRMEAITNGFPNCLDLILVCVEAGLGMEAAFDRVSREIARAEPQVAHLLVRTNLHLRAGA 223

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           +  E++ RM     + E+  F+T++    +LG ++   L   +  +R+++ M+A+ +A
Sbjct: 224 TREEALHRMATLAGVDEIRSFATLLIQSEKLGTSIGTTLRVFASEMREKRRMRAEEKA 281


>gi|160935910|ref|ZP_02083284.1| hypothetical protein CLOBOL_00803 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441152|gb|EDP18869.1| hypothetical protein CLOBOL_00803 [Clostridium bolteae ATCC
           BAA-613]
          Length = 245

 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 77/184 (41%), Gaps = 11/184 (5%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRRVI 56
           +L K+R  +    F   + ++   + AG  + + + + + +        + +  EFR + 
Sbjct: 55  NLKKERARRLELQFKEGIQVLSSFLSAGYSLENGLTLSIKELEILFGRREMITEEFRILS 114

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
           +   +     E      R   +++V  F+ V+S   + GG L E +   + I+RD+  +K
Sbjct: 115 DGIRMNRPAEELFMDFGRRSGVEDVDNFAQVLSAAKRSGGELVEIIRQTAGIIRDKVQVK 174

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH-----MLLGVAAAF 171
            ++  +         I+  +PF +   +  TSPG+ +V+     G       L   A A 
Sbjct: 175 EEIHTMLASRIFEQRIMNLIPFLIVLYIDLTSPGFFSVMYGTWMGRSVMTMCLAAYAGAL 234

Query: 172 MLIG 175
           +L G
Sbjct: 235 VLAG 238


>gi|194288828|ref|YP_002004735.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222663|emb|CAQ68666.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 324

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 80/155 (51%), Gaps = 9/155 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS--DPVRS-EFRRVIETQHL 61
           + +R     ++FP+ +D++   V AGL +  A+  +  + +   PV + E + ++     
Sbjct: 161 VSQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRS 220

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S  ++++ +     +++V  F++++    + G +L E+L  LS +LR ++ M+A+ QA
Sbjct: 221 GFSKEKALTNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQA 280

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
               AK +  ++  L F +  S L+    P ++ +
Sbjct: 281 ----AKIALKLLFPLIFTIFPSLLLVLLGPAFIQI 311


>gi|210629925|ref|ZP_03296172.1| hypothetical protein COLSTE_00055 [Collinsella stercoris DSM 13279]
 gi|210160742|gb|EEA91713.1| hypothetical protein COLSTE_00055 [Collinsella stercoris DSM 13279]
          Length = 254

 Score = 43.1 bits (100), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 78/171 (45%), Gaps = 1/171 (0%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P A   +  S+ +GL ++ A+  + G+S +PVR+EF         G+S  +++  +V  
Sbjct: 84  MPEAFGALAFSLGSGLSLAQAMQYVGGRSEEPVRTEFLHASALMTCGVSSVDALDELVTR 143

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
           +    +      + V  + G +L+  L+  + ++ +R  +   ++  + + + SA ++  
Sbjct: 144 LNAPALDLVVLALKVSRKTGASLTGLLSEAAGLVGERIELARNLEVKTAQVRMSARLVAG 203

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +P  +   +   S  +   +   P G   L VA A  +   +V+R ++  D
Sbjct: 204 MPVIMVGFLSLVSRDFRAGVATGP-GIGSLAVALALNIAAWLVIRKIMQVD 253


>gi|254475205|ref|ZP_05088591.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
 gi|214029448|gb|EEB70283.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
          Length = 327

 Score = 43.1 bits (100), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 75/154 (48%), Gaps = 4/154 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           I++R  +    FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V      
Sbjct: 169 IEERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALAEEFEVVAYEMKA 228

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    + +  M     +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A+  A
Sbjct: 229 GKEKDKVLRDMGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRAEEAA 288

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
             +  K + A +  ++P  +  LV  ++ G  N+
Sbjct: 289 NKLPTKMTLATMTLTVPPLLIILVGPSAQGIANL 322


>gi|294631144|ref|ZP_06709704.1| integral membrane protein [Streptomyces sp. e14]
 gi|292834477|gb|EFF92826.1| integral membrane protein [Streptomyces sp. e14]
          Length = 295

 Score = 43.1 bits (100), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  ++ + + R 
Sbjct: 149 LPDFLDVLAVVVSAGLGFRQALDRVAARYEGPWADELRITLRQMDLGMSRRQAFAELRRR 208

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 209 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 262


>gi|297202077|ref|ZP_06919474.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297148030|gb|EDY58317.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 296

 Score = 43.1 bits (100), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  ++ + + R 
Sbjct: 150 LPDFLDVLAVVVSAGLGFRQALDRVASKYEGPWADELRITLRQMDLGMSRRQAFAELRRR 209

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 210 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 263


>gi|253996761|ref|YP_003048825.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983440|gb|ACT48298.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 312

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 71/160 (44%), Gaps = 11/160 (6%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H I  R  +  + FP+ALD+I+  V +GL + DA    VG+            +   +
Sbjct: 147 LSHRIDSRKREIFESFPDALDLIIVCVESGLGL-DAALARVGEEMHVRSPTLGEELHLIN 205

Query: 61  LGLSLSESISRMVRYMPL----QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
           L L    S  R +R + L    +EV     ++    + G N+S++L    R+  D    K
Sbjct: 206 LELRAGSSRERALRNLALRTGVEEVDTLVAMLVQSDRFGTNISDSL----RVHADSLRTK 261

Query: 117 AKVQALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
            ++ A    AK +  ++  L F +  S L+    P ++N+
Sbjct: 262 RRLLAEEAAAKIAVKLLFPLIFFIFPSMLLVLLGPAFINI 301


>gi|304311188|ref|YP_003810786.1| type II secretion system protein [gamma proteobacterium HdN1]
 gi|301796921|emb|CBL45134.1| type II secretion system protein [gamma proteobacterium HdN1]
          Length = 319

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 1/118 (0%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA-VIVGQSSDPVRSEFRRVIETQHLGL 63
           I +R    L +FP  LD++V  +RAGL  + A+   I    +  +R EF +V+     G 
Sbjct: 156 INRRRRITLKEFPFMLDLLVLGMRAGLNYAAALGHAIEAMPNGVIRDEFSKVLREIRAGK 215

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           S  E++  +   M L+ +S F   ++   + GG +   L   +   R+ +   A++ A
Sbjct: 216 SRREALLTLADRMNLEAISNFVAAVNQVEETGGEIVSVLMVQAEQRRNERFTAAEIAA 273


>gi|239929198|ref|ZP_04686151.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291437532|ref|ZP_06576922.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340427|gb|EFE67383.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 295

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  ++ + + R 
Sbjct: 149 LPDFLDVLAVVVSAGLGFRQALDRVASKYEGPWADELRITLRQMDLGMSRRQAFAELRRR 208

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 209 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 262


>gi|302553855|ref|ZP_07306197.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471473|gb|EFL34566.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 295

 Score = 43.1 bits (100), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  ++ + + R 
Sbjct: 149 LPDFLDVLAVVVSAGLGFRQALDRVASRYEGPWADELRITLRQMDLGMSRRQAFAELRRR 208

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 209 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 262


>gi|300704935|ref|YP_003746538.1| tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072599|emb|CBJ43949.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CFBP2957]
          Length = 314

 Score = 43.1 bits (100), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 79/156 (50%), Gaps = 9/156 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRS-EFRRVIETQHL 61
           I++R     + FP++LD+I+  V AGL +  AV  +V +  ++ P  + E+  +      
Sbjct: 153 IRRRQRDIFEAFPDSLDLIMVCVEAGLGLDAAVLRVVEEMRTARPAMAEEYELLTLELRA 212

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL+  +++  +     +++VS    ++    + G +++E+L   S +LR +++M A+ +A
Sbjct: 213 GLAREKALRNLAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRHMLAEERA 272

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNVL 155
               AK    I+  L FC+  S  V    P  + V+
Sbjct: 273 ----AKIGTKILFPLIFCIFPSLFVVLLGPAAIQVV 304


>gi|238755455|ref|ZP_04616795.1| hypothetical protein yruck0001_3320 [Yersinia ruckeri ATCC 29473]
 gi|238706296|gb|EEP98673.1| hypothetical protein yruck0001_3320 [Yersinia ruckeri ATCC 29473]
          Length = 165

 Score = 42.7 bits (99), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/134 (18%), Positives = 61/134 (45%)

Query: 50  SEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRIL 109
           +EF  +    +LG +     +   R     E  FF++VI +  + GG LS+ +  + + +
Sbjct: 28  NEFNLIYRRLNLGEAPEIVFNDAYRKFNYAEFHFFTSVILLNIKQGGQLSDLIKKMHKGI 87

Query: 110 RDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA 169
            +   +K +   ++ + + +  ++  +P   +  +Y+  P  +  L +   G  ++    
Sbjct: 88  TESNKLKQRKAIMTAQIRMTTNVVSLIPIVFTAFLYYIDPNSIETLWSQDVGKEIISYIV 147

Query: 170 AFMLIGIMVMRLMI 183
              ++GI ++R MI
Sbjct: 148 ISEILGIFIIRNMI 161


>gi|227871817|ref|ZP_03990219.1| type II secretion system protein [Oribacterium sinus F0268]
 gi|227842318|gb|EEJ52546.1| type II secretion system protein [Oribacterium sinus F0268]
          Length = 224

 Score = 42.7 bits (99), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           KKR    +  F   L I+   + AG  + +A+   +    + +  +   V E + +  SL
Sbjct: 37  KKRQEVLVSQFKEMLSILSAYLSAGYSLENALFACIPDLENLLGKKCYMVEELKQIKRSL 96

Query: 66  S------ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
           S      E++S+      + ++  FS +  V  + GG+L + +   S I+RD+  +  ++
Sbjct: 97  SMNRPLEEALSQFALRSGVDDIHNFSEIFLVAKRSGGDLIQIIQQSSTIIRDKLTITEEI 156

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
             L+   +    I+  +PF +   +  +SP +  +L +   G  ++       L+ I + 
Sbjct: 157 ITLNASRRFEQKIMNGVPFFMIFYLNASSPEFFRILYSTIMGRGVMSFCLCIYLLAIYLS 216

Query: 180 RLMI 183
           + +I
Sbjct: 217 QKII 220


>gi|317123667|ref|YP_004097779.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315587755|gb|ADU47052.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 306

 Score = 42.7 bits (99), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 8/161 (4%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSL 65
           +R  +       ALD++   V AG    DA  V V +S+D P+  EF RV+    +G S 
Sbjct: 151 RRQEQVATGLAEALDMLTVCVEAGQGF-DAALVQVARSTDGPISGEFARVLSEVQIGKSR 209

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           SE+ + +   + L +V  F + I    +LG  ++  L   +  +R  +  +A+ +A  + 
Sbjct: 210 SEAFAGLGDRVSLSDVKNFVSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVT 269

Query: 126 AKASAWIIGSLPFCV--STLVYFTSPGYMNVLINDPRGHML 164
            K    I+  L  C+  +  V    PG + ++     G++L
Sbjct: 270 VK----ILFPLLLCIFPAMFVVILGPGIIRMITTLFGGNLL 306


>gi|302037432|ref|YP_003797754.1| pilus assembly protein TadC [Candidatus Nitrospira defluvii]
 gi|300605496|emb|CBK41829.1| Pilus assembly protein TadC [Candidatus Nitrospira defluvii]
          Length = 318

 Score = 42.7 bits (99), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I+ R    L  FP+ALD++V  V AGL + D     VGQ    +  E    +   +
Sbjct: 154 LQRRIESRQRNILAAFPDALDLMVVCVEAGLSL-DVAITRVGQELQLMHRELSEELRALY 212

Query: 61  LGLSLSESISRMVR----YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
           L L    S  + +R     + L+EV  F  ++    + G ++ +AL   +  LR R++++
Sbjct: 213 LELRTGRSRQQALRNAGLRIQLEEVQSFVALLVQTERFGTSVGQALRAHADGLRTRQDLQ 272

Query: 117 AKVQA 121
           A   A
Sbjct: 273 ATEMA 277


>gi|146276356|ref|YP_001166515.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554597|gb|ABP69210.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 323

 Score = 42.7 bits (99), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIE 57
           +K   ++R  + +  FP+ALD+++  V AG  +  ++  +  +S+     +  EF  V  
Sbjct: 162 IKRRAQERHDQIVAGFPDALDMMLVCVEAGQSLDQSILRVARESASGYPALAEEFEMVAH 221

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M   + + +VS F T +   +  G +++EAL   S  +RD++ M+A
Sbjct: 222 EVKAGKERVAVLKDMAERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRA 281

Query: 118 KVQALSMEAK 127
           + +A ++  K
Sbjct: 282 EEKANTLPTK 291


>gi|196047886|ref|ZP_03115064.1| conserved membrane protein, putative [Bacillus cereus 03BB108]
 gi|196021142|gb|EDX59871.1| conserved membrane protein, putative [Bacillus cereus 03BB108]
          Length = 327

 Score = 42.7 bits (99), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 73/158 (46%), Gaps = 8/158 (5%)

Query: 33  VSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQS 92
           V D+V  +       ++ E  +       G S++ES   + +  P QE+ FF  ++ V  
Sbjct: 171 VVDSVEEVKPLVHSSIKEELNKATIKLQQGKSVNESFMSLDKKYPYQELKFFHEMLDVAD 230

Query: 93  QLGGNLSEALANLSRILRDRKNMKAKVQALSMEA----KASAWIIGSLPFCVSTLVYFTS 148
           + GG   EAL +++    +RK  + ++ A +++     + SA  + ++PF     V    
Sbjct: 231 KNGGRNIEALESIAVDFEERKVKQMRLYAETIQGTKAFRNSALTVLAIPFIFKFFV---- 286

Query: 149 PGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           P    +L++ P G ++    A  +L   + ++ + ++D
Sbjct: 287 PDAYGMLMSTPLGSIVFVSIACVVLYCYIRIQKLADWD 324


>gi|256785513|ref|ZP_05523944.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 300

 Score = 42.4 bits (98), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+   E+ + + R 
Sbjct: 154 LPDFLDVLAVVVSAGLGFRQALDRVSTRYEGPWADELRITLRQMDLGMGRREAFTELRRR 213

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 214 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 267


>gi|149178503|ref|ZP_01857091.1| type II secretion system protein [Planctomyces maris DSM 8797]
 gi|148842618|gb|EDL56993.1| type II secretion system protein [Planctomyces maris DSM 8797]
          Length = 334

 Score = 42.4 bits (98), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 82/168 (48%), Gaps = 13/168 (7%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +++   +R  +     P+ALD+++  +  G+P+  A+  +  +   S   +  EF  +I 
Sbjct: 142 LQNQANRRVHRIQRGLPDALDLVMMCLTGGVPLRTALERVTDEVRFSHPDIAVEFE-IIR 200

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                 S+++++ +  + +   +V+  S +IS   +LG N+S AL + +  +R +   +A
Sbjct: 201 RHADANSMADALKQFAKRIDAPDVNALSLMISQTERLGTNVSTALIDFADGVRRKYRQRA 260

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY--FTSPGYM---NVLINDPR 160
           +  +    +K S  ++  + FC++  +Y  F  P  +   N LI + R
Sbjct: 261 EENS----SKTSIKLLFPIIFCMAPPIYILFFGPAVLELRNFLIREHR 304


>gi|78060306|ref|YP_366881.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
 gi|77964856|gb|ABB06237.1| putative Flp pilus assembly protein TadC [Burkholderia sp. 383]
          Length = 324

 Score = 42.4 bits (98), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 76/162 (46%), Gaps = 14/162 (8%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +K R  K  +DFP+ALD++   V AGL +  A+  +  +   SS+ V SE   ++     
Sbjct: 161 VKVRQQKIFEDFPDALDLLTVCVEAGLGLDAALMKVSEELRFSSEVVASELDLLLLEMRS 220

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +   ++  +     ++++  F  ++    + G ++SE+L    R+L D    + +++A
Sbjct: 221 GFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESL----RVLSDMLRTRRRMRA 276

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
               AK +  ++  L FC+        P  M VL+     H+
Sbjct: 277 EERAAKIALKLLFPLIFCI-------FPALMLVLLGPAMIHV 311


>gi|258405283|ref|YP_003198025.1| Type II secretion system F domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797510|gb|ACV68447.1| Type II secretion system F domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 320

 Score = 42.4 bits (98), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIETQHLG 62
           +KR    L  FP+ALD++V  V AG+ +  A++ +  +S      +  E          G
Sbjct: 164 QKRRQTILKGFPDALDLMVVCVEAGMGLDAAISRVAKESKSNNATLSEELHFFTLETRAG 223

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +   +++  +     LQ++   +T++    + G ++S+AL   S  +R  +  +A+ +A 
Sbjct: 224 MPRKDALKNLAMRTDLQQMQNLTTLLIQTEKFGTSVSQALKVFSESMRTERFQRAEEKAA 283

Query: 123 SMEAK 127
            +  K
Sbjct: 284 KIPVK 288


>gi|289769409|ref|ZP_06528787.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289699608|gb|EFD67037.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 291

 Score = 42.4 bits (98), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+   E+ + + R 
Sbjct: 145 LPDFLDVLAVVVSAGLGFRQALDRVSTRYEGPWADELRITLRQMDLGMGRREAFTELRRR 204

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 205 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 258


>gi|17545369|ref|NP_518771.1| tight adherence TadC-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427661|emb|CAD14180.1| probable pilus assembly tadc transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 315

 Score = 42.4 bits (98), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 75/144 (52%), Gaps = 7/144 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG--QSSDPVRS-EFRRVIETQHL 61
           IK R  +  + FP++LD+I+  V AGL +  A+  +V   +++ PV + E+  +      
Sbjct: 155 IKYRQREIFESFPDSLDLIMVCVEAGLSLDAAILRVVDDMRTARPVMAEEYELLTLELRA 214

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GLS  +++  +     + +VS    ++    + G +++++L   S +LR +++M A+ +A
Sbjct: 215 GLSREKALRNLAARTGVDDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERA 274

Query: 122 LSMEAKASAWIIGSLPFCVSTLVY 145
               AK    ++  L FC+   +Y
Sbjct: 275 ----AKIGTKVLFPLIFCIFPSLY 294


>gi|114764951|ref|ZP_01444124.1| Putative Flp pilus assembly protein TadC [Pelagibaca bermudensis
           HTCC2601]
 gi|114542663|gb|EAU45687.1| Putative Flp pilus assembly protein TadC [Roseovarius sp. HTCC2601]
          Length = 323

 Score = 42.4 bits (98), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +++R  +  + FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +      
Sbjct: 165 VEERKKQIEEGFPDALDMMLVCVEAGQSLDQSIVRVSKEIRASYAALADEFEIISHEMKA 224

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  ++ M     + +VS F TV++  S  G ++++AL   +  +RD++ M+A+ +A
Sbjct: 225 GKDKASVLNDMGERCGVADVSSFVTVLNQASTFGTSIADALRIYASEMRDKRVMRAEEKA 284

Query: 122 LSMEAK 127
             +  K
Sbjct: 285 NKLPTK 290


>gi|254511547|ref|ZP_05123614.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221535258|gb|EEE38246.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 325

 Score = 42.4 bits (98), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 73/152 (48%), Gaps = 4/152 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +++R    ++ FP+ LD+++  V AG  +  A+  +  +   S   +  EF  V      
Sbjct: 169 VEERKEAIVNGFPDTLDLMLVCVEAGQSLDQAIVRVAAEMKASYPDIALEFEVVAYEMKA 228

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G      +        +Q+VS F TV+   +  G ++++AL   S  +RD++ M+A+  A
Sbjct: 229 GKEKDTVLRDFATRCGVQDVSAFVTVMIQSAAFGTSIADALRVYSDEMRDKRVMRAEEAA 288

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYM 152
             +  K + A ++ ++P  +  LV  ++ G M
Sbjct: 289 NKLPTKMTLATMMLTVPPLLVILVGPSAKGIM 320


>gi|302558695|ref|ZP_07311037.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302476313|gb|EFL39406.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 295

 Score = 42.4 bits (98), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    LG+S  ++ + + R 
Sbjct: 149 LPDFLDVLAVVVSAGLGFRQALDRVSSKYEGPWADELRITLRQMDLGMSRRQAFAELRRR 208

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + + L +L++ +R      A+ +A     KA+
Sbjct: 209 NDSEQVAMFVTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKAT 262


>gi|115376375|ref|ZP_01463612.1| flp pilus assembling protein [Stigmatella aurantiaca DW4/3-1]
 gi|115366582|gb|EAU65580.1| flp pilus assembling protein [Stigmatella aurantiaca DW4/3-1]
          Length = 90

 Score = 42.4 bits (98), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 53/90 (58%)

Query: 98  LSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           ++E    +S ++R+R  ++ K+ AL+ + K   WI+ S+P  +  ++    P  M  +++
Sbjct: 1   MAEMFETISMVIRERFRLEGKIDALTSQGKLQGWIVASMPAVLGMVLNSMRPDLMEPMMD 60

Query: 158 DPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
              G++L+ V A   ++GI+++R ++N D+
Sbjct: 61  HMFGYVLVTVIAIMEILGILIIRRIVNIDI 90


>gi|163814843|ref|ZP_02206231.1| hypothetical protein COPEUT_00993 [Coprococcus eutactus ATCC 27759]
 gi|158449782|gb|EDP26777.1| hypothetical protein COPEUT_00993 [Coprococcus eutactus ATCC 27759]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 66/141 (46%), Gaps = 7/141 (4%)

Query: 43  QSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
           Q    ++ E + +I    +   +   +        L +V  F+ V +V  + GGNL + +
Sbjct: 102 QGRSYIQGEIKMIIAGLEMNTDMKILLKNFAERSGLDDVMEFAKVSAVAGRSGGNLIKMM 161

Query: 103 ANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
             + + + +R  ++ ++  +    +    I+ ++PF +   +   +PGYMN L  +    
Sbjct: 162 KKMVQTIEERLEVEDEIDTMVTAKRMEYNIMSAMPFVIVLYMRVCNPGYMNALYGN---- 217

Query: 163 MLLGVAAAFMLIGIMVMRLMI 183
            + G+AA  M + ++V+ LM+
Sbjct: 218 -VFGIAA--MSVCLIVIFLMV 235


>gi|56697924|ref|YP_168295.1| TadC family type II/IV secretion system protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679661|gb|AAV96327.1| type II/IV secretion system protein, TadC subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 326

 Score = 42.0 bits (97), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 72/143 (50%), Gaps = 4/143 (2%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHLGLSLSESISRM 72
           FP+ALD+++  V AG  +  ++  +  +   S   +  EF  V      G    + +  M
Sbjct: 179 FPDALDMLLVCVEAGQSLDQSIVRVSKELRASYPDLADEFEMVAYEMKAGKEKDKVLRDM 238

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS-AW 131
                + +VS F TV+   SQ G +++EAL   +  +RD++ M+A+  A  +  K + A 
Sbjct: 239 GTRCGVVDVSSFVTVMIQSSQFGTSIAEALRVYAGEMRDKRVMRAEEAANKLPTKMTLAT 298

Query: 132 IIGSLPFCVSTLVYFTSPGYMNV 154
           ++ ++P  +  LV  ++ G M++
Sbjct: 299 MMLTVPPLLIILVGPSAKGIMDL 321


>gi|94309584|ref|YP_582794.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353436|gb|ABF07525.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Cupriavidus metallidurans CH34]
          Length = 323

 Score = 42.0 bits (97), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS--DPVRS-EFRRVIETQHL 61
           +  R     ++FP+ +D++   V AGL +  A+  +  + +   PV + E + ++     
Sbjct: 161 VTARQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRS 220

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S  +++S +     +++V  F++++    + G +L E+L  LS +LR ++ M+A+ QA
Sbjct: 221 GFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQA 280

Query: 122 LSMEAK 127
             +  K
Sbjct: 281 AKIALK 286


>gi|259418040|ref|ZP_05741959.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346946|gb|EEW58760.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 323

 Score = 42.0 bits (97), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 76/155 (49%), Gaps = 6/155 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ----SSDPVRSEFRRVIETQH 60
           I++R       FP+ALD+++  V AG  +  A+ V VG+    S   +  EF  V     
Sbjct: 168 IEERKQAITRAFPDALDMMLVCVEAGQSLDQAI-VRVGKELRASYPELAEEFEIVAYEMK 226

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G    + +  M     +Q+V+ F TV+   +  G ++++AL   +  +RD++ M+A+  
Sbjct: 227 AGKEKDKVLRDMGTRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRAEEA 286

Query: 121 ALSMEAKASAWIIG-SLPFCVSTLVYFTSPGYMNV 154
           A  +  K +   +G ++P  ++ L+  +  G  N+
Sbjct: 287 ANKLPTKMTLATMGLTVPPLLAILIAPSVQGLGNI 321


>gi|21326712|gb|AAL92472.1| TadC [Haemophilus ducreyi]
          Length = 281

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 77/157 (49%), Gaps = 6/157 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           +IK +  + + D P  +D++  +V+ G+ +  A   V++   + +  +     R+I    
Sbjct: 126 IIKSKIKRIMSDLPGFIDLVAVNVQTGISIEAAFKQVSMDFERLNPDLTYVLLRIIRRAE 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  SL+ ++  +   +P +E+  F TV+      G ++ + L  LS  +RD + +  + +
Sbjct: 186 LT-SLNVALQDLAISLPTKEIRMFCTVMQQSLNFGSSVYDNLTMLSADIRDMQLLVMEEK 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             ++ AK S  +I  + F +  L+   +PG M VL N
Sbjct: 245 LGTLAAKMSVPLILFVMFPIIILI--VAPGAMRVLPN 279


>gi|197295161|ref|YP_002153702.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944640|emb|CAR57244.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 324

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 76/156 (48%), Gaps = 11/156 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIETQH 60
           +K R  K  +DFP+ALD++   V AGL + DA  + V +     S+ V SE   ++    
Sbjct: 161 VKVRQQKIFEDFPDALDLLTVCVEAGLGL-DAALMKVSEELRFRSEVVASELDLLLLEMR 219

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +   ++  +     ++++  F  ++    + G ++SE+L    R+L D    + +++
Sbjct: 220 SGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESL----RVLSDMLRTRRRMR 275

Query: 121 ALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           A    AK +  ++  L FC+  + +V    P  ++V
Sbjct: 276 AEERAAKIALKLLFPLIFCIFPALMVVLLGPAMIHV 311


>gi|167566943|ref|ZP_02359859.1| type II secretion system protein [Burkholderia oklahomensis EO147]
 gi|167574012|ref|ZP_02366886.1| type II secretion system protein [Burkholderia oklahomensis C6786]
          Length = 318

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 72/155 (46%), Gaps = 9/155 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           I  R    ++DFP+ALD++   + AGL +   +  +  +    S  V  E   ++     
Sbjct: 157 IASRQRVIVEDFPDALDLLTVCIEAGLGLDAGLMKVADELRLRSPVVADELGLMLLEMRS 216

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S   ++  +      +++  FS ++    + G ++  +L  LS  LR ++ M+A+ +A
Sbjct: 217 GFSKETALRNLALRTGAEDIDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRAEERA 276

Query: 122 LSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
               AK +  ++  L FC+  + L     P ++++
Sbjct: 277 ----AKIALKLLFPLIFCIFPALLTVLLGPAFIHI 307


>gi|33152381|ref|NP_873734.1| tight adherence protein C [Haemophilus ducreyi 35000HP]
 gi|33148604|gb|AAP96123.1| tight adherence protein C [Haemophilus ducreyi 35000HP]
          Length = 290

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 77/157 (49%), Gaps = 6/157 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           +IK +  + + D P  +D++  +V+ G+ +  A   V++   + +  +     R+I    
Sbjct: 135 IIKSKIKRIMSDLPGFIDLVAVNVQTGISIEAAFKQVSMDFERLNPDLTYVLLRIIRRAE 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L  SL+ ++  +   +P +E+  F TV+      G ++ + L  LS  +RD + +  + +
Sbjct: 195 LT-SLNVALQDLAISLPTKEIRMFCTVMQQSLNFGSSVYDNLTMLSADIRDMQLLVMEEK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             ++ AK S  +I  + F +  L+   +PG M VL N
Sbjct: 254 LGTLAAKMSVPLILFVMFPIIILI--VAPGAMRVLPN 288


>gi|332560332|ref|ZP_08414654.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
 gi|332278044|gb|EGJ23359.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
          Length = 326

 Score = 42.0 bits (97), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +K   ++R  + +  FP+ALD+++  V AG  +  ++  +  +S+     +  EF  V  
Sbjct: 165 IKRRAQERYDQIVSGFPDALDMMLVCVEAGQSLDQSILRVARESAAGYPALAEEFEMVAH 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M   + + +VS F T +   +  G +++EAL   S  +RD++ M+A
Sbjct: 225 EVKAGKERVAVLKDMSERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRA 284

Query: 118 KVQALSMEAK 127
           + +A ++  K
Sbjct: 285 EEKANTLPTK 294


>gi|148657456|ref|YP_001277661.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148569566|gb|ABQ91711.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 309

 Score = 42.0 bits (97), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 50/98 (51%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  + L+  P+ALD++  +  AGL    A+  I  + ++ +  EF RV+    +G+ 
Sbjct: 155 IRQRQTELLNALPDALDLLAIASAAGLSFESAMQEITSKWTNELAREFSRVLRDMSMGVP 214

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
             ++++ M     + +++ F + +     LG ++   L
Sbjct: 215 RRQALTDMAERTGVSDIASFVSAVKQAEALGISIGRVL 252


>gi|187251609|ref|YP_001876091.1| TadC subunit [Elusimicrobium minutum Pei191]
 gi|186971769|gb|ACC98754.1| TadC subunit [Elusimicrobium minutum Pei191]
          Length = 296

 Score = 42.0 bits (97), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIV--GQSSDPVRSEFRRVIETQHLG 62
           I+KR    L +F   +D+    + +GL    A   I+   +    +  E  +++    LG
Sbjct: 139 IQKRQRDMLGNFSTTVDLAALIIESGLDYMTAFDRIIRIAKEKTVLEEELDKMLNEVKLG 198

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
            S  E++ R+     +QE+  F  +I    +LG +L + L N S  LR R+  KA+
Sbjct: 199 YSRREALERLANRTGVQEIRSFVGLIIQSDELGTSLVDLLRNFSIDLRFRRMNKAE 254


>gi|126461326|ref|YP_001042440.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638311|ref|YP_002524573.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
 gi|126102990|gb|ABN75668.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159092|gb|ACM00072.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
          Length = 326

 Score = 42.0 bits (97), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +K   ++R  + +  FP+ALD+++  V AG  +  ++  +  +S+     +  EF  V  
Sbjct: 165 IKRRAQERYDQIVSGFPDALDMMLVCVEAGQSLDQSILRVARESAAGYPALAEEFEMVAH 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M   + + +VS F T +   +  G +++EAL   S  +RD++ M+A
Sbjct: 225 EVKAGKERVAVLKDMSERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRA 284

Query: 118 KVQALSMEAK 127
           + +A ++  K
Sbjct: 285 EEKANTLPTK 294


>gi|83943934|ref|ZP_00956391.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83954507|ref|ZP_00963218.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840791|gb|EAP79962.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845181|gb|EAP83061.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 305

 Score = 41.6 bits (96), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 73/154 (47%), Gaps = 7/154 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           + +R  +    FP+ALD+++  V AG  +   +  +  +   S   +  EF  V      
Sbjct: 150 VAERKEEITRGFPDALDMMLVCVEAGQSLDQCIVRVARELRASYPALAEEFEIVAYEMKA 209

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G      ++ M     +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A+  A
Sbjct: 210 GKDKVSVLNAMGERCGVQDVSSFVTVLVQSAAFGTSIADALRVYAAEMRDKRVMRAEEAA 269

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
             +  K + A ++ ++P     L+   +P  MN+
Sbjct: 270 NKLPTKMTLATMMLTVP---PLLIILVAPSVMNI 300


>gi|283787697|ref|YP_003367562.1| tight adherence protein C [Citrobacter rodentium ICC168]
 gi|282951151|emb|CBG90842.1| putative tight adherence protein C [Citrobacter rodentium ICC168]
          Length = 283

 Score = 41.6 bits (96), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 79/159 (49%), Gaps = 10/159 (6%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF-----RRVI 56
           K +I  R  +  +D P  +DI+   V++G+ + + +  +  ++++ +  +      R ++
Sbjct: 124 KMIIDSRVRRICNDLPYIIDIMAICVQSGMTIENTIRYL-AENTETINPDISVLLARTIM 182

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
           + +  G+S  E++  +   +P QE+   ++ +    + G ++   L +LSR +R+ + + 
Sbjct: 183 KMEVSGMS--EALDLLYNEVPSQEIRMLASTLQQSIKFGSSIYLLLLDLSREIREMQLLA 240

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
              +  S+ AK S  +I  + F +  LV    PG + ++
Sbjct: 241 IDEKISSLAAKMSLPMIICIMFPI--LVLVAGPGVIRIV 277


>gi|297192377|ref|ZP_06909775.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197723022|gb|EDY66930.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 296

 Score = 41.6 bits (96), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 58/130 (44%), Gaps = 4/130 (3%)

Query: 4   LIKKRTAKFLDD----FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ 59
           L++   A+  DD     P+ LD++   V AGL    A+  +  + + P   E R  +   
Sbjct: 134 LLRAAIARRRDDIERTLPDFLDVLAVVVSAGLGFRQALERVAEKYAGPWSDELRITLRQM 193

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
            +G+   E+  ++ R    ++VS F + +    +LG  + + L  ++  +R      A+ 
Sbjct: 194 DMGMGRREAFEQLRRRNESEQVSMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARR 253

Query: 120 QALSMEAKAS 129
           +A     KA+
Sbjct: 254 KAAKAVPKAT 263


>gi|110679391|ref|YP_682398.1| TadC family type II/IV secretion system protein [Roseobacter
           denitrificans OCh 114]
 gi|109455507|gb|ABG31712.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter denitrificans OCh 114]
          Length = 355

 Score = 41.6 bits (96), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 3/128 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +  R  +    FP++LD+++  V AG  +   +  +  +   S   +  EF  V      
Sbjct: 195 VDARKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAYEMKA 254

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  ++       +Q+VS F TV++   Q G +++EAL   +  +RD++ M+A+  A
Sbjct: 255 GKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAEEMRDKRVMRAEEAA 314

Query: 122 LSMEAKAS 129
             +  K +
Sbjct: 315 NKLPTKMT 322


>gi|294140782|ref|YP_003556760.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
 gi|293327251|dbj|BAJ01982.1| Flp pilus assembly protein TadC [Shewanella violacea DSS12]
          Length = 322

 Score = 41.6 bits (96), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +++L  +R  +    FP+ALD++V    AGL +  A+  +  +   S   + SE   V  
Sbjct: 160 LQNLASRRMKELRAGFPDALDLLVVCCEAGLGLLAALQRVANELAISHVSLASELDLVCS 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  ++        L ++   ++ IS   +LG  ++  L   S   RD++  +A
Sbjct: 220 KVRAGLTIKVALQEFTDRTGLDDIKGLNSAISQSIRLGTGIAATLRVFSDEYRDKRLQEA 279

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 280 EEQAAKLAVK 289


>gi|119773848|ref|YP_926588.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
 gi|119766348|gb|ABL98918.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
          Length = 287

 Score = 41.6 bits (96), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 64/128 (50%), Gaps = 8/128 (6%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQ 59
           +  L + R  + +   P  LD +  ++ AGL +S A+A  V +  D P++ EF +VI   
Sbjct: 131 LNDLRRTRQEQIVKVLPVYLDYLTMAIEAGLNMSAAIAQAVERGPDGPLKIEFEKVIRDM 190

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL---ANLSRILR----DR 112
             G+S +++   M   + + E++   + ++   + G +L   L   A+  R+ R    ++
Sbjct: 191 RAGISRAQAFRNMADRVQISELNSLVSALAQAERTGASLGYTLRIQADQRRVERFQRAEK 250

Query: 113 KNMKAKVQ 120
           K M+A ++
Sbjct: 251 KAMEAPIK 258


>gi|147677788|ref|YP_001212003.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
 gi|146273885|dbj|BAF59634.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
          Length = 307

 Score = 41.6 bits (96), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 76/164 (46%), Gaps = 15/164 (9%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P+ +D++  SV AGL    A+  +  +    +  EF ++++   +G    E
Sbjct: 157 RKKEIEKSLPDVMDLLTVSVEAGLSFDGALMKVTEKKRGVLSEEFTKMLQEIKIGRPRLE 216

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  + R + + ++S F+  + +  QLG +    + N+ R+  D+  MK +  A  M  K
Sbjct: 217 ALRDLSRRLDVDDLSAFAGAVILADQLGIS----IGNILRVQSDQIRMKRRQAAEEMAMK 272

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF 171
           A   ++  +P     +V F  P    VL+    G  ++ ++ AF
Sbjct: 273 APVKML--IP-----MVLFIFPAIFVVLL----GPAVIQISKAF 305


>gi|319795559|ref|YP_004157199.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598022|gb|ADU39088.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 295

 Score = 41.6 bits (96), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 3/122 (2%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGLS 64
           KKR    L   P  LD+I    +AGL ++ A+A  V +     +  EF R++     G+S
Sbjct: 143 KKREKNILRTLPGYLDMITLCCQAGLSLTGAIAQAVQKGPGGALGIEFDRMMREMRTGVS 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             ++++ M   +  + +    + ++    LG +L++ L+ +S   R  +   A  + L+M
Sbjct: 203 RMDALNAMAERLDNKHIKSLVSNLTQAESLGASLADTLSAISDQRRTERFQHA--EKLAM 260

Query: 125 EA 126
           EA
Sbjct: 261 EA 262


>gi|15668960|ref|NP_247764.1| hypothetical protein MJ_0779 [Methanocaldococcus jannaschii DSM
           2661]
 gi|2833584|sp|Q58189|Y779_METJA RecName: Full=Uncharacterized protein MJ0779
 gi|1499599|gb|AAB98769.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
           2661]
          Length = 299

 Score = 41.6 bits (96), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 68/129 (52%), Gaps = 7/129 (5%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVI---ETQHLGLSLSESIS 70
           ++ P AL I++ ++ +G  +++A+  +V  +   V   FR+V+   E Q   LS  ES++
Sbjct: 85  NNIPQALYIMILALESGRSINEALLEVVKSNIKEVSDIFRKVLYLMENQK--LSFEESMT 142

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +      + +   + ++    + GG+LS++L  L++ L D K  K ++ +++    A  
Sbjct: 143 IVSNLYDSKVLRMLARIMIENRKYGGDLSDSLKILAKTLEDFKMYKRQLLSVTASGLAIG 202

Query: 131 WII--GSLP 137
           +II  G +P
Sbjct: 203 FIILCGVIP 211


>gi|83950071|ref|ZP_00958804.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837970|gb|EAP77266.1| type II/IV secretion system protein, TadC subfamily  protein
           [Roseovarius nubinhibens ISM]
          Length = 323

 Score = 41.6 bits (96), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVI---VGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           D FP++LD+++  V AG  +  ++  +   +  S   +  E++ V +    G   +  ++
Sbjct: 172 DGFPDSLDMMLVCVEAGQSMDQSIVRVSEEIRASYPALADEYQLVAQQIKAGRDKASVLN 231

Query: 71  RMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
            M     +Q++S F TV+ VQSQ  G ++ +AL   +  +RD++ M+A+ +A  +  K +
Sbjct: 232 EMGDRCGVQDISSFVTVL-VQSQTFGTSVGDALRVYAAEMRDKRVMRAEEKANKIPTKMT 290

Query: 130 AWIIG 134
              +G
Sbjct: 291 LCTMG 295


>gi|319783869|ref|YP_004143345.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169757|gb|ADV13295.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 320

 Score = 41.6 bits (96), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 70/132 (53%), Gaps = 3/132 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIETQ-HL 61
           +++R  ++ + FP+ +D+++    AG+ +   +  +  +   + P  S+  +++  +   
Sbjct: 167 VRERRREYRNGFPDFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRA 226

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G SL +++  +   + L EV  F+T++    +LG +LS AL   S  +R ++   A+ +A
Sbjct: 227 GRSLDDALKALADRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDDMRHKRMSLAEEKA 286

Query: 122 LSMEAKASAWII 133
            ++ AK S  ++
Sbjct: 287 HALPAKMSVPVV 298


>gi|226309726|ref|YP_002769620.1| hypothetical protein BBR47_01390 [Brevibacillus brevis NBRC 100599]
 gi|226092674|dbj|BAH41116.1| hypothetical membrane protein [Brevibacillus brevis NBRC 100599]
          Length = 298

 Score = 41.6 bits (96), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 66/138 (47%)

Query: 45  SDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALAN 104
           S+ V  E+RR++E     + L   ++R        +V + +T++ +Q ++GG++++ L  
Sbjct: 152 SEIVLEEYRRIVELLRAQVPLEHVMNRFFERTGSADVKYLATIVHIQREMGGDMAKTLDL 211

Query: 105 LSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML 164
            +  +  R+    + +A   +  A   ++  +PF     +Y  +P + + L     G  L
Sbjct: 212 AASSILRRRQSLRRQKAAMAQIVAQVNLLSVMPFVFVIALYVNNPNHFDPLTATIGGRFL 271

Query: 165 LGVAAAFMLIGIMVMRLM 182
           +  + A +LIG   +R +
Sbjct: 272 ILGSLASILIGGEAIRFV 289


>gi|297619917|ref|YP_003708022.1| Type II secretion system F domain-containing protein [Methanococcus
           voltae A3]
 gi|297378894|gb|ADI37049.1| Type II secretion system F domain protein [Methanococcus voltae A3]
          Length = 294

 Score = 41.6 bits (96), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 5/138 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE-TQHLG 62
           L + +  KF  + P AL I+V S+ +G  V +++  I+      V   F ++I       
Sbjct: 73  LYENKIDKFEKNLPKALYIMVLSLNSGRSVIESINEIINSDIKEVNIAFSKIILLMSERK 132

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LS  +S+  +   +  +       +I    + GGNL+E+L  L++ L D  N+K   Q L
Sbjct: 133 LSFEDSVLIVSNSLDSKLFKQLGRLIIENRKYGGNLAESLNTLAKTLEDLTNLKN--QLL 190

Query: 123 SMEAKASAWIIGSLPFCV 140
           S+ +   +  +G +  C+
Sbjct: 191 SVASNGLS--VGIIILCI 206


>gi|126459953|ref|YP_001056231.1| type II secretion system protein [Pyrobaculum calidifontis JCM
           11548]
 gi|126249674|gb|ABO08765.1| type II secretion system protein [Pyrobaculum calidifontis JCM
           11548]
          Length = 256

 Score = 41.6 bits (96), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL-GLSLSESISRMVRY 75
           P  L ++  +V AG+ + +A  V+ G    P  + FRRV+    + GL++ E++ R+   
Sbjct: 42  PQVLRMVADAVGAGMGLREAFEVVAGMGLYPANAVFRRVLSLAEVGGLAVDEALWRVASE 101

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSR 107
           +P      F+ +++  ++ G  L E L   +R
Sbjct: 102 LPSPNFRRFALIVAEGARSGARLGEVLGVAAR 133


>gi|282865305|ref|ZP_06274357.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559778|gb|EFB65328.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 295

 Score = 41.6 bits (96), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I +R        P+ LD++   V AGL    A+  +  + S P   E R  +    
Sbjct: 134 IRSAISRRKDDIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKYSGPWADELRITLRQMD 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+S  E+  ++ +    ++VS F + +    +LG  + + L  ++  +R      A+ +
Sbjct: 194 MGVSRREAFDQLRKRNESEQVSMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARRK 253

Query: 121 ALSMEAKAS 129
           A     KA+
Sbjct: 254 AAKAVPKAT 262


>gi|220913152|ref|YP_002488461.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860030|gb|ACL40372.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 285

 Score = 41.2 bits (95), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 58/122 (47%), Gaps = 1/122 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   KKRTA     +P+ +D +  ++RAGLP+ +A+  +  +  + +R  FR       
Sbjct: 94  LRWRAKKRTALLRQLWPDVVDHLRSAIRAGLPLPEALIQLGDKGPEELRPVFREFGADYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
            G     S+ ++   +           + +  ++GG +L + L  L+  LR+    ++++
Sbjct: 154 AGGQFDGSLDKLKNRLADPVADRIVEALRLTREVGGSDLGKLLGTLAEFLRENARTRSEL 213

Query: 120 QA 121
           +A
Sbjct: 214 EA 215


>gi|168069635|ref|XP_001786522.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162661100|gb|EDQ48667.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 200

 Score = 41.2 bits (95), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 66/153 (43%), Gaps = 8/153 (5%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIV----GQSSDPVRSEFRRVIETQH 60
           + KR      +    L+ IV  V AG  V  A+         Q   P+  E  R+I+   
Sbjct: 47  VDKRDQDITIELAELLNKIVLLVGAGETVQKAITRCARQKEAQRDHPLYKELIRMIDDLE 106

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
            G S  +S     +   +QEVS F+T + +  + GG + + AL +LSR L +++    + 
Sbjct: 107 GGYSFQQSFENFSKRCAVQEVSAFTTAVLLNLRRGGSDFAMALNDLSRGLWEKRKAITRT 166

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYM 152
           +    E  +S  +   +   +  +V   +P +M
Sbjct: 167 RG---EQASSKLVFPMMVIFMIVIVLVGTPAFM 196


>gi|157375501|ref|YP_001474101.1| putative putative tight adherence TadC-like transmembrane protein
           [Shewanella sediminis HAW-EB3]
 gi|157317875|gb|ABV36973.1| conserved hypothetical putative tight adherence TadC-related
           transmembrane protein [Shewanella sediminis HAW-EB3]
          Length = 321

 Score = 41.2 bits (95), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           ++ +  +R       FP+ALD++V    AGL +  A   VA  +  S   + SE   V  
Sbjct: 159 LQKIASRRMRMLRTGFPDALDLLVVCCEAGLGLMAAMQRVARELALSHPTLASELDLVCS 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL++  +++       L+++   ++ IS   +LG  ++E L   S   R+++  +A
Sbjct: 219 KVRAGLTVKVALNEFTDRTGLEDIKGLNSAISQSIRLGTGIAETLRVFSDEYRNKRLQEA 278

Query: 118 KVQALSMEAK 127
           + QA  +  K
Sbjct: 279 EEQAAKLAVK 288


>gi|15895374|ref|NP_348723.1| general secretion pathway protein F [Clostridium acetobutylicum
           ATCC 824]
 gi|15025093|gb|AAK80063.1|AE007711_20 General secretion pathway protein F [Clostridium acetobutylicum
           ATCC 824]
 gi|325509519|gb|ADZ21155.1| General secretion pathway protein F [Clostridium acetobutylicum EA
           2018]
          Length = 396

 Score = 41.2 bits (95), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 29  AGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVI 88
           AG  + ++++++     D  +   RR+I+    G+    SI + V+Y       FF +++
Sbjct: 74  AGFNICESLSIMY----DKFQGNMRRIIKCIEKGIENGNSIYKSVQYCGDSIPYFFKSML 129

Query: 89  SVQSQLGGNLSEALANLSRILRDRKNMKAKVQ-ALSMEAKASAWIIGSLPFCVSTLV 144
            +  +  GNLSE   NL    +D+   + K++ A +  A   A+ I  L F VS ++
Sbjct: 130 FIGEE-SGNLSEVFRNLGEYYKDQWKTEEKIKNATTYPAIVFAFTIIILVFLVSKVI 185


>gi|238790284|ref|ZP_04634058.1| Flp pilus assembly protein TadC [Yersinia frederiksenii ATCC 33641]
 gi|238721634|gb|EEQ13300.1| Flp pilus assembly protein TadC [Yersinia frederiksenii ATCC 33641]
          Length = 282

 Score = 41.2 bits (95), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 73/157 (46%), Gaps = 6/157 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVI---VGQSSDPVRSEFRRVIET 58
           K+++  R  K   D P  +D++   V++GL +  ++  +   VG  +D       R+++ 
Sbjct: 126 KYIVNARIEKIERDMPLFVDLLAICVQSGLTIESSLKFLAENVGDINDNFVPFLDRLVKK 185

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
             +   L   ++ + + +P +EVS     +    + G ++ E L  LS  +R+ + +K +
Sbjct: 186 IEVN-GLEAGLTHLQKELPSREVSMLCVTLQQSLRYGSSIYEYLMELSSEMRELQLLKTE 244

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
                + AK S  ++  L F    ++   +PG M V+
Sbjct: 245 EIIGKLSAKMSIPLV--LFFMFPVVIIIAAPGIMRVM 279


>gi|317133736|ref|YP_004089647.1| Type II secretion system F domain [Ruminococcus albus 7]
 gi|315450198|gb|ADU23761.1| Type II secretion system F domain [Ruminococcus albus 7]
          Length = 286

 Score = 41.2 bits (95), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 64/130 (49%), Gaps = 7/130 (5%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLS 64
           +K+ A+F  + P  LD+   +++  LPV+ A+  I  +S D + S E  R +    LG S
Sbjct: 135 QKKKAQFESEIPRFLDLFQTAIKINLPVATAIK-ITAESIDGILSEELLRALVVTELGTS 193

Query: 65  -LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              +S+  + +   +   S F   I    Q G +++E++   SR ++    + AK QA  
Sbjct: 194 NWQDSLYDIAQKYEVDSFSDFVLDIVTAFQKGSDITESVERQSRSIKSSTLLSAKEQA-- 251

Query: 124 MEAKASAWII 133
             AK ++ I+
Sbjct: 252 --AKTTSLIL 259


>gi|77462448|ref|YP_351952.1| putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
 gi|77386866|gb|ABA78051.1| Putative Flp pilus assembly protein TadC [Rhodobacter sphaeroides
           2.4.1]
          Length = 326

 Score = 41.2 bits (95), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +K   ++R  + +  FP+ALD+++  V AG  +  ++  +  +S+     +  EF  V  
Sbjct: 165 IKRRAQERYDQIVSGFPDALDMMLVCVEAGQSLDQSILRVARESAAGYPALAEEFEIVAH 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M   + + +VS F T +   +  G +++EAL   S  +RD++ M+A
Sbjct: 225 EVKAGKERVAVLKDMSERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRVMRA 284

Query: 118 KVQALSMEAK 127
           + +A ++  K
Sbjct: 285 EEKANTLPTK 294


>gi|319943385|ref|ZP_08017667.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
 gi|319743200|gb|EFV95605.1| type II secretion system protein [Lautropia mirabilis ATCC 51599]
          Length = 298

 Score = 41.2 bits (95), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 1/128 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQ 59
           ++ L  +RT +     P  LDII  ++ AG  ++ A+   V +  + P+  E RRV+   
Sbjct: 140 LRDLGARRTRQIAKALPFYLDIITLAIEAGSNMTGALQHAVDKGPTGPMSEELRRVLRDI 199

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G + +ES+  +   + +  +S +   I    + G +L   L   +   R+ + M+A+ 
Sbjct: 200 RAGRTRAESLRALAERLRIPAISNWVAAILTAEKQGSSLGPILRAQADQRRNERFMQAEA 259

Query: 120 QALSMEAK 127
            AL    K
Sbjct: 260 MALKAPVK 267


>gi|84501671|ref|ZP_00999843.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390292|gb|EAQ02851.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 330

 Score = 41.2 bits (95), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 65/133 (48%), Gaps = 7/133 (5%)

Query: 2   KHLIKKRTAKFLDD----FPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRR 54
           K+ I KR A+  ++    FP+ALD+++  V AG  +  A+  +  +   S   +  EF  
Sbjct: 156 KYWINKRQAQRQEEITNGFPDALDMLLVCVEAGQSMDQAILRVAKEIRVSYPSLADEFEL 215

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V      G   +  +  M     + +++ F TV+   +  G ++++AL   +  +RD++ 
Sbjct: 216 VSHEIKAGKDKASVLGDMAERCGVPDIASFVTVLIQSASFGTSVADALRVYASEMRDKRV 275

Query: 115 MKAKVQALSMEAK 127
           M+A+ +A  +  K
Sbjct: 276 MRAEEKANKLPTK 288


>gi|317472142|ref|ZP_07931474.1| hypothetical protein HMPREF1011_01824 [Anaerostipes sp. 3_2_56FAA]
 gi|316900546|gb|EFV22528.1| hypothetical protein HMPREF1011_01824 [Anaerostipes sp. 3_2_56FAA]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 81/165 (49%), Gaps = 23/165 (13%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS---EFRRVIETQ----HLGLSLSE 67
           +F   L  +  S+ AG  + +AV      + D +R+   + + V+E +      GL +++
Sbjct: 80  EFKEMLLSVYNSLSAGYSLENAVRA----ARDDMRAVNGDKKSVLEQELSLVCAGLEVNQ 135

Query: 68  SISRMVRYMPLQ----EVSFFSTVISVQSQLGGNL----SEALANLSRILRDRKNMKAKV 119
            I  ++  M L+    E S F+ V+ +  + GGNL     +++ ++++ ++ ++ +   V
Sbjct: 136 PIEVLMDKMALRLGVDEASQFAQVLWIIKRNGGNLIQIIKKSVEHMNQKIQVKEEILTMV 195

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML 164
            A  ME K    I+  +PF +   V   +PGY  VL + P G +L
Sbjct: 196 SAKRMEQK----IMSVMPFFILLYVRLMNPGYFQVLYDSPGGVIL 236


>gi|167748318|ref|ZP_02420445.1| hypothetical protein ANACAC_03062 [Anaerostipes caccae DSM 14662]
 gi|167652310|gb|EDR96439.1| hypothetical protein ANACAC_03062 [Anaerostipes caccae DSM 14662]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 81/165 (49%), Gaps = 23/165 (13%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS---EFRRVIETQ----HLGLSLSE 67
           +F   L  +  S+ AG  + +AV      + D +R+   + + V+E +      GL +++
Sbjct: 80  EFKEMLLSVYNSLSAGYSLENAVRA----ARDDMRAVNGDKKSVLEQELSLVCAGLEVNQ 135

Query: 68  SISRMVRYMPLQ----EVSFFSTVISVQSQLGGNL----SEALANLSRILRDRKNMKAKV 119
            I  ++  M L+    E S F+ V+ +  + GGNL     +++ ++++ ++ ++ +   V
Sbjct: 136 PIEVLMDKMALRLGVDEASQFAQVLWIIKRNGGNLIQIIKKSVEHMNQKIQVKEEILTMV 195

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML 164
            A  ME K    I+  +PF +   V   +PGY  VL + P G +L
Sbjct: 196 SAKRMEQK----IMSVMPFFILLYVRLMNPGYFQVLYDSPGGVIL 236


>gi|296156494|ref|ZP_06839332.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893093|gb|EFG72873.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 318

 Score = 41.2 bits (95), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 72/160 (45%), Gaps = 14/160 (8%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           M  L++ R  K  +D P+ALD++   V AGL +  A   V   +G  S  ++ EF  V+ 
Sbjct: 150 MTRLVESRQRKLFEDLPDALDLMTVCVEAGLGLDAAMMRVTQEIGVKSHALKDEFDMVLL 209

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    +++  +     ++++   + ++    + G ++ ++L   +  LR ++ ++A
Sbjct: 210 ELRAGSGRDKALRNLSLRTGVEDIDTLAAMLIQADRFGTSVGDSLRVYTDNLRTKRRLRA 269

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +  A  +  K            +  L++F  P  + VL+ 
Sbjct: 270 EELAAEIALK-----------LLFPLMFFIFPTLLAVLVG 298


>gi|295395216|ref|ZP_06805424.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971978|gb|EFG47845.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 312

 Score = 41.2 bits (95), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 52/116 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   +KKR  + L +FP   +++  S+ AG    DA+  +   ++  +  E R  +    
Sbjct: 157 LTQAVKKREERILAEFPTIAELLALSITAGEGTVDALNRVCHTATGELSDELRIALAQAR 216

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
            G SL +++  M R   +Q +  F   +++    G  LSE L   +  +R+    K
Sbjct: 217 TGTSLVDALDAMARRTNIQSLIQFVDGLAIALSRGTPLSEVLRAQAADVREEGRRK 272


>gi|299067812|emb|CBJ39023.1| Tad secretion system, secretion accessory protein [Ralstonia
           solanacearum CMR15]
          Length = 315

 Score = 41.2 bits (95), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRS-EFRRVIETQHL 61
           IK R  +  + FP++LD+I+  V AGL +  A+  +V +  ++ PV + E+  +      
Sbjct: 155 IKYRQREIFESFPDSLDLIMVCVEAGLSLDAAILRVVDEMRTARPVMAEEYELLTLELRA 214

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL   +++  +     + +VS    ++    + G +++++L   S +LR +++M A+ +A
Sbjct: 215 GLPREKALRNLAARTGVDDVSMLVAMLIQADRFGTSVADSLRVHSDMLRTKRHMLAEERA 274

Query: 122 LSMEAKASAWIIGSLPFCVSTLVY 145
               AK    ++  L FC+   +Y
Sbjct: 275 ----AKIGTKVLFPLIFCIFPSLY 294


>gi|78357408|ref|YP_388857.1| hypothetical protein Dde_2365 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219813|gb|ABB39162.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 324

 Score = 41.2 bits (95), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 6   KKRTAKFL--DDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQH 60
           K RT + L  D  P+ALD++V  V AG+ +  A+  +  +   SS  +  E   ++    
Sbjct: 165 KVRTRRRLMEDSLPDALDLLVVCVEAGMGLDQAIGRVARELSLSSPVLGEELSMLVSELR 224

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G + SES+  +   + L++V+   T+I      G +++  L   S  +R  +  +A+  
Sbjct: 225 AGKTRSESLKNLAHRVGLEDVNSLVTLIIQADAFGTSIAHTLRVYSDTMRTTRFQRAEEI 284

Query: 121 ALSMEAKASAWIIGSLPFCV 140
           A  M  K    ++  L FC+
Sbjct: 285 AAKMPVK----LLFPLVFCI 300


>gi|117928945|ref|YP_873496.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
 gi|117649408|gb|ABK53510.1| type II secretion system protein [Acidothermus cellulolyticus 11B]
          Length = 286

 Score = 40.8 bits (94), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
           +P+ +D +  +VRAGL + +AVA +  +  D +R  FRR  +   +  + + S+  + R 
Sbjct: 110 WPDVVDNLASAVRAGLALPEAVAQLADRGPDELRPTFRRFADDYRVSGNFAASLDELKRR 169

Query: 76  MPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKVQ 120
           +           + +  ++GG +L   L  LS  LR+   ++A+++
Sbjct: 170 LADPTADRIIESLRMAREVGGTDLGRLLRTLSVFLREDLRIRAELE 215


>gi|308176986|ref|YP_003916392.1| type II secretion system protein F [Arthrobacter arilaitensis
           Re117]
 gi|307744449|emb|CBT75421.1| putative type II secretion system protein F [Arthrobacter
           arilaitensis Re117]
          Length = 313

 Score = 40.8 bits (94), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 69/150 (46%), Gaps = 10/150 (6%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I +R  K L  FP   +++  +V AG   + A+  I       +  EF + +   H G  
Sbjct: 162 INRRARKILTQFPTVAEVLALTVGAGESTTGAIERISRICHGVIGDEFTKTLNDIHAGTP 221

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRD---RKNMK-AKVQ 120
           + +++  M   M +  ++ F   I V ++ G  L++ L + ++ +RD   R+ M+ A  +
Sbjct: 222 MVQAMQHMSDRMQVGAMTRFVDAIVVATERGTPLAQVLRDQAQDVRDASKRELMEVAGKR 281

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPG 150
            +SM       + G LP    T+V+   PG
Sbjct: 282 EISMLVPV---VFGILPL---TIVFAVFPG 305


>gi|163745841|ref|ZP_02153200.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161380586|gb|EDQ04996.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 326

 Score = 40.8 bits (94), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 64/137 (46%), Gaps = 5/137 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ----SSDPVRSEFRRVIE 57
           +  +  R  +    FP+ALD+++  V AG  + D   V VG+    S   +  EF  V  
Sbjct: 165 RRRVDSRKEEITRGFPDALDMMLVCVEAGQSL-DQCIVRVGRELRASYPALAEEFEMVAY 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      ++ M     +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 224 EMKAGKDRITVLNDMSERCGVQDVSSFVTVLIQSAAFGTSIADALRVYAEEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIG 134
           +  A  +  K +   +G
Sbjct: 284 EEAANKLPTKMTLATMG 300


>gi|323702118|ref|ZP_08113786.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
 gi|323533000|gb|EGB22871.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
          Length = 310

 Score = 40.8 bits (94), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I++R  +     P+ALD++  SV AGL    A+  +  QS+  +  EF  +++  H+G  
Sbjct: 157 IRQRKNQVEKALPDALDLLTVSVEAGLGFDCALMKVAEQSNSVLADEFVLMMQECHMGKP 216

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLG---GNL 98
             E++  M   + + ++S F   I +   LG   GN+
Sbjct: 217 RREALRDMADRVDVDDLSTFCGSIILADTLGISIGNI 253


>gi|107028240|ref|YP_625335.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116687151|ref|YP_840398.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|105897404|gb|ABF80362.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116652866|gb|ABK13505.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 324

 Score = 40.8 bits (94), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 16/163 (9%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIETQH 60
           +K R  K  +DFP+ALD++   V AGL + DA  + V +     S+ V SE   ++    
Sbjct: 161 VKVRQRKIFEDFPDALDLLTVCVEAGLGL-DAALMKVSEELRFRSEVVASELDLLLLEMR 219

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +   ++  +     ++++  F  ++    + G ++SE+L    R+L D    + +++
Sbjct: 220 SGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESL----RVLSDMLRTRRRMR 275

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           A    AK +  ++  L FC+        P  M VL+     H+
Sbjct: 276 AEERAAKIALKLLFPLIFCI-------FPALMMVLLGPAMIHV 311


>gi|72162675|ref|YP_290332.1| integral membrane protein [Thermobifida fusca YX]
 gi|71916407|gb|AAZ56309.1| putative integral membrane protein [Thermobifida fusca YX]
          Length = 273

 Score = 40.8 bits (94), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 2/120 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR  +     P+ LD++  +V AGL    A+A +       + SEF+  +    LG S 
Sbjct: 118 RKRQEEIQKQLPDFLDVLAVTVSAGLSFRQALARVADAMPGVLASEFQLALRQMELGTSR 177

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR--DRKNMKAKVQALS 123
            ++ + +      + +  F T +    +LG  LS+ L  LS  +R  D + ++ K Q L+
Sbjct: 178 RDAFAALRERNSNEALGRFITALQQAEELGAPLSQTLHALSTDMRREDAQFLRRKAQHLN 237


>gi|289192868|ref|YP_003458809.1| Type II secretion system F domain protein [Methanocaldococcus sp.
           FS406-22]
 gi|288939318|gb|ADC70073.1| Type II secretion system F domain protein [Methanocaldococcus sp.
           FS406-22]
          Length = 299

 Score = 40.8 bits (94), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVI---ETQHLGLSLSESIS 70
           ++ P AL I++ ++ +G  +++A+  +V  +   V   FR+V+   E Q   LS  ES++
Sbjct: 85  NNIPQALYIMILALESGRSINEALLEVVKSNIKEVSDIFRKVLYLMENQK--LSFEESMT 142

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +      + +   + ++    + GG+L+++L  L++ L D K  K ++ +++    AS 
Sbjct: 143 IVSNLYDSKVLRMLARIMIENRKYGGDLADSLKILAKTLEDFKMYKKQLLSVT----ASG 198

Query: 131 WIIGSLPFC 139
             IG +  C
Sbjct: 199 LAIGFIILC 207


>gi|170734860|ref|YP_001773974.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169820898|gb|ACA95479.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 324

 Score = 40.8 bits (94), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 16/163 (9%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIETQH 60
           +K R  K  +DFP+ALD++   V AGL + DA  + V +     S+ V SE   ++    
Sbjct: 161 VKVRQRKIFEDFPDALDLLTVCVEAGLGL-DAALMKVSEELRFRSEVVASELDLLLLEMR 219

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +   ++  +     ++++  F  ++    + G ++SE+L    R+L D    + +++
Sbjct: 220 SGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESL----RVLSDMLRTRRRMR 275

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           A    AK +  ++  L FC+        P  M VL+     H+
Sbjct: 276 AEERAAKIALKLLFPLIFCI-------FPALMMVLLGPAMIHV 311


>gi|297571776|ref|YP_003697550.1| type II secretion system protein F [Arcanobacterium haemolyticum
           DSM 20595]
 gi|296932123|gb|ADH92931.1| Type II secretion system F domain protein [Arcanobacterium
           haemolyticum DSM 20595]
          Length = 291

 Score = 40.8 bits (94), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 7   KRTAKFLD-DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           + T++ L    P+ +++I  +V AG PV  A+   V   S P+    R  +   H G SL
Sbjct: 142 RATSRILTAQLPDVIELIALAVSAGEPVRPAIERAVRSGSGPLIEHLRTTLAHVHAGKSL 201

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALAN 104
             ++S +      Q VS F+  +    + GG L++ L N
Sbjct: 202 PAALSDLSVRAGNQNVSRFTDSLITAMEQGGGLAQTLHN 240


>gi|254463054|ref|ZP_05076470.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2083]
 gi|206679643|gb|EDZ44130.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 323

 Score = 40.8 bits (94), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 63/128 (49%), Gaps = 3/128 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHL 61
           I  R  +    FP++LD+++  V AG  +  ++  +  +   S P +  E+  V +    
Sbjct: 167 IDTRKEQIESGFPDSLDMMLVCVEAGQSLDQSIVRVAAELHHSYPFLADEYEIVAQEMKA 226

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G      ++ M     +Q+V+ F TV+   +  G +++EAL   +  +RD++ M+A+ +A
Sbjct: 227 GKDKIAVLNDMSERCGVQDVASFVTVLIQSTSFGTSIAEALRVYAGEMRDKRVMRAEEKA 286

Query: 122 LSMEAKAS 129
             +  K +
Sbjct: 287 NKLPTKMT 294


>gi|163733537|ref|ZP_02140980.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
 gi|161393325|gb|EDQ17651.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
          Length = 327

 Score = 40.8 bits (94), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 3/128 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIETQHL 61
           +  R  +    FP++LD+++  V AG  +   +  +  +   S   +  EF  V      
Sbjct: 167 VDTRKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAYEMKA 226

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  ++       +Q+VS F TV++   Q G +++EAL   +  +RD++ M+A+  A
Sbjct: 227 GKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAGEMRDKRVMRAEEAA 286

Query: 122 LSMEAKAS 129
             +  K +
Sbjct: 287 NKLPTKMT 294


>gi|197118215|ref|YP_002138642.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197087575|gb|ACH38846.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 304

 Score = 40.8 bits (94), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 71/153 (46%), Gaps = 15/153 (9%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAV---AVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++TA F    P+ LD++   V AGL +  A+   A    + + P+ +EF  VI     G 
Sbjct: 151 RKTAIF-HALPDVLDLLTVCVEAGLGLDAAIIKTAENFQEKNCPLIAEFNAVILEIRAGR 209

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
             SE++  +     L ++    +++    +LG +L + L   S  LR ++   A+ +A  
Sbjct: 210 PRSEALKGLAERTTLDDIKALVSMLIQTEKLGTSLGKTLRIYSDSLRTKRKQLAEERA-- 267

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLI 156
             AK +  ++  L FCV        P +M VL+
Sbjct: 268 --AKTAVKMLFPLTFCV-------FPAFMVVLL 291


>gi|15602712|ref|NP_245784.1| hypothetical protein PM0847 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721156|gb|AAK02931.1| TadC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 284

 Score = 40.4 bits (93), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 74/157 (47%), Gaps = 6/157 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIETQH 60
           ++K +  K + D P  +D++  +V+ G+ +  A   VA+   + +  +     R+I    
Sbjct: 129 ILKAKVKKIMVDLPGFIDLVAVNVQTGISIDAALKQVAIDFKKLNPDLTYVMLRIIRKSE 188

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L   LS+++  +   +P  E+  F TV+      G ++   L  LS  +R+ + +  + +
Sbjct: 189 LT-GLSQALQDLSISLPTTEIRMFCTVLQQSLNFGSSIYSHLIQLSADIREIQLLIIEEK 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
             ++ AK S  +I  + F +  L+   +PG M V  N
Sbjct: 248 LGTLSAKMSIPLILFIMFPIIILIL--APGIMRVFPN 282


>gi|42522078|ref|NP_967458.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
 gi|39574609|emb|CAE78451.1| Flp pilus assembly protein TadC [Bdellovibrio bacteriovorus HD100]
          Length = 258

 Score = 40.4 bits (93), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 6/122 (4%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS--SDPV-RSEFRRVIETQHLG 62
           K+R      D P  +D++  SV AGL    A+  IV ++  +D V   EF  V++   +G
Sbjct: 104 KRRELSVRADLPFFIDLLALSVEAGLDFFSAIQKIVDKANGTDSVLAEEFSIVLKDIKIG 163

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLS---RILRDRKNMKAKV 119
            S ++++  M   + + E++ F  V+      G ++S+ L + S   R+ R  +  KA  
Sbjct: 164 SSKAQALKEMAERLDMNEITSFVAVLVDAESTGASISQVLKDQSVQMRLERFVRAEKAGA 223

Query: 120 QA 121
           QA
Sbjct: 224 QA 225


>gi|260431089|ref|ZP_05785060.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414917|gb|EEX08176.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 327

 Score = 40.4 bits (93), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 75/153 (49%), Gaps = 4/153 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHL 61
           +++R       FP+ LD+++  V AG  +  A+  +  +  SS P +  EF  V      
Sbjct: 169 VEERKEAITAGFPDTLDLMLVCVEAGQSLDQAIVRVASEMKSSYPDIAQEFEIVAYEMKA 228

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   ++ +        +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A+  A
Sbjct: 229 GKDKNQVLRDFGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRAEEAA 288

Query: 122 LSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMN 153
             +  K + A ++ ++P  +  LV  ++ G M 
Sbjct: 289 NKLPTKMTLATMMLTVPPLLIILVGPSAKGIME 321


>gi|298345275|ref|YP_003717962.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
 gi|298235336|gb|ADI66468.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
          Length = 295

 Score = 40.4 bits (93), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 4/168 (2%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
           +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + R 
Sbjct: 118 WPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILKRE 177

Query: 76  MPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
           +           + + +Q+GGN L   L +L  +LR  +  + +V A        A +  
Sbjct: 178 LADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARLAA 237

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF-MLIGIMVMRL 181
           + P+ +  L+  + PG + V  + P G M+L V A    L  +M++RL
Sbjct: 238 ASPWIILALL-LSRPGTLEV-YSTPVGSMILLVGALVSALAYLMMLRL 283


>gi|303244717|ref|ZP_07331048.1| Type II secretion system F domain protein [Methanothermococcus
           okinawensis IH1]
 gi|302484931|gb|EFL47864.1| Type II secretion system F domain protein [Methanothermococcus
           okinawensis IH1]
          Length = 295

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 8/153 (5%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE-TQHLGLS 64
           + +  KF  + P AL +++ S+ +G  V DA+  ++      V   F +++       LS
Sbjct: 77  ESKIEKFERNLPKALYVMILSLESGRSVIDAINEVINSGIKEVDVIFLKIVALMTEKKLS 136

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             +SI  +   +  +       +I    + GG L+E L  L++ L D +N+K ++ +++ 
Sbjct: 137 FEDSIILVSNSIDSKIFRQIGRLIIENRKHGGELAEVLKTLAKTLEDLQNLKNQLLSVTA 196

Query: 125 EAKASAWII--GSLPFCVSTLVYFTSPGYMNVL 155
              A   II  G +P     +      GY+N +
Sbjct: 197 NGLAVGLIIICGVIPATAGII-----GGYLNAI 224


>gi|115376389|ref|ZP_01463626.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
 gi|115366596|gb|EAU65594.1| Flp pilus assembly protein TadC [Stigmatella aurantiaca DW4/3-1]
          Length = 238

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGL 63
           +K+R        P  LD++  SV AGL  + A++ +V +  S P++ E   V++   +G 
Sbjct: 83  VKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVEKGKSGPLKEEMSIVLKQLKMGK 142

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
           +  E++  M+  + L  ++ F T +    ++G +L + L   S  +R  +  +A+
Sbjct: 143 TREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRIQSTQMRIDRTQRAE 197


>gi|315655695|ref|ZP_07908593.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
 gi|315489759|gb|EFU79386.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
          Length = 295

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 4/168 (2%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
           +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + R 
Sbjct: 118 WPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILKRE 177

Query: 76  MPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
           +           + + +Q+GGN L   L +L  +LR  +  + +V A        A +  
Sbjct: 178 LADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARLAA 237

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAF-MLIGIMVMRL 181
           + P+ +  L+  + PG + V  + P G M+L V A    L  +M++RL
Sbjct: 238 ASPWIILALL-LSRPGTLEV-YSTPVGSMILLVGALVSALAYLMMLRL 283


>gi|330819179|ref|YP_004348041.1| type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327371174|gb|AEA62529.1| type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 293

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSLSESISRMVRY 75
           P  LD +  +V AGL ++ A+   V +  D  +RSEF  V+     GL+ ++++ R    
Sbjct: 151 PVYLDFLTLAVEAGLNINGAIQKAVEKGPDGALRSEFEHVLRDLKSGLNRADALRRFDER 210

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
             ++E++ F   +    ++G  L+  L   S   R  +  +A  + L+MEA
Sbjct: 211 QDIKEITNFVGAVIQAERMGSGLAGTLRFQSEQRRAERFQRA--EKLAMEA 259


>gi|163840097|ref|YP_001624502.1| tyrosine phenol-lyase [Renibacterium salmoninarum ATCC 33209]
 gi|162953573|gb|ABY23088.1| tyrosine phenol-lyase [Renibacterium salmoninarum ATCC 33209]
          Length = 161

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%)

Query: 5  IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
          I +R A+ L +FP+  +++  +VRAG   + A+  +   S   +  EF R++     G+ 
Sbjct: 3  ITRREARMLAEFPSLAELMALAVRAGESATGALERVCRTSQGDLAQEFARILGQTRSGVP 62

Query: 65 LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLS 99
          L+E+++   R   +  +  F+  ++V  + G  L+
Sbjct: 63 LTEALAAFSRRTKIAPLVRFTDGLTVAVERGTPLA 97


>gi|239943899|ref|ZP_04695836.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           15998]
 gi|239990353|ref|ZP_04711017.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           11379]
 gi|291447362|ref|ZP_06586752.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291350309|gb|EFE77213.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 295

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  +  +   P   E R  +    +G+S  ++   + R 
Sbjct: 149 LPDFLDVLAVVVSAGLGFRQALDRVAEKYEGPWSDELRITLRQMDMGVSRRQAFEELRRR 208

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
              ++V+ F T +    +LG  + E L  ++  +R      A+ +A     KA+
Sbjct: 209 NDSEQVAMFVTTLQQGEELGAPIVETLIQIANDMRRTDAQNARRKAAKAVPKAT 262


>gi|302536567|ref|ZP_07288909.1| integral membrane protein [Streptomyces sp. C]
 gi|302445462|gb|EFL17278.1| integral membrane protein [Streptomyces sp. C]
          Length = 292

 Score = 40.0 bits (92), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 2/101 (1%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P+ LD++   V AGL    A+  + G+   P   E R  ++   +G+S  ++   + R 
Sbjct: 145 LPDFLDVLAVVVSAGLGFRQALERVAGKYEGPWADEIRITLQQMDMGVSRRQAFDELRRR 204

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILR--DRKN 114
              ++V+ F T +    +LG  + E L  ++  +R  D +N
Sbjct: 205 NDSEQVAQFVTALQQGEELGSPIVETLIAIAEDMRRTDAQN 245


>gi|84516638|ref|ZP_01003997.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
 gi|84509674|gb|EAQ06132.1| type II/IV secretion system protein, TadC subfamily [Loktanella
           vestfoldensis SKA53]
          Length = 316

 Score = 40.0 bits (92), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHL 61
           ++ R    ++ FP++LD+++  V AG  +  ++  +  +  +  P +  EF  V +    
Sbjct: 161 VEVRKEAIINAFPDSLDLMLVCVEAGQSLDQSILRVSNELRTGFPELAEEFEIVSQEAKA 220

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  +  M     + ++S F TV+   +Q G ++S+AL   +  +RD++ M+A+  A
Sbjct: 221 GKDKTTVLKDMAERCGVPDISSFVTVMVQSAQFGTSISDALRVYASEMRDKRVMRAEEAA 280

Query: 122 LSMEAK 127
             +  K
Sbjct: 281 NKLPTK 286


>gi|310822671|ref|YP_003955029.1| type II secretion system protein f domain-containing protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395743|gb|ADO73202.1| Type II secretion system protein F domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 296

 Score = 40.0 bits (92), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGL 63
           +K+R        P  LD++  SV AGL  + A++ +V +  S P++ E   V++   +G 
Sbjct: 141 VKRRHLAISRALPYNLDLLTLSVEAGLDFTAALSKVVEKGKSGPLKEEMSIVLKQLKMGK 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
           +  E++  M+  + L  ++ F T +    ++G +L + L   S  +R  +  +A+
Sbjct: 201 TREEALKAMILRVDLPSLTTFVTALIQADKMGTSLGKVLRIQSTQMRIDRTQRAE 255


>gi|57641787|ref|YP_184265.1| hypothetical protein TK1852 [Thermococcus kodakarensis KOD1]
 gi|57160111|dbj|BAD86041.1| hypothetical membrane protein, conserved [Thermococcus kodakarensis
           KOD1]
          Length = 351

 Score = 40.0 bits (92), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K + K+R  +     P AL  I   + AG+ +++A+  +      P+  EF  VI     
Sbjct: 165 KMVWKRRVREVEKALPYALRHIASLLSAGVGIAEAMLSVAKADYGPLSEEFELVIRDMRT 224

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLS 106
           G S  E++ +    M  + VS     I    + GGNL+E L  L+
Sbjct: 225 GSSFEEAMLKFEEKMASENVSRVVKQILRAVKFGGNLAEILYKLA 269


>gi|299532601|ref|ZP_07045990.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719404|gb|EFI60372.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 303

 Score = 40.0 bits (92), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/134 (19%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R  +  ++FP+A D+++  V AG+ +  A    +G+ ++ +R +   + E  H
Sbjct: 137 LRWMALRRKREIFENFPDAADLMLVCVEAGMGLDAA----LGKVTEEIRIKSEALAEELH 192

Query: 61  L-------GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
                   G +  +++  +     + E+  F+ +++   + G ++ E+L   S  LR ++
Sbjct: 193 WTNLEMRAGSTREKALRNLAARTGVDEIHTFTAMLTQADRFGTSIGESLRVFSDDLRHKR 252

Query: 114 NMKAKVQALSMEAK 127
            M+A+  A  +  K
Sbjct: 253 QMRAEELAAKIPTK 266


>gi|299538323|ref|ZP_07051606.1| type II secretion system protein [Lysinibacillus fusiformis ZC1]
 gi|298725910|gb|EFI66502.1| type II secretion system protein [Lysinibacillus fusiformis ZC1]
          Length = 401

 Score = 40.0 bits (92), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 27  VRAGLPVSDAVAVIVGQS-SDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFS 85
           +RAG+PV +A  ++  Q+ S P++    +V E    G++ S++  +  +  PL  V+   
Sbjct: 75  IRAGVPVVEATHILGEQTRSKPLKRALMQVEEDIRNGMAFSDAAGKHPKVFPLLFVNMMR 134

Query: 86  TVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVST-LV 144
                  +  GN+ + L  L+  L  + N+K K+Q+    A     I+  L   V   L+
Sbjct: 135 A-----GEATGNVDDTLDRLASTLEKQYNIKKKIQS----AMTYPAILSLLTLVVGMFLM 185

Query: 145 YFTSPGYMN 153
            F  P +M+
Sbjct: 186 VFIVPTFMD 194


>gi|225026645|ref|ZP_03715837.1| hypothetical protein EUBHAL_00896 [Eubacterium hallii DSM 3353]
 gi|224956015|gb|EEG37224.1| hypothetical protein EUBHAL_00896 [Eubacterium hallii DSM 3353]
          Length = 191

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQ-------SSDPVRSEFRRVIETQHLGLSLSES 68
           F N L  ++ S++AG  ++++  + + +        ++P+  + RR+I+   L ++L + 
Sbjct: 49  FQNLLQSMMTSLQAGYSLNNSCRIALKELEELYQDQNNPMLRQMRRIIQGLDLHIALEQL 108

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
                    L+E   F+ VI +    GGN+ E L    + L+ + + + +++ L
Sbjct: 109 FMEFAESTGLEEAKQFAVVIEIVRSTGGNMVEILKRTMQHLKYKMDTEEEIRVL 162


>gi|126737249|ref|ZP_01752984.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721834|gb|EBA18537.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 82/155 (52%), Gaps = 6/155 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDP-VRSEFRRVIETQHL 61
           +++R  K    FP++LD+++  V AG  +  ++  +  +  +S P +  EF  V +    
Sbjct: 164 VEERRQKIEQGFPDSLDMMLVCVEAGQSLDQSIVRVATELRASFPDLAYEFEIVAQEMKA 223

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQ 120
           G    + +  M     +Q++S F TV+ +QSQ  G ++++AL   +  +RD++ M+A+  
Sbjct: 224 GKDKEKVLRDMGTRCGVQDISSFVTVM-IQSQSFGTSIADALRVYAGEMRDKRVMRAEEA 282

Query: 121 ALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
           A  +  K + A ++ ++P  +  LV  +  G +N+
Sbjct: 283 ANKLPVKMTLATMMLTVPPLLIILVGPSVQGILNM 317


>gi|160893700|ref|ZP_02074484.1| hypothetical protein CLOL250_01254 [Clostridium sp. L2-50]
 gi|156864685|gb|EDO58116.1| hypothetical protein CLOL250_01254 [Clostridium sp. L2-50]
          Length = 301

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 84/193 (43%), Gaps = 14/193 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRRVIET 58
           I+KR  +   +F + +  +  S+ AG    +A      +       S  +  E + VI  
Sbjct: 113 IEKRQRQLYVEFKDMVQSLAASMGAGYAFENAFTAAYEEMRKLYGDSGLIVKELKWVIR- 171

Query: 59  QHLGLSLSESISRMVRYMP----LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
              GL + E I  +++ M     ++E+S F+ V+ V  + GGN+   +   +  +  +  
Sbjct: 172 ---GLRMHEDIEYLLQDMGERSGVREISEFAQVVGVAKRTGGNMVHIMKATAADISRKME 228

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           ++ ++Q +    K    I+  +PF +   +   +  Y+++L  +  G +++ +  A  ++
Sbjct: 229 VELEIQTMIAAKKYEQKIMLIVPFFILAYLRIANGSYIHILYENIAGRLIMTICLAVSIL 288

Query: 175 GIMVMRLMINFDV 187
                R MI   V
Sbjct: 289 SAAWSRKMIRIGV 301


>gi|13471027|ref|NP_102596.1| integral membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021771|dbj|BAB48382.1| probable integral membrane protein [Mesorhizobium loti MAFF303099]
          Length = 305

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 68/128 (53%), Gaps = 3/128 (2%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIETQ-HL 61
           ++++  ++ + FP+ +D+++    AG+ +   +  +  +   + P  S+  +++  +   
Sbjct: 151 VREKMREYRNGFPDFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRA 210

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G SL +++  +   + L EV  F+T++    +LG +LS AL   S  +R ++   A+ +A
Sbjct: 211 GRSLDDALKALADRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKA 270

Query: 122 LSMEAKAS 129
            ++ AK S
Sbjct: 271 HALPAKMS 278


>gi|325963897|ref|YP_004241803.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469984|gb|ADX73669.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 285

 Score = 39.7 bits (91), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 59/122 (48%), Gaps = 1/122 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   KKR+A     +P+ +D +  ++RAGLP+ +A+  +  +  + +R  FR       
Sbjct: 94  LRWRAKKRSALLRQLWPDVVDHLRSAIRAGLPLPEALIQLGDKGPEELRHVFRDFGADYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKV 119
            G     S++++   +           + +  ++GG +L + L  L+  LR+    ++++
Sbjct: 154 AGGQFDASLNKLKHRLADPVADRIVEALRLTREVGGSDLGKLLGTLAEFLRESARTRSEL 213

Query: 120 QA 121
           +A
Sbjct: 214 EA 215


>gi|253576285|ref|ZP_04853616.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844412|gb|EES72429.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 270

 Score = 39.7 bits (91), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 81/192 (42%), Gaps = 8/192 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVS-------DAVAVIVGQSSDPVRSEFRRV 55
           +L+++R       F  AL  +  S+ AG  V        D + ++     + V  E   +
Sbjct: 80  YLLRRRRENLSLHFKQALYSLSSSLAAGRSVENGFREAIDDLRLLYPDGDNDVMRELAII 139

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G  + E++    R   ++++  F+ V +   + GG+L E +   S ++ ++  +
Sbjct: 140 CARMDYGQPIEEALLDFSRRAAMEDIDNFADVFTTCKRSGGDLVEVIRRTSNLIGEKLEI 199

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
             ++  +  + +  A  + + P      + FTSP YM  L +   G ++ GVA     I 
Sbjct: 200 TQEISVMIAQKRFEAKAMLAAPVLFLLFMQFTSPDYMRPL-HHGAGLLISGVALLLYAIC 258

Query: 176 IMVMRLMINFDV 187
             +M  +I+  V
Sbjct: 259 AWLMLKIIDIRV 270


>gi|308068034|ref|YP_003869639.1| hypothetical protein PPE_01259 [Paenibacillus polymyxa E681]
 gi|305857313|gb|ADM69101.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 290

 Score = 39.7 bits (91), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 5/115 (4%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIV----GQSSDPVRSEFRRVIETQH 60
           ++KR  + L + P  L  ++  V AG  V  A+   V      +  P+  E R+ +    
Sbjct: 137 VQKRDQQILMELPELLSKMMLLVGAGETVQRALLHCVERKGADTEHPLYRELRQTVAEWE 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKN 114
            G S  ++   + +   +QE++ F+T + +  + GG +   AL  LS+ L  ++ 
Sbjct: 197 SGFSFQQAFEHLSKRCGIQEMTVFTTTVLLNMRRGGSDFVMALRELSQTLWGKRT 251


>gi|254486463|ref|ZP_05099668.1| type II secretion system protein [Roseobacter sp. GAI101]
 gi|214043332|gb|EEB83970.1| type II secretion system protein [Roseobacter sp. GAI101]
          Length = 320

 Score = 39.7 bits (91), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 72/160 (45%), Gaps = 15/160 (9%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGL---PVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           K R  +    FP+ L++IV +  AGL   P    VA  +  S   +  E  +++    + 
Sbjct: 165 KNRLGRIRHSFPDMLELIVITSEAGLGPQPALHRVAQEMSLSHPELAREMLQMVSEMAMT 224

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
                + ++M   +PL E+  F+  +    + G   S A+  L  I+  R N     + +
Sbjct: 225 NDCRGAYAKMNLRVPLPEIGIFTQTLDQSDRYGTPFSRAMRTL--IIEQRGN-----RLM 277

Query: 123 SMEAKASAW-IIGSLP--FCV--STLVYFTSPGYMNVLIN 157
           ++E KA+   ++ +LP  FC+  +  V    P  ++VL N
Sbjct: 278 AIEEKAARLPVLMTLPLIFCIMPAVFVVLVGPAVLSVLDN 317


>gi|182436318|ref|YP_001824037.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776948|ref|ZP_08236213.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464834|dbj|BAG19354.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657281|gb|EGE42127.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 295

 Score = 39.7 bits (91), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 53/125 (42%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I+ R        P+ LD++   V AGL    A+  +  +   P   E R  +    +G+S
Sbjct: 138 IRVRREHIERTLPDFLDVLAVVVSAGLGFRQALDRVAEKYEGPWSDELRITLRQMDMGVS 197

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             ++   + R    ++V+ F T +    +LG  + E L  ++  +R      A+ +A   
Sbjct: 198 RRQAFEELRRRNDSEQVAMFVTTLQQGEELGAPIVETLIQIANDMRRTDAQNARRKAARA 257

Query: 125 EAKAS 129
             KA+
Sbjct: 258 VPKAT 262


>gi|197106463|ref|YP_002131840.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
 gi|196479883|gb|ACG79411.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
          Length = 320

 Score = 39.7 bits (91), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 70/167 (41%), Gaps = 19/167 (11%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+ I+KR+ K     P+ALD+ V    AGL + DA    V +   P   E         
Sbjct: 160 LKNAIQKRSLKIQRALPDALDLFVICAEAGLSL-DAALARVSREIGPAAPEL-----ADE 213

Query: 61  LGLSL---------SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRD 111
           LGL+           E++  + R +   +V      +    + G  L++AL  L+   RD
Sbjct: 214 LGLTAVELGFLPDRREALLNLTRRVAAPQVRGLVNTLVQTEKYGTPLAQALRVLAAEFRD 273

Query: 112 RKNMKAKVQALSMEAKASAWIIGSLPFCVSTL-VYFTSPGYMNVLIN 157
            + MKA+ +A  + A  +  +I    F +  L V    P  + VL  
Sbjct: 274 TRMMKAEEKAARLPATLTVPMIA---FILPPLFVVLIGPAIVQVLTT 317


>gi|295836764|ref|ZP_06823697.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|295826195|gb|EFG64730.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 300

 Score = 39.7 bits (91), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 57/127 (44%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
             +++R A      P+ LD++   V AGL    A+  +  +   P   E R  +    +G
Sbjct: 141 QAVRERRAVIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKYEGPWADELRITLRQMDMG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S  ++   + R    ++V+ F + +    +LG  ++E L  ++  +R     +A+ +A 
Sbjct: 201 VSRRQAFDELRRRNNSEQVAQFVSALQQGEELGSPIAETLIQIANDMRRTDAQQARRRAA 260

Query: 123 SMEAKAS 129
               KA+
Sbjct: 261 KTIPKAT 267


>gi|320008843|gb|ADW03693.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 295

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 54/125 (43%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++KR        P+ LD++   V AGL    A+  +  +   P   E R  +    +G+S
Sbjct: 138 VRKRRDDIDRTLPDFLDVLAVVVSAGLGFRQALDRVAEKYQGPWSDELRITLRQMDMGVS 197

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             ++   + R    ++V+ F T +    +LG  + + L  ++  +R      A+ +A   
Sbjct: 198 RRQAFDELRRRNDSEQVAMFVTALQQGEELGAPIVDTLIAIANDMRRTDAQNARRKAAKA 257

Query: 125 EAKAS 129
             KA+
Sbjct: 258 VPKAT 262


>gi|254255261|ref|ZP_04948577.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
 gi|124900998|gb|EAY71748.1| Flp pilus assembly protein TadC [Burkholderia dolosa AUO158]
          Length = 324

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 74/156 (47%), Gaps = 11/156 (7%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS----SDPVRSEFRRVIETQH 60
           +  R  K  +DFP+ALD++   V AGL + DA  + V +     SD V  E   ++    
Sbjct: 161 VAARQQKIFEDFPDALDLLTVCVEAGLGL-DAALMKVSEELRFRSDVVAGELDLLLLEMR 219

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +   ++  +     ++++  F  ++    + G ++SE+L    R+L D    + +++
Sbjct: 220 SGFTKETALRNLALRTGVEDIESFCAMLIQADRFGTSISESL----RVLSDLLRTRRRMR 275

Query: 121 ALSMEAKASAWIIGSLPFCV--STLVYFTSPGYMNV 154
           A    AK +  ++  L FC+  + +V    P  ++V
Sbjct: 276 AEERAAKIALKLLFPLIFCIFPALMVVLLGPAMIHV 311


>gi|284161834|ref|YP_003400457.1| type II secretion system protein [Archaeoglobus profundus DSM 5631]
 gi|284011831|gb|ADB57784.1| type II secretion system protein [Archaeoglobus profundus DSM 5631]
          Length = 617

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 3/95 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +++  F N L  I  S   G+P+  A++++    + P+R E R++      GL LS 
Sbjct: 409 RYLRYIPIFFNRLATINES---GVPIYRAISILAKTDTSPLRDEIRKIKTDIDWGLDLSR 465

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
           +  R    + + +V+   T+++   +  GNL+E L
Sbjct: 466 AFVRFANRIRVFDVTRVVTMLNEAMKTTGNLTEVL 500


>gi|255316490|ref|ZP_05358073.1| hypothetical protein CdifQCD-7_19177 [Clostridium difficile
           QCD-76w55]
          Length = 317

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 78/180 (43%), Gaps = 11/180 (6%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG--QSSDPVRSEFRRVIETQ 59
           K L  KR  K      + + II+   +    +S ++   +   Q S+P+ SE ++ +   
Sbjct: 127 KTLSNKRVTKMESQIGSFIRIIIERYKINKNISKSLVETLPDFQGSEPLYSELKKSVVDI 186

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLS--EALANLSRILRDRKNMKA 117
            LG+ + E +S + R    + +  FS    V S L    S  + L        D + +K 
Sbjct: 187 DLGIPIEEVLSSLARRTGSKYLKLFSNYYEVSSMLSSQESKIKILTTSFNQYEDNRIIKR 246

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY---FTSPGYMNVLINDPRGHM-LLGVAAAFML 173
            ++   M     ++I   + F +  L+    F S GY++ +IN+  G M L G+  + +L
Sbjct: 247 DLRKEIMGPVRESYI---MVFAIPVLMLYQSFVSDGYLDFMINEKIGQMGLTGIFVSILL 303


>gi|150401575|ref|YP_001325341.1| type II secretion system protein [Methanococcus aeolicus Nankai-3]
 gi|150014278|gb|ABR56729.1| type II secretion system protein [Methanococcus aeolicus Nankai-3]
          Length = 295

 Score = 39.3 bits (90), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRR----VIETQHL 61
           + +  KF  + P AL ++  S+ +G  V++A+  ++    + V  EF +    +IE ++ 
Sbjct: 76  EGKIEKFEKNIPKALYVMTLSLDSGRSVTEAIEEVINAGVNGVDKEFMKILYLIIEKKYS 135

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
                 +I+     M  +++     +I  + Q GG L+  L  L++ L D  N+K ++  
Sbjct: 136 FEDAMTTITENSDSMVFRQIG--RLIIENRKQ-GGELASTLRTLAKTLEDLMNIKQQL-- 190

Query: 122 LSMEAKASAWIIGSLPFC 139
             +   A+  ++G +  C
Sbjct: 191 --LSTTANGLVVGLVILC 206


>gi|261402163|ref|YP_003246387.1| Type II secretion system F domain protein [Methanocaldococcus
           vulcanius M7]
 gi|261369156|gb|ACX71905.1| Type II secretion system F domain protein [Methanocaldococcus
           vulcanius M7]
          Length = 301

 Score = 39.3 bits (90), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 69/129 (53%), Gaps = 7/129 (5%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVI---ETQHLGLSLSESIS 70
           ++ P AL I++ ++ +G  +++A+  +V  +   V + F++V+   E Q +  S  E+++
Sbjct: 87  NNIPQALYIMILTLESGRSINEALEEVVKNNIKEVSNVFKKVLYLMEKQKI--SFEEAMT 144

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +      + +   + ++    + GGNL+++L  L++ L D +  K ++ +++    A  
Sbjct: 145 IVSNLYDSKVLKMLARIMIENRKYGGNLADSLRVLAKTLEDFRLYKRQLLSVTASGLAVG 204

Query: 131 WII--GSLP 137
           +II  G +P
Sbjct: 205 FIILCGVIP 213


>gi|184200571|ref|YP_001854778.1| hypothetical protein KRH_09250 [Kocuria rhizophila DC2201]
 gi|183580801|dbj|BAG29272.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 285

 Score = 39.3 bits (90), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 76/160 (47%), Gaps = 3/160 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +RTA   + +P+ +D +  ++RAG+ + +A+  +  +  +P+R  F R          L 
Sbjct: 100 RRTAVLREVWPDVVDHLRSAIRAGMGLPEALMQLQYRGPEPLRPAFARFAADYRASGQLH 159

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGG-NLSEALANLSRILRDRKNMKAKVQALSME 125
            S++ + + +           + V  ++GG +L + L  LS  LR+ +  +++++A    
Sbjct: 160 GSLTMLKQRLADPVADNIVEALRVTREVGGTDLGKLLGTLSEFLRENERTRSELEARQSW 219

Que