BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780722|ref|YP_003065135.1| pilus assembly protein
[Candidatus Liberibacter asiaticus str. psy62]
         (187 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|13474664|ref|NP_106233.1| hypothetical protein mlr5603 [Mesorhizobium loti MAFF303099]
 gi|14025419|dbj|BAB52019.1| mlr5603 [Mesorhizobium loti MAFF303099]
          Length = 337

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 108/187 (57%), Positives = 144/187 (77%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R   FL++FPNALDIIVR+V++GLP++DAV +I  +S +PV++EFRR++++Q 
Sbjct: 151 VSFRRARRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANESPEPVKAEFRRIVDSQQ 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+S+ ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKVQ
Sbjct: 211 MGISIPDATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQ 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG AA +M IGI+VMR
Sbjct: 271 ALSMEAKASAAIIGALPFIVAFLVYLSSPDYLMPLFNTSVGNLILGCAAVWMSIGILVMR 330

Query: 181 LMINFDV 187
            M+NF+V
Sbjct: 331 KMMNFEV 337


>gi|260461945|ref|ZP_05810190.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032192|gb|EEW33458.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 337

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 107/187 (57%), Positives = 144/187 (77%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R   FL++FPNALDIIVR+V++GLP++DAV +I  ++ +PV++EFRR++++Q 
Sbjct: 151 VSFRRSRRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANEAPEPVKTEFRRIVDSQQ 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKVQ
Sbjct: 211 MGLSIPDATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVQ 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG +A +M IGI+VMR
Sbjct: 271 ALSMEAKASAAIIGALPFIVAFLVYLSSPSYLMPLFNTSVGNLILGCSAVWMSIGILVMR 330

Query: 181 LMINFDV 187
            M+NF+V
Sbjct: 331 KMMNFEV 337


>gi|302391032|ref|YP_003826852.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203109|gb|ADL11787.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 327

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 105/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  KKR  KF +   ++L II  S++AG     A+ ++  +   P+  E  RV++  +
Sbjct: 141 LKYSQKKRLDKFNEQINDSLTIISNSLKAGYSFFQALEMVAKEMPPPISEEITRVLKEMN 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  ++++ +   +   ++    T + +Q Q+GGNLSE L N+S  +R+R  +K ++Q
Sbjct: 201 LGASPQDALTALTDRVESDDLELVVTAVLIQRQVGGNLSEILDNISDTIRERIKIKGEIQ 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +  +++  SP YM  L   P G  ++GV     ++G ++++
Sbjct: 261 TLTAQGRMSGLIIGLLPVGLGGMLFLISPDYMAPLFGHPLGQTMIGVGIISQILGAVLIK 320

Query: 181 LMINFDV 187
            +I+ +V
Sbjct: 321 KIIDIEV 327


>gi|86748903|ref|YP_485399.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
 gi|86571931|gb|ABD06488.1| type II secretion system protein [Rhodopseudomonas palustris HaA2]
          Length = 324

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 94/186 (50%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KF++  P+A+D+IVR ++AGLP+ D++ V+   S +P++SEF  +IETQ 
Sbjct: 138 LGFLKKRREKKFINALPDAVDVIVRGIKAGLPLFDSLKVVAADSPEPLKSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYDRMPLPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L     +M  GI+VM+
Sbjct: 258 AMSMEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGCVVWMSAGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|115525753|ref|YP_782664.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519700|gb|ABJ07684.1| type II secretion system protein [Rhodopseudomonas palustris
           BisA53]
          Length = 324

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 129/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R   FL   P+A+D+IVR ++AGLP+ D++ V+   + +P+R+EF  +++TQ 
Sbjct: 138 LSFLKKRRERNFLKALPDAVDVIVRGIKAGLPLYDSIKVVAADAPEPLRTEFLTILDTQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACGRLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+ +L   P G M+L     +M IG+ VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMFLVYLTTPDYIALLWTHPTGQMMLAGCVLWMSIGVFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|260776711|ref|ZP_05885606.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607934|gb|EEX34199.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 322

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/187 (33%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I  R + F    P ALDI+ R ++AG PV+ A + +  +   P+  EF+      +
Sbjct: 136 LSKKISDRLSAFEGQLPEALDIMRRMLQAGQPVTQAFSEVGEEMPAPIGVEFKNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++
Sbjct: 196 YGYDMRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRARFKLQRKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +PGY+  L  DPRG  L+      + IG + +R
Sbjct: 256 TLSAESRLSAWILVLSPFVLFLFLSFVNPGYVEPLYTDPRGMKLISGGVVSLFIGSLWIR 315

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 316 KIINFEV 322


>gi|187927683|ref|YP_001898170.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|187724573|gb|ACD25738.1| type II secretion system protein [Ralstonia pickettii 12J]
          Length = 325

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 111/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  K     P+A+D+I R++RAG   + A+ ++  +  +P+  EF    E  +
Sbjct: 139 IASQRRKRLKKLEAQLPDAVDMIARALRAGHSFASALGMVGQEIKEPMGPEFHTTFEEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL E+++ + + +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++
Sbjct: 199 YGVSLDEALTNLAKRVPVNDLRYFVIAVLIQRESGGNLAEILDTIGNLVRERLKLYDKIR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G LPFC + ++   +P +M VL  DP G  ++G+A   M++G++ MR
Sbjct: 259 VLSAEGRLSAWILGLLPFCTAGMILLVNPDFMKVLWTDPMGLKMIGLALFNMVMGLIWMR 318

Query: 181 LMINFDV 187
            +I   V
Sbjct: 319 KIIRIRV 325


>gi|90425201|ref|YP_533571.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107215|gb|ABD89252.1| type II secretion system protein [Rhodopseudomonas palustris
           BisB18]
          Length = 324

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 131/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R   FL   P+A+D+IVR ++AGLP+ D++ V+   + +P++SEF  ++ETQ 
Sbjct: 138 LNFLKKRREKNFLKALPDAVDVIVRGIKAGLPLFDSLKVVAADAPEPLKSEFLAILETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M IGI VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLAGCVLWMAIGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 QMINFD 323


>gi|222147178|ref|YP_002548135.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734168|gb|ACM35131.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 334

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 113/187 (60%), Positives = 152/187 (81%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LI++R  KFL +FPNALD++VRS+++GLP++DA+ +I   + +PV++EFRRV++ Q 
Sbjct: 148 VSFLIRRRQEKFLTEFPNALDVMVRSIKSGLPLNDALRMIAVDAQEPVKTEFRRVVDAQQ 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+++ E+  RM   MPLQEVSFF+ VI++QSQ GGNLSEAL+NLS++LR+R+ MKAKV 
Sbjct: 208 LGITVPEACGRMFNSMPLQEVSFFAIVIAIQSQAGGNLSEALSNLSKVLRERRKMKAKVS 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+ LVY +SP Y+ VL  DPRGHM+LG +A +M IGI VMR
Sbjct: 268 ALSMEAKASAVIIGALPFIVAFLVYISSPAYIMVLFTDPRGHMILGFSAFWMSIGIFVMR 327

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 328 NMINFDI 334


>gi|319785604|ref|YP_004145080.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171492|gb|ADV15030.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 337

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 107/187 (57%), Positives = 143/187 (76%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R   FL++FPNALDIIVR+V++GLP++DAV +I  +S +PV++EFRR++++Q 
Sbjct: 151 VTFRRARRVKAFLNEFPNALDIIVRAVKSGLPLNDAVRLIANESPEPVKTEFRRIVDSQQ 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++  RM   MP  E SFF  VI +QSQ GGNLSEAL NLSR+LRDRK MKAKV 
Sbjct: 211 MGLSIPDATLRMPETMPCTEASFFGIVIQIQSQAGGNLSEALGNLSRVLRDRKKMKAKVA 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+ LVY +SP Y+  L N   G+++LG +A +M IGI+VMR
Sbjct: 271 ALSMEAKASAAIIGALPFIVAFLVYLSSPAYLMPLFNTSVGNLILGCSAVWMSIGILVMR 330

Query: 181 LMINFDV 187
            M+NF+V
Sbjct: 331 KMMNFEV 337


>gi|315121887|ref|YP_004062376.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495289|gb|ADR51888.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 328

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 142/187 (75%), Positives = 174/187 (93%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++LIKKRTAKFL++FPNALDIIVRSVR+GLPVSDA+++IVGQSSDPVRSEFRRV+E QH
Sbjct: 142 LQYLIKKRTAKFLNEFPNALDIIVRSVRSGLPVSDAISIIVGQSSDPVRSEFRRVVEAQH 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+SES++RMVRYMPLQEVSFFSTVIS+Q+Q GGNLSEAL+NLS ILR+RK MK KVQ
Sbjct: 202 LGLSVSESVARMVRYMPLQEVSFFSTVISIQAQSGGNLSEALSNLSGILRERKKMKGKVQ 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+MEAK+SAWIIGSLPF VS+LV+FTSPGY+++L  D RGH++LG+AA  M++G ++MR
Sbjct: 262 ALAMEAKSSAWIIGSLPFFVSSLVHFTSPGYIDILFLDSRGHIILGIAAFLMVLGAVIMR 321

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 322 TMINFDM 328


>gi|148258239|ref|YP_001242824.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146410412|gb|ABQ38918.1| putative pilus assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 324

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KFL   P+A+D+IVR ++AGLP+ +++ V+   + +P+RSEF  +IETQ 
Sbjct: 138 LNFLKKRREKKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADAPEPLRSEFLAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  V+++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVVAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M +GI VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLVGCVVWMSMGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|222084473|ref|YP_002543002.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721921|gb|ACM25077.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 335

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++FPNALD+I RS+R+GLP++DAV ++  ++ +PVR+EFRRV+ETQ 
Sbjct: 149 VGFLIKRRQNKFLEEFPNALDLITRSIRSGLPLNDAVRLVASEAREPVRTEFRRVVETQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS++++ +RM  +MPLQEV+FFS VI++Q+Q GGNLSEAL NL+++LR+RK MKAKV 
Sbjct: 209 VGLSMTDACARMNNHMPLQEVNFFSIVIAIQAQAGGNLSEALGNLAKVLRERKKMKAKVV 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V  LVY TSP YM +L  DPRGH+++ +A  +M  G+++MR
Sbjct: 269 ALSMEAKASAVIIGALPFIVMLLVYLTSPQYMMILFTDPRGHLIMLLAGIWMAFGVIIMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 QMVNFDI 335


>gi|21673274|ref|NP_661339.1| TadB protein [Chlorobium tepidum TLS]
 gi|21646363|gb|AAM71681.1| tadB protein [Chlorobium tepidum TLS]
          Length = 305

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 65/187 (34%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR   F    P ALD I RS+RAG  +S A+ +I  +  DP+  EF+ V +  +
Sbjct: 119 LSRKAKKRRMAFEAKLPEALDYISRSLRAGHSLSSAIGMIGKEFPDPLGGEFKTVFDEMN 178

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+   E+ + +   +   ++SFF   + +Q + GGNL+E L  L+  +R+R  ++ KV+
Sbjct: 179 FGIPFKEAFAHLSNRIRSNDISFFVIALMIQHETGGNLAELLGGLATTIRERFKLRGKVR 238

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SA ++GS+PF  +T++   +P Y+  L N P+GH LL +A   ML+G+ V+ 
Sbjct: 239 TLSSEGRISALVLGSMPFVFATIISLINPRYILPLFNTPQGHTLLYIAGGLMLVGMYVLN 298

Query: 181 LMINFDV 187
            M+   V
Sbjct: 299 NMVKIKV 305


>gi|84498180|ref|ZP_00996977.1| putative membrane protein [Janibacter sp. HTCC2649]
 gi|84381680|gb|EAP97563.1| putative membrane protein [Janibacter sp. HTCC2649]
          Length = 654

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  KF    P+ L ++  ++ +G  ++ A+  +   S+ P   EF R +    
Sbjct: 468 LRMLAGRRAKKFEQMLPDILMLVATTLASGFSLTQALDAVARDSAQPAGKEFSRTLAETR 527

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  +S+++  M   M  + + + +  I +Q  +GGNL++ L   +  LR+R+++K +V 
Sbjct: 528 IGADVSDALENMSVRMDSEAMRWTTMAIRIQRDVGGNLADTLRTTAHTLRERESLKRQVN 587

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SA+I+  LP  +   + +++P Y ++L     G ++L  +   M+IG + MR
Sbjct: 588 SLSAEGRLSAYILLGLPILLFVYMAWSNPAYTSLLWTRTVGILMLLGSGVSMVIGTLWMR 647

Query: 181 LMINFDV 187
            +I  +V
Sbjct: 648 KVIQIEV 654


>gi|145219379|ref|YP_001130088.1| type II secretion system protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205543|gb|ABP36586.1| type II secretion system protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 322

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   F D  P ALD I R++RAG  ++ A+ ++  +  DP+  EF+ V +   
Sbjct: 136 LLKLADRRRRAFEDKLPEALDHISRALRAGHSLAPAMGMVGQEFGDPIGYEFKIVFDEIG 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+   E+I R+   +   +++FF   +++Q + GGNL+E    L+R +R R  ++ K++
Sbjct: 196 FGIPFKEAIGRLAERVQSNDLNFFVISLTIQHETGGNLTELFDGLARTIRHRIKLRGKIR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E +AS W++GS+PF +  ++   +P Y+  L   P+G+ ++ + A  M +G +V++
Sbjct: 256 ILSSEGRASGWVLGSMPFVLMAVLSLINPEYIAQLWTTPQGNTMMMIGAGLMSVGFVVLK 315

Query: 181 LMINFDV 187
            ++   V
Sbjct: 316 RIVQIKV 322


>gi|114705451|ref|ZP_01438359.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
 gi|114540236|gb|EAU43356.1| probable pilus assembly protein [Fulvimarina pelagi HTCC2506]
          Length = 335

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 98/187 (52%), Positives = 146/187 (78%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR   F + FP A+D+IVR V+AGLP++D +  +V    DPV SEF++V+E Q 
Sbjct: 149 LSNRRKKRINDFSNSFPTAIDLIVRGVKAGLPLNDTLRTVVSDVPDPVSSEFQKVVEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++L ++  R+ + +PL E +FF+ VI++QSQ GGNLSEAL NLSR+LR+RK M+ K+Q
Sbjct: 209 MGVTLGDACDRLYKQVPLPETNFFAIVIAIQSQAGGNLSEALGNLSRVLRERKKMRQKIQ 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGS+P  V++++Y TSP Y+NVL++DPRG+++L  +A +MLIG+++M+
Sbjct: 269 AVSMEAKASASIIGSIPVLVASMIYMTSPDYLNVLLHDPRGNIVLIASAVWMLIGVLIMK 328

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 329 KMINFDI 335


>gi|299132290|ref|ZP_07025485.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
 gi|298592427|gb|EFI52627.1| Type II secretion system F domain protein [Afipia sp. 1NLS2]
          Length = 323

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 97/186 (52%), Positives = 136/186 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  +FL+  P+A+D+IVR V+AGLP+ D++ V+V  S +P+RSEFR +IETQ 
Sbjct: 137 LSYLKRRREKQFLEALPDAVDVIVRGVKAGLPLFDSLKVVVNDSPEPLRSEFRAIIETQS 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  VI +Q++ GGNLSEAL NLS++LRDRK M+AK+Q
Sbjct: 197 IGMPLGEACMRLYERMPLPEANFFGIVIGIQTKSGGNLSEALGNLSKVLRDRKKMRAKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LP  V  +VY  SP Y+++L   P G  +L   A +M  GI+VM+
Sbjct: 257 AMSMEAKASAAIIGALPPVVMIIVYIMSPDYISLLWTHPTGRFMLACCAVWMTAGILVMK 316

Query: 181 LMINFD 186
            MINFD
Sbjct: 317 KMINFD 322


>gi|261252091|ref|ZP_05944664.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260935482|gb|EEX91471.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 322

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 62/187 (33%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I  R A F +  P ALDI+ R ++AG PV+ A   +  +   P+  EF+ +    +
Sbjct: 136 LGKKISDRLAAFEEQLPEALDIMRRMLQAGQPVTQAFNEVGLEMPAPIGVEFKNMFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  ++ K++
Sbjct: 196 YGYDMRMAIMQMAERTPTVSMLAFSSAVILQKETGGNLSENLEKVSKVLRSRFKLQRKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   +PGY+  L  DPRG  L+      + IG + +R
Sbjct: 256 TLSAESRLSAWILVLSPFVLFLFLSVINPGYVEPLYTDPRGMKLVSGGVVSLFIGSLWIR 315

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 316 KIINFEV 322


>gi|209886534|ref|YP_002290391.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
 gi|209874730|gb|ACI94526.1| type II secretion system protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 102/186 (54%), Positives = 139/186 (74%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  KFLD  P+A+D+IVR V+AGLP+ D++ V+V  S +P+RSEFR +IETQ 
Sbjct: 139 LNFLKKRREKKFLDALPDAVDVIVRGVKAGLPLFDSLKVVVNDSPEPLRSEFRAIIETQS 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+  R+   MPL E +FF  V+ +Q + GGNLSEAL NLS++LRDRK MKAK+Q
Sbjct: 199 IGMPLGEACMRLYERMPLPEANFFGIVVGIQMKSGGNLSEALGNLSKVLRDRKKMKAKIQ 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  +VYF SP Y+++L  +P G ++L V+ A+M  G+M+M+
Sbjct: 259 AMSMEAKASAGIIGSLPPAVMMIVYFMSPDYISLLWTEPAGRVMLAVSGAWMFAGVMIMK 318

Query: 181 LMINFD 186
            MINFD
Sbjct: 319 KMINFD 324


>gi|90419768|ref|ZP_01227677.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
 gi|90335809|gb|EAS49557.1| putative Flp pilus assembly protein TadB, type II/IV secretion
           system [Aurantimonas manganoxydans SI85-9A1]
          Length = 335

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 98/186 (52%), Positives = 142/186 (76%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR  KF ++FPNA+D+IVR V++GLP++D + ++ G++ DPVRSEFR++IE+Q 
Sbjct: 149 LSRARKKRFHKFGEEFPNAIDLIVRGVKSGLPLNDTLRIVSGETLDPVRSEFRKIIESQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ +SE++ ++ R +P  E +FF+ VI++QSQ GGNLSEAL NLS +LRDRK M+AKVQ
Sbjct: 209 MGVPISEAVEKLYRNIPTPEANFFAIVIAIQSQAGGNLSEALGNLSNVLRDRKKMRAKVQ 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKAS  IIG+LP  V+ LVY T+P Y++VL     GH++L V+  +M  G+ VM+
Sbjct: 269 AMSMEAKASGGIIGALPVVVAGLVYITTPDYISVLFTTGTGHLILAVSGLWMATGVFVMK 328

Query: 181 LMINFD 186
            MI+FD
Sbjct: 329 KMISFD 334


>gi|316933035|ref|YP_004108017.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
 gi|315600749|gb|ADU43284.1| Type II secretion system F domain [Rhodopseudomonas palustris DX-1]
          Length = 324

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 94/186 (50%), Positives = 135/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  KFL   P+A+D+IVR ++AGLP+ D++ V+   + +P+RSEF  +IETQ 
Sbjct: 138 LGFLKRRREKKFLAALPDAVDVIVRGIKAGLPLFDSIKVVAADAPEPLRSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L+++ +R+   MPL E +FF  VI++Q + GGNLSEAL+NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLADACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALSNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+
Sbjct: 258 AMSMEAKASATIIGALPLIVMLLVYLTTPDYISLLWTHPTGRLLLAGSALWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|146338119|ref|YP_001203167.1| putative pilus assembly protein membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146190925|emb|CAL74930.1| putative pilus assembly protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 93/186 (50%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R  KFL   P+A+D+IVR ++AGLP+ +++ V+   + +P+RSEF  +IETQ 
Sbjct: 138 LGYLKKRREKKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADAPEPLRSEFLAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MPL E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPLPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+++L   P G ++L     +M +GI+VM+
Sbjct: 258 AMSMEAKASAGIIGSLPPIVMLLVYLSTPDYISLLWTHPTGQLMLVGCVVWMSMGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|154250693|ref|YP_001411517.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154643|gb|ABS61860.1| type II secretion system protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 328

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 91/186 (48%), Positives = 140/186 (75%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +LIK+R   F ++F NA+D+IVR V++GLPV+D + +I  +S +PVR+EF+ ++E Q 
Sbjct: 142 LSYLIKRRQKAFTEEFANAIDVIVRGVKSGLPVNDCLKLIATESPEPVRTEFQGIVEGQR 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++L + ++++   MPL EV+FF  V+++Q + GGNLSEAL NLS++LR+RK M+ K+Q
Sbjct: 202 VGVTLEQGLAKIYERMPLPEVNFFQIVLAIQQKTGGNLSEALGNLSKVLRERKKMRGKIQ 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLP  V  L+YF+SPGYM+VL +   G+M++     +M IG++VM+
Sbjct: 262 AMSQEAKASAGIIGSLPPGVMLLIYFSSPGYMDVLFSTTAGNMIIVGGIMWMAIGVLVMK 321

Query: 181 LMINFD 186
            MI+F 
Sbjct: 322 KMIDFK 327


>gi|153008063|ref|YP_001369278.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559951|gb|ABS13449.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188]
          Length = 337

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 108/185 (58%), Positives = 141/185 (76%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              K+R  KFL++FPNALD+IVR+ RAGLP++D + +I  ++ +PV+SEF++V+E Q +G
Sbjct: 153 QKRKRRLKKFLEEFPNALDVIVRATRAGLPLNDGLRLIASEAVEPVKSEFKKVVEAQQIG 212

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LS+ E++ +M   MP  E +FF+ VI +Q+Q GGNLSEAL NLS++LRDRK MKAKV AL
Sbjct: 213 LSIPEAVGKMPDSMPCPETNFFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVDAL 272

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           SMEAKASA IIG+LPF V  LVY TSP YM +L     GHMLLG+AA  ML GI +M+ M
Sbjct: 273 SMEAKASAAIIGALPFIVMVLVYLTSPQYMTLLFTSSTGHMLLGIAAVLMLTGIFIMKNM 332

Query: 183 INFDV 187
           INFD+
Sbjct: 333 INFDM 337


>gi|39936744|ref|NP_949020.1| type II secretion system protein [Rhodopseudomonas palustris
           CGA009]
 gi|39650600|emb|CAE29123.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 324

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 96/186 (51%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  KFL   P+A+DIIVR ++AGLP+ D++ ++   S +P+RSEF  +IETQ 
Sbjct: 138 LGYLKRRREKKFLAALPDAVDIIVRGIKAGLPLFDSIKMVAADSPEPLRSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+ +R+   MP+ E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPIGEACARLYERMPIPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPIIVMMLVYVTTPDYISLLWTHPTGRILLAASALWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|150398545|ref|YP_001329012.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150030060|gb|ABR62177.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 336

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 153/187 (81%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IK+R  KFLD+FPNALD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q 
Sbjct: 150 VGSRIKRRCRKFLDEFPNALDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQ 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL++ E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV 
Sbjct: 210 VGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVN 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G +A +M IGI +MR
Sbjct: 270 ALSMEAKASACIIGALPFIVATLVYLTSPAYMAILFTDPRGHLIMGASAVWMSIGIWMMR 329

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 330 NMINFDI 336


>gi|260771471|ref|ZP_05880396.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
 gi|260613597|gb|EEX38791.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
          Length = 321

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R +KF +  P+ALDII R ++AG P++ +   +  +   P+  EF+      +
Sbjct: 135 LQKKISDRLSKFEEQLPDALDIIRRMLQAGQPLTQSFNEVGNEMPAPIGVEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  +  K++
Sbjct: 195 YGYDLRLAIMQMADRTPTVSMLAFSSAVLLQKETGGNLSENLDKVSKVLRARFKLARKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAWI+   PF +  ++    PGY++ L  DPRG  ++      + +G + MR
Sbjct: 255 TISAESRMSAWILVLSPFVLFIVMSLIHPGYVSPLYEDPRGVGVISYGIVSLFLGSLWMR 314

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 315 HIINFEV 321


>gi|193213110|ref|YP_001999063.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
 gi|193086587|gb|ACF11863.1| type II secretion system protein [Chlorobaculum parvum NCIB 8327]
          Length = 322

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F +  P ALD + RS+RAG  ++ A+ ++  +   P+  EF+ V +   
Sbjct: 136 LSRQANKRRQAFSEKLPEALDYVTRSLRAGHSLTSAIGIVGKEFPGPIGQEFKIVFDEIS 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+   E++ R+   +   +++FF   + +Q + GGNL+E L  L++ +R+R  ++ KV+
Sbjct: 196 FGIPFKEAMDRLADRVESVDLNFFVISLEIQHETGGNLTELLEGLAKTIRERFKLRGKVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SA ++GS+PF ++ ++   +P Y +VL + P+GH L+ V A  M +G   + 
Sbjct: 256 TLSAEGRISALVLGSMPFILTAILTVINPEYTSVLWSTPQGHTLIMVMAVLMALGFFSLN 315

Query: 181 LMINFDV 187
            +    V
Sbjct: 316 RISQIKV 322


>gi|27376546|ref|NP_768075.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349687|dbj|BAC46700.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 340

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 98/186 (52%), Positives = 135/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R +KFL   P+A+D+IVR ++AGLP+ +++ V+   S +P+RSEF  +IETQ 
Sbjct: 154 LSFLKKRRESKFLAALPDAVDVIVRGIKAGLPLFESIKVVAADSPEPLRSEFLAIIETQA 213

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ SR+   MPL E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M+ K+Q
Sbjct: 214 IGMPLGEACSRLYDRMPLPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMREKIQ 273

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G ++L     +M +GIMVM+
Sbjct: 274 AMSMEAKASAAIIGSLPPIVMFLVYLTTPHYISLLWTHPTGQLMLVGCVVWMSVGIMVMK 333

Query: 181 LMINFD 186
            MINFD
Sbjct: 334 KMINFD 339


>gi|192292570|ref|YP_001993175.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
 gi|192286319|gb|ACF02700.1| type II secretion system protein [Rhodopseudomonas palustris TIE-1]
          Length = 324

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 95/186 (51%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R  +FL   P+A+DIIVR ++AGLP+ D++ ++   S +P+RSEF  +IETQ 
Sbjct: 138 LGYLKRRREKRFLAALPDAVDIIVRGIKAGLPLFDSIKMVAADSPEPLRSEFNAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+ +R+   MP+ E +FF  VIS+Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPIGEACARLYERMPIPEANFFGIVISIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+++L   P G +LL  +A +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPIIVMMLVYVTTPDYISLLWTHPTGRILLAASALWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|239833233|ref|ZP_04681562.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825500|gb|EEQ97068.1| type II secretion system protein [Ochrobactrum intermedium LMG
           3301]
          Length = 336

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 110/185 (59%), Positives = 142/185 (76%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H  K+R  KFL++FPNALD+IVR+ RAGLP++D + +I  ++ +PV+SEF++V+E Q +G
Sbjct: 152 HRRKQRLKKFLEEFPNALDVIVRATRAGLPLNDGLRLIASEAVEPVKSEFKKVVEAQQIG 211

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LS+ E++ +M   MP  E +FF+ VI +Q+Q GGNLSEAL NLS++LRDRK MKAKV AL
Sbjct: 212 LSIPEAVGKMPDSMPCPETNFFAIVIQIQAQAGGNLSEALNNLSKVLRDRKKMKAKVNAL 271

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           SMEAKASA IIG+LPF V  LVY TSP YM +L     GHMLLGVAA  ML GI +M+ M
Sbjct: 272 SMEAKASAAIIGALPFIVMVLVYLTSPLYMTLLFTSSTGHMLLGVAAVLMLTGIFIMKNM 331

Query: 183 INFDV 187
           INFD+
Sbjct: 332 INFDM 336


>gi|323137429|ref|ZP_08072507.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
 gi|322397416|gb|EFX99939.1| Type II secretion system F domain [Methylocystis sp. ATCC 49242]
          Length = 326

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 99/187 (52%), Positives = 135/187 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R +KF+++FP ++D+I+R V+AGLPV+D   VI  +  +PVR EFRR+IE+Q 
Sbjct: 140 LSFLRKRRISKFIEEFPGSIDVIIRGVKAGLPVADCFRVIASEGQEPVRGEFRRIIESQA 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ E++ R    +P+ E SFFS VI++Q + GGNLSEAL NLSR+LRDRK MK KV+
Sbjct: 200 IGLSVGEAVERFAERVPVPEASFFSIVINIQQKSGGNLSEALGNLSRVLRDRKKMKGKVK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLPF V   VY T+P YM VL     G +++     +M IG+ +MR
Sbjct: 260 AMSSEAKASAGIIGSLPFLVGGAVYLTTPSYMMVLFTTNIGKIIIACGLLWMAIGVFIMR 319

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 320 KMINFDI 326


>gi|194335918|ref|YP_002017712.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308395|gb|ACF43095.1| type II secretion system protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 332

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 109/187 (58%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R   F D  P ALD I R++RAG  ++ A+ ++  +  DP+  EF+ V +   
Sbjct: 146 LLRQAKQRRKVFGDKLPEALDYISRAMRAGHSLTSAIGMVGKELPDPIGYEFKTVFDEIS 205

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+   ++I  +   +   +++FF   + +Q + GGNL+E L  L++ +R+R  ++ KV+
Sbjct: 206 FGIPFKDAIGHLADRIQSNDLNFFVISLKIQHETGGNLAELLHGLAKTIRERVKLRGKVR 265

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E +ASAWI+G++PF  + ++   +PGY++VL + P+G  L+ +    M +GI V+ 
Sbjct: 266 TLSSEGRASAWILGTMPFVFAGILMLINPGYISVLWSTPQGQNLMFIGCGLMAVGIFVLS 325

Query: 181 LMINFDV 187
            ++   V
Sbjct: 326 RIVQIKV 332


>gi|328953759|ref|YP_004371093.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454083|gb|AEB09912.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 339

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K R  KF    P AL ++ RS++AG      + ++  +  +P+  EF +  +  +
Sbjct: 153 LHMKKKYRLKKFEKQLPEALGLMARSLKAGHSFPSTMQLVADEMPNPIGIEFFKTFKEFN 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GL +S +++ + + + LQ++ FF T I++Q + GGNL E L  ++ ++RDR  +   ++
Sbjct: 213 YGLDMSSALANLQKRIDLQDLKFFVTAINIQRETGGNLVEILEKIASLIRDRFKLVNHIK 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + S  I+  LP  ++ ++YF +  YM +LI  P G M++GVA    L+G +++ 
Sbjct: 273 AITSEGRFSGLILTCLPPGMAIILYFLNKKYMLLLITHPWGKMMVGVALTMQLLGYLMIH 332

Query: 181 LMINFDV 187
            ++N  V
Sbjct: 333 KIVNIKV 339


>gi|315497461|ref|YP_004086265.1| type II secretion system f domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315415473|gb|ADU12114.1| Type II secretion system F domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 87/186 (46%), Positives = 125/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+RT KF  +F +A+DI+VR +++GLPV D + +I  +   P+  EF+R+ E   
Sbjct: 140 LSFLAKRRTTKFTANFADAIDILVRGIKSGLPVHDGLKIIAKELPAPLGPEFQRLNENIS 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L  S+ +M   MP  E+ FF+ VI++Q + GGNL+EAL NLS +LR R+ M+ K++
Sbjct: 200 IGMGLDMSLEKMCERMPTPELRFFTIVIAIQQKTGGNLAEALGNLSHVLRSRRMMREKIK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA IIG LP  V  ++Y T+PGYM  L+ DPRG+ +L   A +ML GI +MR
Sbjct: 260 ALSSEAIASASIIGVLPPGVGIMIYITNPGYMGPLLTDPRGNFMLLGGAVWMLCGIFMMR 319

Query: 181 LMINFD 186
            MINF 
Sbjct: 320 KMINFK 325


>gi|91977989|ref|YP_570648.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
 gi|91684445|gb|ABE40747.1| type II secretion system protein [Rhodopseudomonas palustris BisB5]
          Length = 324

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 90/186 (48%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R  +FL+  P+A+D+IVR ++AGLP+ D++ V+   S +P+++EF  +IETQ 
Sbjct: 138 LGFLKKRREKRFLNALPDAVDVIVRGIKAGLPLFDSIKVVAADSPEPLKTEFNAIIETQT 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+ +R+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPIGEACARLYDRMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKRMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L     +M  GI+VM+
Sbjct: 258 AMSMEAKASAAIIGSLPPIVMLLVYMSTPDYIALLWTHPTGRLMLAGCVVWMAAGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|218516696|ref|ZP_03513536.1| probable pilus assembly protein [Rhizobium etli 8C-3]
          Length = 335

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 113/187 (60%), Positives = 155/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q 
Sbjct: 149 LGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G++A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISAVWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|322434107|ref|YP_004216319.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161834|gb|ADW67539.1| Type II secretion system F domain protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 320

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 112/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K     R  KF +  P+A+D++ R++RAG  +S A+ V+  +S++P+  EF  V + Q 
Sbjct: 134 LKWKKSSRLGKFEEALPDAIDLMARALRAGHAMSSAIEVVAEESAEPLAGEFAIVFQQQK 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GL   +++ ++   +P +++SF  T I VQ + GG+L++ L   +R++R+R  ++ +++
Sbjct: 194 FGLQFRDALLQLGDRVPSKDLSFLITAILVQKETGGDLTDVLDRTTRVIRERIRIQGEIR 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + + + + WI+ +LP  +  L+   +PGY ++L +DP G +LLG     +LIG  ++ 
Sbjct: 254 TYTAQGRLTGWILSALPVVMLCLINVATPGYSHILFHDPTGQLLLGAGGVLILIGGFIIS 313

Query: 181 LMINFDV 187
            +++  V
Sbjct: 314 RVVDIKV 320


>gi|194288829|ref|YP_002004736.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222664|emb|CAQ68667.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 325

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL  KR  +     P+A+D+I R++RAG   S A++++  +   P+  EFR   E  + G
Sbjct: 141 HLRAKRLKQLEAQLPDAVDMISRALRAGHSFSGALSMVGQEMKAPIGPEFRTTFEEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ L
Sbjct: 201 VALDEAMTNLAMRVPVADLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SAW++G LPF  + ++   +PG+MNVL  DP G  ++G A   M  G++ MR +
Sbjct: 261 SAEGKLSAWVLGLLPFGTAGMILVINPGFMNVLWEDPLGLRMIGGALVSMTFGVLWMRKI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|227823975|ref|YP_002827948.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|227342977|gb|ACP27195.1| putative type II/IV secretion system protein TadB, Flp pilus
           assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 336

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 111/184 (60%), Positives = 154/184 (83%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           ++K+R  KFLD+FPNALD++VRS+++GLP++DA+ +I     +PV++EFRRV+E+Q +GL
Sbjct: 153 MVKRRCKKFLDEFPNALDVMVRSIKSGLPLNDALRLIASDGQEPVKTEFRRVVESQQVGL 212

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           ++ ++ +RM++ +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+RK MKAKV ALS
Sbjct: 213 NVPDACARMIQSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERKKMKAKVGALS 272

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
           MEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR MI
Sbjct: 273 MEAKASACIIGALPFIVATLVYLTSPEYMMVLFTDPRGHLIMGASAVWMSIGIFVMRNMI 332

Query: 184 NFDV 187
           NFD+
Sbjct: 333 NFDI 336


>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040399|gb|ACT57195.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 187

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 187/187 (100%), Positives = 187/187 (100%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH
Sbjct: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ
Sbjct: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR
Sbjct: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180

Query: 181 LMINFDV 187
           LMINFDV
Sbjct: 181 LMINFDV 187


>gi|225872757|ref|YP_002754214.1| bacterial type II secretion system protein F domain protein
           [Acidobacterium capsulatum ATCC 51196]
 gi|225792618|gb|ACO32708.1| bacterial type II secretion system protein F domain protein
           [Acidobacterium capsulatum ATCC 51196]
          Length = 323

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  KF    P+++D++ R++RAG  V+ A+ V+  Q  +PV SEF  V   Q+
Sbjct: 137 LNFQRAQRLKKFNAALPDSIDLLGRALRAGHSVASAIEVVSEQGQEPVASEFGEVFRAQN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GL   +++ ++   +P  ++ F  T + VQ + GGNL+E L   + ++R+R  ++ +V+
Sbjct: 197 FGLPFRDAMLQLAERVPSSDLRFLVTAMMVQKETGGNLTEILDRTTYVIRERLRIQGEVK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + + + +  I+  LP  +  L+   +P Y   L  DP G  +L   A  + +G   + 
Sbjct: 257 TKTAQGRLTGVILALLPIILGILINVINPDYAKPLFTDPLGKKMLYAGAGLISVGAFFIN 316

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 317 KIVKIEV 323


>gi|190889885|ref|YP_001976427.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|190695164|gb|ACE89249.1| probable pilus assembly protein [Rhizobium etli CIAT 652]
 gi|327194690|gb|EGE61536.1| putative pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 335

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 113/187 (60%), Positives = 155/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q 
Sbjct: 149 LGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH+++G++A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISAVWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|15963898|ref|NP_384251.1| hypothetical protein SMc02821 [Sinorhizobium meliloti 1021]
 gi|307315795|ref|ZP_07595309.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|15073073|emb|CAC41532.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898563|gb|EFN29236.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 336

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  ++K+R  KFLD+FPN+LD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q 
Sbjct: 150 VGSMVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQ 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL++ E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV 
Sbjct: 210 VGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVS 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR
Sbjct: 270 ALSMEAKASACIIGALPFIVATLVYLTSPDYMMVLFTDPRGHIIMGASAVWMSIGIWVMR 329

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 330 NMINFDI 336


>gi|148976657|ref|ZP_01813344.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
 gi|145964008|gb|EDK29266.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
          Length = 321

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  +P+  EF+      +
Sbjct: 135 VQNRVTYRMARFEEQLPEALDIIRRALQAGQPIVQSFNEVGEEMPEPIGVEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAIMQMTERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L +DPRG  ++ +    + IG + +R
Sbjct: 255 TLSAESRLSAWILTLSPFVLFFGLKFVNPEYIEPLYSDPRGISMVSIGVILLAIGALWIR 314

Query: 181 LMINFDV 187
            +IN ++
Sbjct: 315 KIINIEI 321


>gi|315181053|gb|ADT87967.1| Flp pilus assembly protein TadB [Vibrio furnissii NCTC 11218]
          Length = 321

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R +KF +  P+ALDII R ++AG P++ +   +  +   P+  EF+      +
Sbjct: 135 LQKKISDRLSKFEEQLPDALDIIRRMLQAGQPLTQSFNEVGNEMPAPIGVEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  +  K++
Sbjct: 195 YGYDLRLAIMQMADRTPTVSMLAFSSAVLLQKETGGNLSENLDKVSKVLRARFKLARKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAWI+   PF +   +    PGY++ L  DPRG  L+      + +G + MR
Sbjct: 255 TISAESRMSAWILVLSPFVLFIAMSIIHPGYVSPLYEDPRGVGLISYGIVSLFMGSLWMR 314

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 315 HIINFEV 321


>gi|92116009|ref|YP_575738.1| type II secretion system protein [Nitrobacter hamburgensis X14]
 gi|91798903|gb|ABE61278.1| type II secretion system protein [Nitrobacter hamburgensis X14]
          Length = 324

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 91/186 (48%), Positives = 128/186 (68%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   FL   P+A+D+IVR ++AGLP+ +++ V+   S +P++SEF  +IETQ 
Sbjct: 138 LGFLKTRREKAFLRALPDAVDVIVRGIKAGLPLFESIKVVAADSPEPLKSEFAAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ +R+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K+Q
Sbjct: 198 IGMPLGEACARLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQ 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY T+P Y+ +L   P G ++L     +M  GI VM+
Sbjct: 258 AMSMEAKASAAIIGSLPPVVMMLVYLTTPDYIAMLWTHPTGRLMLAGCVLWMSAGIFVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|307320430|ref|ZP_07599847.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306893996|gb|EFN24765.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 336

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  ++K+R  KFLD+FPN+LD++VRS+++GLP++DA+ +I     +PVR+EFRRV+E+Q 
Sbjct: 150 VGSMVKRRCRKFLDEFPNSLDVMVRSIKSGLPLNDALRLIASDGQEPVRTEFRRVVESQQ 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL++ E+ +RM+  +PL EV+FF+ VI++Q+Q GGNLSEAL NLS++LR+R+ MKAKV 
Sbjct: 210 VGLNVPEACARMIHSIPLPEVNFFAIVIAIQAQAGGNLSEALGNLSKVLRERRKMKAKVG 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH+++G +A +M IGI VMR
Sbjct: 270 ALSMEAKASACIIGALPFIVATLVYLTSPDYMMVLFTDPRGHIIMGASAVWMSIGIWVMR 329

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 330 NMINFDI 336


>gi|323491539|ref|ZP_08096718.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
 gi|323314115|gb|EGA67200.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
          Length = 322

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 62/187 (33%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I  R A F +  P ALDI+ R ++AG PV+ A   +  +   P+  EF+      +
Sbjct: 136 LGKKISDRLAAFEEQLPEALDIMRRMLQAGQPVTQAFNEVGVEMPAPIGIEFKNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++
Sbjct: 196 YGYDMRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRARFKLQRKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   +PGY+  L  DPRG  L+      +  G + +R
Sbjct: 256 TLSAESRLSAWILVLSPFVLFIFLSVINPGYVEPLYTDPRGMKLVSGGVVSLFFGSLWIR 315

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 316 KIINFEV 322


>gi|218461009|ref|ZP_03501100.1| probable pilus assembly protein [Rhizobium etli Kim 5]
 gi|218662450|ref|ZP_03518380.1| probable pilus assembly protein [Rhizobium etli IE4771]
          Length = 335

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 113/187 (60%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRR+IE Q 
Sbjct: 149 LGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRIIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYLTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|269126092|ref|YP_003299462.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311050|gb|ACY97424.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 660

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++R   F D  P+AL ++  S+R+G  V+ +V  + G    P+  E  R +    
Sbjct: 474 LRGRAERRLTAFADQLPDALQLVAGSLRSGFSVAQSVERLAGLELQPMGQEMARAVAQTR 533

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+S  +++  +   M  +++ +    I +Q ++GGNLSE +   +  +R+R  ++ +++
Sbjct: 534 LGVSTEDALRSVADRMNCRDLHWVVLAIQIQREVGGNLSEVIETTAETMRERTRLRRQIR 593

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA+++ +LP     L+  + P YM  L   P G  ++ +A   + +G + + 
Sbjct: 594 ALSAEGRLSAYVLIALPVITGGLLTVSRPDYMRPLYTTPMGIGMICLAVFLVALGWLWLS 653

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 654 KVVKVEV 660


>gi|254473793|ref|ZP_05087188.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957179|gb|EEA92384.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 339

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 85/187 (45%), Positives = 135/187 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR  +FL++FPNA+DIIVR +++G+P+ D + +   ++ DPV +EF  V++   
Sbjct: 153 VSRARKKRFNRFLEEFPNAVDIIVRGIKSGMPLGDCMHIAASEAKDPVGTEFSLVLDKMQ 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L+E+I  + + +PLQE +F + V+++Q+Q GG+LSEAL NLS+ LR RK MK K++
Sbjct: 213 MGMPLAEAIQSLPKRVPLQETNFLAIVVTIQAQAGGSLSEALGNLSKTLRQRKEMKGKIR 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIGSLPF V+ L++  SP Y+ +L++   G +L+G+   +M IGI+VMR
Sbjct: 273 AVSQEAKSSAAIIGSLPFIVTALLFVLSPDYIKLLVDTDIGLVLIGIGLFWMSIGILVMR 332

Query: 181 LMINFDV 187
            MI+F +
Sbjct: 333 KMIDFKI 339


>gi|187919328|ref|YP_001888359.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187717766|gb|ACD18989.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 325

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 110/185 (59%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  +     P+A D+I R++RAG     A+ ++  +  +P+  EF  V +  + G
Sbjct: 141 RKRTKRVLQLERQLPDAADLIARALRAGHSFPAALGMVGEELPNPLGGEFALVFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+S+++  MV  +P++++ +F   + +Q + GGNL+E L +++ I+R+R  +  KV+ L
Sbjct: 201 VSMSDALLNMVNRVPVEDLRYFVIAVLIQREAGGNLAEILGSIAGIIRERLKLLGKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAW++G LPF +  L+   +PGY++V   DP G  + GVA A ML GI+ MR +
Sbjct: 261 SAEGRLSAWVLGVLPFAILGLLSVLNPGYISVFWKDPAGPQIAGVAIAMMLFGILWMRKV 320

Query: 183 INFDV 187
           +   V
Sbjct: 321 VRIRV 325


>gi|163757631|ref|ZP_02164720.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
 gi|162285133|gb|EDQ35415.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43]
          Length = 336

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 105/187 (56%), Positives = 149/187 (79%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L  +R   FL +FPNALDI+VRS+++GLP++DA+ +I  +  +PVR+EF+R++++Q 
Sbjct: 150 VGYLRNRRLKAFLSEFPNALDIMVRSIKSGLPLNDAIRMISAEGQEPVRTEFKRIVDSQQ 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+++ E+ +R+   +PL E +FFS VI++Q+Q GGNLSEAL NLSR+LRDRK MKAK+ 
Sbjct: 210 MGMNIPEACARLYSRIPLSEANFFSIVIAIQAQAGGNLSEALGNLSRVLRDRKKMKAKIN 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+ LVY TSP Y+ +L  D RGH++LG +A +M IGI+VMR
Sbjct: 270 ALSMEAKASAAIIGALPFIVALLVYLTSPDYIMILFTDTRGHLILGASAIWMSIGILVMR 329

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 330 NMINFDI 336


>gi|91788418|ref|YP_549370.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697643|gb|ABE44472.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 325

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  +     P+ALD++ R++RAG     A+ ++  + +DP+  EFR   +  +
Sbjct: 139 VTRAKRKRLDRIEHQLPDALDLMGRALRAGHAFPTALKMVGDEMNDPLAGEFRIAFDEVN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+++ +++  M   +P  ++ +F   + +Q + GGNLSE L ++S I+RDR  +  +V+
Sbjct: 199 FGIAMPDALMNMATRVPSTDLRYFVIAVLIQRETGGNLSELLTSISAIIRDRIKLMGQVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E K SAW++  LPF  + ++  T+P ++ VL  DP G  +L  A   M +GI+VMR
Sbjct: 259 VLSAEGKMSAWVLSLLPFGAAFMIQLTNPKFLEVLYTDPAGRKMLAAAIVMMALGILVMR 318

Query: 181 LMINFDV 187
            +I   V
Sbjct: 319 KIIRIRV 325


>gi|209551763|ref|YP_002283680.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537519|gb|ACI57454.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 335

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 114/187 (60%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q 
Sbjct: 149 VGFLIKRRQNKFLNELPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFRRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEVSFF+ VI++QSQ GGNLSEA+ NLS+++R+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTAHMPLQEVSFFAIVIAIQSQAGGNLSEAIGNLSKVIRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYLTSPSYMMILFTDPRGHFIMGVSAIWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|86355868|ref|YP_467760.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279970|gb|ABC89033.1| probable pilus assembly protein [Rhizobium etli CFN 42]
          Length = 335

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 115/187 (61%), Positives = 155/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++FPNALD+I RS+++GLP++DA+ +I  + ++PV+SEFRRVIE Q 
Sbjct: 149 IGFLIKRRQNKFLNEFPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFRRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTLHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM VL  DPRGH ++G +A +M IGI+VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYLTSPNYMIVLFTDPRGHFIMGASAVWMSIGILVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|241207161|ref|YP_002978257.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861051|gb|ACS58718.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 335

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 114/187 (60%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++ PNALD+I RS+++GLP++DA+ +I  + ++PV+SEF RVIE Q 
Sbjct: 149 VGFLIKRRQTKFLNELPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKVQ
Sbjct: 209 VGLSIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVQ 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|116249985|ref|YP_765823.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254633|emb|CAK05707.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 114/187 (60%), Positives = 154/187 (82%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK+R  KFL++FPNALD+I RS+++GLP++DA+ +I  + ++PV+SEF RVIE Q 
Sbjct: 149 VGFLIKRRQTKFLNEFPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQ 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ ++ +RM  +MPLQEV+FF+ VI++QSQ GGNLSEA+ NLS++LR+R+ MKAKV 
Sbjct: 209 VGLSIPDACARMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVS 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V+TLVY TSP YM +L  DPRGH ++GV+A +M IGI VMR
Sbjct: 269 ALSMEAKASAVIIGALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMR 328

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 329 NMVNFDI 335


>gi|295690794|ref|YP_003594487.1| type II secretion system F domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432697|gb|ADG11869.1| Type II secretion system F domain protein [Caulobacter segnis ATCC
           21756]
          Length = 325

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 125/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L + R  KF + F +A+DIIVR +++GLP+ D + +I  +S +P+  EFR + E   
Sbjct: 139 LSILAQGRIRKFTEAFSDAIDIIVRGIKSGLPLHDCLRIIGQESPEPLAGEFRMLTENVA 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L  ++ +M   MP  E+ FF+ V+++Q + GGNL+EAL NLS +LR RK MK K++
Sbjct: 199 MGVPLDAALDKMHERMPTNELRFFAIVLAIQQKTGGNLAEALGNLSTVLRSRKMMKEKIK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA IIG+LP  V  L+  TSP YM  L  DPRGH++L  AA +M IG++VMR
Sbjct: 259 ALSAEAVASALIIGALPPGVIVLISVTSPAYMQPLFTDPRGHLMLLAAAIWMGIGVLVMR 318

Query: 181 LMINFD 186
            MINF 
Sbjct: 319 KMINFK 324


>gi|170750193|ref|YP_001756453.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656715|gb|ACB25770.1| type II secretion system protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 325

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 94/186 (50%), Positives = 130/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL  KR AKF  + PNA+D++VR +R G+PV D   ++  ++ +PVRSEFR V+ETQ 
Sbjct: 139 LRHLRLKRIAKFNKELPNAVDVVVRGIRTGIPVGDCFRMVSREAEEPVRSEFRTVVETQA 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLSL E+ +R+   +P  EV+FF+ VI++Q Q GGNLSEAL NLS +LRDR  M+ KVQ
Sbjct: 199 MGLSLGEACTRLFERVPTAEVNFFAIVINIQQQSGGNLSEALNNLSTVLRDRAKMRGKVQ 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA II  LPF V+ +   TSP Y+++L     G + L  AA +M IGI  ++
Sbjct: 259 AMSMEAKASASIIACLPFAVAGITALTSPDYISLLWTTDTGKIALVGAAIWMSIGIFTIK 318

Query: 181 LMINFD 186
            MI F+
Sbjct: 319 KMIAFE 324


>gi|86147460|ref|ZP_01065772.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
 gi|85834753|gb|EAQ52899.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
          Length = 321

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  +P+  EF+      +
Sbjct: 135 VQNRVTYRMARFEEQLPEALDIIRRALQAGQPLVQSFNEVGEEMPEPIGVEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAIMQMTERAPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L  DPRG  ++ +    + IG + +R
Sbjct: 255 TLSAESRLSAWILTLSPFVLFFGLKFVNPEYIEPLYTDPRGISMVSIGVILLAIGALWIR 314

Query: 181 LMINFDV 187
            +IN ++
Sbjct: 315 KIINIEI 321


>gi|75674495|ref|YP_316916.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
 gi|74419365|gb|ABA03564.1| type II secretion system protein [Nitrobacter winogradskyi Nb-255]
          Length = 324

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R   FL   P+A+D+IVR ++AGLP+ +++ V+   S +P++SEF  +IETQ 
Sbjct: 138 LGFLKKRRETAFLRALPDAVDVIVRGIKAGLPLFESLKVVAADSPEPLKSEFAAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ SR+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K++
Sbjct: 198 IGMPLGEACSRLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L  +A +M  GI+VM+
Sbjct: 258 AVSMEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGSALWMTAGILVMK 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|300021858|ref|YP_003754469.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523679|gb|ADJ22148.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 332

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 89/186 (47%), Positives = 128/186 (68%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R AKF     NA+D++VR V++GLP+++ + VI  +S +P+  EFR V+E Q 
Sbjct: 146 VAKLTKRRQAKFTSHLANAIDVVVRGVKSGLPLNECLQVIARESPEPLAGEFRSVMEQQR 205

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L++++ RM   MPL EV F + VI++Q Q GGNLSEAL+NLS +LRDR+ +  KV+
Sbjct: 206 LGVPLADALDRMYDRMPLAEVRFLTIVIAIQQQAGGNLSEALSNLSGVLRDRQMLALKVK 265

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAKASA ++ SLP  V  +VY +SPGYM  L     G  ++ + A +M IG++VM+
Sbjct: 266 ALSAEAKASAMVLASLPPGVMFMVYMSSPGYMMPLFTTTPGRFMMALGATWMTIGVLVMK 325

Query: 181 LMINFD 186
            MINF 
Sbjct: 326 KMINFK 331


>gi|78186532|ref|YP_374575.1| TadB protein [Chlorobium luteolum DSM 273]
 gi|78166434|gb|ABB23532.1| TadB protein [Chlorobium luteolum DSM 273]
          Length = 322

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   F D  P ALD I R++RAG  ++ A+ ++  +  +P+  EF+ V +   
Sbjct: 136 LMQLADRRLRAFEDKLPEALDHISRALRAGHSLAPAMGMVGQEFGEPIGYEFKIVFDEIG 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+   E+I R+   M   +++FF   +++Q + GGNL+E    L+R +R R  ++ K++
Sbjct: 196 FGIPFKEAIGRLAERMQSTDLNFFVISLTIQHETGGNLTELFDGLARTIRHRIKLRGKIR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E +AS W++GS+PF +  ++   +P Y+++L    RG+ L+ + A  M +G +V++
Sbjct: 256 TLSSEGRASGWVLGSMPFVLMMVLSLINPEYISLLWTTSRGNNLMLIGAGLMSVGFVVLK 315

Query: 181 LMINFDV 187
            ++   V
Sbjct: 316 RIVQIKV 322


>gi|110632960|ref|YP_673168.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283944|gb|ABG62003.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 338

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 136/186 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R  +F ++F NA+D+IVR +++GLPV D + +I  ++ +PV+SEF  +++ Q 
Sbjct: 152 VASRRKRRFKQFTNEFSNAVDVIVRGLKSGLPVGDCLRIIAAEAQEPVKSEFVAIVQDQT 211

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL E++ R+   +PL E +FF+ V+ +QS+ GG+L+EAL NLS++LR+RK M AK++
Sbjct: 212 LGISLDEAVQRLWERVPLAEANFFAIVVGLQSRTGGSLAEALGNLSKVLRERKKMSAKIR 271

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIG+LPF VS  +Y TSP YM++L +   G ++L   A +M +GI+VMR
Sbjct: 272 AMSSEAKSSAGIIGALPFFVSAAIYLTSPDYMSLLFSTLTGKLVLAGCALWMGMGILVMR 331

Query: 181 LMINFD 186
            MINFD
Sbjct: 332 KMINFD 337


>gi|225181995|ref|ZP_03735427.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167280|gb|EEG76099.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 319

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 101/186 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   KR  KF D   +AL I+  S+RAG     A+  +  +   P+ +EF R ++   
Sbjct: 133 LKNAKMKRLQKFNDQLGDALGIMSNSLRAGFSFLQAMDSLSKELPPPISTEFGRALKEMR 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG    E+++ M   +   ++    T +++Q Q+GGNL+E L N+   + +R  MK +++
Sbjct: 193 LGTPTEEALANMTERIRSDDLDLIVTAVNIQRQVGGNLAEILDNIGNTISERVRMKGEIK 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+  LP  +  ++   +P Y+ +L   P G +L+G A    LIGIM+++
Sbjct: 253 TLTAQGRISGTIVALLPVFLVGVISVMNPSYIGLLFTHPLGLILIGGAVISELIGIMLIK 312

Query: 181 LMINFD 186
            +IN +
Sbjct: 313 KVINIE 318


>gi|325673437|ref|ZP_08153128.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
 gi|325555458|gb|EGD25129.1| type II secretion system protein [Rhodococcus equi ATCC 33707]
          Length = 623

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 104/186 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R A F D   ++L ++  ++RAG  +  A+  +  ++  P   EF R++    
Sbjct: 437 LRVMAGRRRAAFADQLDDSLQLLASNLRAGHSMLRALDSLSREAEVPTSEEFARIVNETR 496

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L+ES+  + R M   + ++ +  I++  ++GG+L+E L  +   +R+R  ++ +V+
Sbjct: 497 VGRDLNESLDDVARRMRSDDFNWIAQAIAINREVGGDLAEVLDQVGNTIRERNQIRRQVK 556

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+++ +LPF ++  +  ++P Y++ L     G++++ V    + +G + M 
Sbjct: 557 ALAAEGKLSAYVLMALPFGLTAFLLVSNPDYLSKLTGSAIGYVMIAVGLVMLTVGGLWMN 616

Query: 181 LMINFD 186
            +++  
Sbjct: 617 KVVSVK 622


>gi|219883049|ref|YP_002478213.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219862055|gb|ACL42396.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 309

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 99/186 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR  KF D   ++L ++   +RAG  +  AV  +  Q+  P   EF R++    
Sbjct: 123 LSFLAGKRRKKFADQLDDSLQLLSGGLRAGHSLQRAVDAVSQQAPSPTAEEFSRIMNETR 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L++++ +    M  ++ S+ S  I +  ++GG+L++ L  + R +R+R  ++ +V+
Sbjct: 183 IGRDLTDAMDQTAERMKSEDFSWVSQAIGIHREVGGDLADVLDQVGRTIRERNQIQRQVK 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E K SA+++ +LP  +  ++   SP Y+    + P G  ++      M +G + ++
Sbjct: 243 ALSAEGKMSAYVLMALPVLIIGVLAIISPSYIVSFGSSPLGWGMVAGGILMMTVGGLWLK 302

Query: 181 LMINFD 186
            +++F 
Sbjct: 303 KIVSFK 308


>gi|312139258|ref|YP_004006594.1| type ii secretion system integral membrane subunit [Rhodococcus
           equi 103S]
 gi|311888597|emb|CBH47909.1| putative type II secretion system integral membrane subunit
           [Rhodococcus equi 103S]
          Length = 622

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 104/186 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  +R A F D   ++L ++  ++RAG  +  A+  +  ++  P   EF R++    
Sbjct: 436 LRVMAGRRRAAFADQLDDSLQLLASNLRAGHSMLRALDSLSREAEVPTSEEFARIVNETR 495

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L+ES+  + R M   + ++ +  I++  ++GG+L+E L  +   +R+R  ++ +V+
Sbjct: 496 VGRDLNESLDDVARRMRSDDFNWIAQAIAINREVGGDLAEVLDQVGNTIRERNQIRRQVK 555

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+++ +LPF ++  +  ++P Y++ L     G++++ V    + +G + M 
Sbjct: 556 ALAAEGKLSAYVLMALPFGLTAFLLVSNPDYLSKLTGSAIGYVMIAVGLVMLTVGGLWMN 615

Query: 181 LMINFD 186
            +++  
Sbjct: 616 KVVSVK 621


>gi|218710399|ref|YP_002418020.1| Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
 gi|218323418|emb|CAV19595.1| Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
          Length = 321

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  DP+ +EF+      +
Sbjct: 135 VQNRVSYRMARFEEQLPEALDIIRRALQAGQPLIQSFNEVGEELPDPIGAEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAILQMAERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRSRFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   +P Y+  L NDPRG  ++ V    + IG + ++
Sbjct: 255 TLSAESRLSAWILTLSPFGLFFALKVANPDYIEPLYNDPRGVSMVSVGIVLLAIGALWIK 314

Query: 181 LMINFDV 187
            +I+ ++
Sbjct: 315 RIISIEI 321


>gi|85713509|ref|ZP_01044499.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699413|gb|EAQ37280.1| type II secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 324

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 92/186 (49%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R   FL   P+A+D+IVR ++AGLP+ +++ V+V  S +P++SEF  +IETQ 
Sbjct: 138 LGFLKQRRETAFLRALPDAVDVIVRGIKAGLPLFESLKVVVADSPEPLKSEFAAIIETQA 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E+ SR+   MP+ E +FF  VI++Q + GGNLSEAL NLS++LRDRK M  K++
Sbjct: 198 VGMPLGEACSRLYERMPVPEANFFGIVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLP  V  LVY ++P Y+ +L   P G ++L  +A +M  GI+VMR
Sbjct: 258 AVSTEAKASAAIIGSLPPIVMLLVYLSTPDYIALLWTHPTGRLMLAGSALWMSAGILVMR 317

Query: 181 LMINFD 186
            MINFD
Sbjct: 318 KMINFD 323


>gi|83859361|ref|ZP_00952882.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852808|gb|EAP90661.1| hypothetical protein OA2633_13190 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 331

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 128/187 (68%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K R  KF ++F +ALDIIVR V++GLP+++ + +I  +   PV+ EF+ ++E   
Sbjct: 145 LGMMRKGRQKKFTENFADALDIIVRGVKSGLPLNETLKIIAQEGEAPVKQEFQLLVEGLA 204

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E + RM R MPL E+SFF+TV+++Q + GGNL+EAL NLS +LR RK M+ KV 
Sbjct: 205 VGVDVEEGMRRMHRRMPLPELSFFTTVLAIQQKTGGNLAEALNNLSAVLRARKMMREKVS 264

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAKASAWIIGSLP  V  +V   SP YM  L+  P GH LL     +ML GI+VMR
Sbjct: 265 ALSSEAKASAWIIGSLPPGVGVMVSIMSPDYMTPLLTTPMGHFLLLGGGVWMLTGILVMR 324

Query: 181 LMINFDV 187
            MINF +
Sbjct: 325 SMINFKM 331


>gi|254293218|ref|YP_003059241.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041749|gb|ACT58544.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 331

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 90/183 (49%), Positives = 121/183 (66%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           I  R  KF   F + +D+IVR V++GLP+ + + +I  +S  P+ +EF+RVI+   +G +
Sbjct: 149 ISARQKKFTQQFSDGIDVIVRGVKSGLPLIECLRIIASESPAPLGTEFKRVIDAIQMGTT 208

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           + +S+S M   MPL EV+FF  VI +Q Q GGNLSEAL NLS +LR RK +  KV+ALS 
Sbjct: 209 VEKSLSNMYNRMPLPEVNFFGIVIGIQQQSGGNLSEALGNLSEVLRSRKMLAEKVKALSS 268

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           EAKASA IIG+LP  V  LVYF+SP Y+ +L   P GH +L V A  M  GI VM+ M+ 
Sbjct: 269 EAKASAMIIGALPIAVMILVYFSSPDYITLLFTHPTGHFMLMVGAGLMGAGIFVMKQMMK 328

Query: 185 FDV 187
            DV
Sbjct: 329 LDV 331


>gi|121534345|ref|ZP_01666169.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
 gi|121307115|gb|EAX48033.1| type II secretion system protein [Thermosinus carboxydivorans Nor1]
          Length = 324

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  +++RT  F D   +AL +I  S+R G     ++ ++  +   P+ +EF RV+   +
Sbjct: 138 LRVKVERRTKAFNDQLGDALILIANSLRTGYSFLQSIEMVSREMLPPIATEFARVLREMN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG++  E+++ + + +   ++    T + +Q Q+GGNL+E L N++  +R R  +K +++
Sbjct: 198 LGVTTEEALNNLAKRVDSDDLDLVVTAVLIQRQVGGNLAEVLENIAGTIRSRIKIKGEIK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +  ++Y  +PGYM +L   P G  L+  A    LIG++++R
Sbjct: 258 TLTAQGRISGVIIGLLPVALGLVIYALNPGYMQILFTHPLGRALVAGAIVSQLIGVLLIR 317

Query: 181 LMINFDV 187
            ++N DV
Sbjct: 318 RIVNIDV 324


>gi|15887569|ref|NP_353250.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155106|gb|AAK86035.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 334

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 109/187 (58%), Positives = 151/187 (80%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L+K+R  KFL++FPNALD++ RS+++GLP++DAV +I     +PV++EF+RV++ Q 
Sbjct: 148 LAFLLKRRQKKFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQ 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + + I RM+  MPL EVSFFS VI++Q+Q GGNLSEAL+NLSR+LRDR+ M+AKV 
Sbjct: 208 VGIGIPQGIERMMLTMPLFEVSFFSIVINIQAQAGGNLSEALSNLSRVLRDRRKMRAKVN 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V  LV+FTSP Y+++L  D RGH++LG +A +MLIGI +MR
Sbjct: 268 ALSMEAKASAVIIGALPFIVMLLVHFTSPDYLSILFTDTRGHLILGASAIWMLIGIFIMR 327

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 328 QMINFDI 334


>gi|82703470|ref|YP_413036.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411535|gb|ABB75644.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 323

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 102/184 (55%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             +KR  K     P  +D++ R+++AG   S A+ +      +P   EFR   +  + G+
Sbjct: 140 AKRKRLEKIERQLPEVIDLMARALKAGHAFSGALQMASTDGPEPAADEFRLTFDEINFGV 199

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+ +++  +   +P+ ++ +F   + +Q + GGNL+E L  +S ++R R  +  K++ LS
Sbjct: 200 SVQDALMNLATRVPITDLRYFVIAVLIQRESGGNLAELLDKISGLIRARLTLLGKIRVLS 259

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+  LPF  + ++   +PG++ VL  DP G M++G A   M+IGI VM  +I
Sbjct: 260 AEGRLSAWILSCLPFATALMINLVNPGFLTVLWTDPIGVMMVGTALGMMVIGIFVMSRII 319

Query: 184 NFDV 187
              V
Sbjct: 320 KIRV 323


>gi|16127171|ref|NP_421735.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|221235972|ref|YP_002518409.1| TadB-like pilus assembly protein [Caulobacter crescentus NA1000]
 gi|7208429|gb|AAF40196.1|AF229646_8 TadB [Caulobacter crescentus CB15]
 gi|13424567|gb|AAK24903.1| hypothetical protein CC_2941 [Caulobacter crescentus CB15]
 gi|220965145|gb|ACL96501.1| TadB-related pilus assembly protein [Caulobacter crescentus NA1000]
          Length = 325

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 89/186 (47%), Positives = 125/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K RT KF + F +A+DIIVR +++GLPV D + +I  +  +P+  EFR + E   
Sbjct: 139 LGFLAKGRTQKFTEAFADAVDIIVRGIKSGLPVHDCLKIIGKECPEPLAGEFRILTENVA 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ +  ++ +M   MP  E+ FF+ V+++Q + GGNL+EAL NLS +LR RK MK K++
Sbjct: 199 MGVPMDAALEKMYERMPTNELRFFAIVLAIQQKTGGNLAEALGNLSAVLRSRKLMKEKIK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA+IIG LP  V TL+  TSP YM  +  DPRGH++L  +A +M IGI VMR
Sbjct: 259 ALSAEAVASAFIIGCLPPGVVTLISVTSPAYMAPMFTDPRGHLMLLASAIWMSIGIFVMR 318

Query: 181 LMINFD 186
            MINF 
Sbjct: 319 NMINFK 324


>gi|118589707|ref|ZP_01547112.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
 gi|118437793|gb|EAV44429.1| hypothetical protein SIAM614_04685 [Stappia aggregata IAM 12614]
          Length = 340

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 89/186 (47%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R   FL++ PN +DIIVR V+AGLP+SD + V+  ++ DPV +EFR++ ETQ 
Sbjct: 154 VASKRKRRFNAFLEELPNGVDIIVRGVKAGLPLSDCIKVVAREARDPVATEFRKITETQI 213

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SL++++ ++   +PL E +FF+ V+++Q + GG L+EAL NLS++LR RK MK K++
Sbjct: 214 MGISLADAVGKLPERVPLPEANFFAIVVAIQQKAGGGLAEALNNLSKVLRGRKAMKRKIK 273

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAK+SA IIGSLPF V  ++Y  SP Y+ VL     G++++     +M  GIMVMR
Sbjct: 274 ALSAEAKSSAGIIGSLPFFVGGIMYLISPKYIMVLFETTAGNIIIAGGLFWMFCGIMVMR 333

Query: 181 LMINFD 186
            MINFD
Sbjct: 334 AMINFD 339


>gi|116671472|ref|YP_832405.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611581|gb|ABK04305.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 316

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 99/186 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R A+F     + L ++   +RAG  V  A+  +  ++S+P  +EF RV+    
Sbjct: 130 LSFLTQRRRARFEAQLGDTLTMVSGGLRAGHSVLRAIDAVAQEASEPTATEFSRVVNETR 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L +S++ +   M  ++ ++ +  I +  ++GG+L+E    +   +R+R  +K  V+
Sbjct: 190 LGRDLQDSLNDVSLRMKSEDFNWMAQAIEINREVGGDLAEVFDQVGETIRERSQIKGMVK 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E K SA I+ +LP  +  L+   +P Y   L   P G M+LG+A   M IG + +R
Sbjct: 250 ALSAEGKLSAIILMALPVLLFILIGLANPKYSGQLTGHPIGWMMLGIAVVMMTIGGLWIR 309

Query: 181 LMINFD 186
            + +  
Sbjct: 310 KISDLK 315


>gi|325291655|ref|YP_004277519.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059508|gb|ADY63199.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 334

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 107/187 (57%), Positives = 152/187 (81%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  ++K+R  KFL++FPNALD++ RS+++GLP++DAV +I     +PV++EF+RV++ Q 
Sbjct: 148 LGFILKRRQKKFLEEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQ 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + + I RM+  +PL EVSFFSTVI++Q+Q GGNLSEAL+NLS++LR+R+ M+AKV 
Sbjct: 208 VGIGIPQGIERMMLTVPLFEVSFFSTVINIQAQAGGNLSEALSNLSKVLRERRKMRAKVN 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LPF V  LV+FTSP Y++VL  D RGH++LGV+  +MLIGI +MR
Sbjct: 268 ALSMEAKASAVIIGALPFIVMLLVHFTSPDYLSVLFTDMRGHIILGVSGLWMLIGIFIMR 327

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 328 QMINFDI 334


>gi|299532600|ref|ZP_07045989.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719403|gb|EFI60371.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 329

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 114/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    +R  +     P ALD+I R++RAG   S ++ +   + ++P+  EFR V +  +
Sbjct: 143 LQRKRLQRLKRMERQLPEALDLIARALRAGHAFSASLQMAGEELTEPIAGEFRLVHDEIN 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G SL ++++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AKV+
Sbjct: 203 YGTSLHQALTNLGERVPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKVR 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS + + SAWI+G +PF ++ L+   +P +M+ L  DP G  +L   AA M+IG++++R
Sbjct: 263 VLSADGRMSAWILGLMPFGLAALLNLMNPEFMHPLWTDPIGISILKWLAALMVIGLLLLR 322

Query: 181 LMINFDV 187
            +    V
Sbjct: 323 RIARIRV 329


>gi|258621454|ref|ZP_05716488.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
 gi|258586842|gb|EEW11557.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
          Length = 232

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R ++F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      +
Sbjct: 46  LQKRIADRLSRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGKEMAAPIGLEFKNTFNLLN 105

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  F++ + +Q + GGNLSE L  + ++LR R  +  K++
Sbjct: 106 YGYDMRLAIMQMAERTPTVSMLAFASAVMLQKETGGNLSENLEKVGKVLRQRFKLTRKIK 165

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L  D RG  ++ V    +  G + +R
Sbjct: 166 TLSAESRLSAWILVLSPFVLFIGLMFINPDYVTPLYQDARGMEMVSVGMVSLFFGAIWIR 225

Query: 181 LMINFDV 187
            +I+F+V
Sbjct: 226 KIISFEV 232


>gi|113866737|ref|YP_725226.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113525513|emb|CAJ91858.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 325

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/185 (31%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  +      +A+D+I R++RAG   S A+ ++  +   P+  EFR   E  + G
Sbjct: 141 RQRAKRIKRMEAQLADAVDMISRALRAGHSFSGALGMVGQEMKAPIGPEFRTTFEEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ L
Sbjct: 201 VALDEAMTNLAIRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SAW++G LPF  + L+   +PG+M VL  DP G  ++G A   M  G++ MR +
Sbjct: 261 SAEGKMSAWVLGLLPFGTAGLILVVNPGFMKVLWEDPIGLRMIGGALVSMTFGVLWMRKI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|304392380|ref|ZP_07374321.1| type II secretion system protein [Ahrensia sp. R2A130]
 gi|303295484|gb|EFL89843.1| type II secretion system protein [Ahrensia sp. R2A130]
          Length = 332

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 89/186 (47%), Positives = 125/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   KKR A F   FPNA+D+IVR +++GLP++D + +I   S +PVR EFR++IE   
Sbjct: 146 VKRKRKKRFAAFTKTFPNAIDVIVRGIKSGLPLNDCLRIIATDSDEPVRGEFRKLIEAAQ 205

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + E+  R+ + +P  E +FFS VI++QS  GGNLSEAL NLS++LR+R+ M  K+Q
Sbjct: 206 MGIPVPEACERLYKSIPTSETNFFSIVIAIQSSAGGNLSEALGNLSKVLRERRKMADKIQ 265

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S EAK S  IIG+LPF V+ +V+ TSP Y+  L     GH +L   A  M  GI+VM+
Sbjct: 266 AFSSEAKTSTMIIGALPFVVAIMVFATSPYYLVPLWTTTGGHKVLFFCAVSMGFGILVMK 325

Query: 181 LMINFD 186
            MINF 
Sbjct: 326 KMINFK 331


>gi|94309585|ref|YP_582795.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353437|gb|ABF07526.1| flp pilus assembly protein TadB [Cupriavidus metallidurans CH34]
          Length = 325

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/185 (32%), Positives = 107/185 (57%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L  KR  +     P+A+D+I R++RAG   + A+ ++  +   P+  EFR   E  + G
Sbjct: 141 RLRTKRLKQMEVQLPDAVDMISRALRAGHSFAGALGMVGQEIKAPLGPEFRTTFEEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  +  K++ L
Sbjct: 201 VALDEAMTNLAMRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGTMVRERLKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LPF  + L+   +PG+M VL  DP G  ++G A   M+ G++ MR +
Sbjct: 261 SAEGRLSAWILGLLPFGTAGLIMVVNPGFMRVLWEDPIGWRMVGAAMTSMIFGVLWMRKI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|220913394|ref|YP_002488703.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860272|gb|ACL40614.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 310

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 94/186 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR A F     + L ++   +RAG  +  A+     +S  P   E RRVI    
Sbjct: 124 VGFLAGKRRAAFDGQLGDTLQLLSGGLRAGHSILRAIDAAAAESQKPTSEEMRRVITETS 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  +++     M  ++  + S  I +  ++GGNL++ L  ++  +R+R  +K  ++
Sbjct: 184 LGRDLLAALNDTADRMKNEDFVWISQAIQINREVGGNLADVLDQVNETIRERAEIKGHIK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+I+ ++PF +  ++   SP YMN +   P G  ++  +   M +G + MR
Sbjct: 244 ALAAEGKFSAYILIAMPFGIVAMLLAVSPTYMNSMFTHPLGWAMIVASFVLMTVGALWMR 303

Query: 181 LMINFD 186
            +I+  
Sbjct: 304 KIIDLK 309


>gi|114568974|ref|YP_755654.1| type II secretion system protein [Maricaulis maris MCS10]
 gi|114339436|gb|ABI64716.1| type II secretion system protein [Maricaulis maris MCS10]
          Length = 327

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 85/187 (45%), Positives = 126/187 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R  +F  +F NALD+I R V++GLP+++ + ++  +S +PV++EF +++E   
Sbjct: 141 LGFLRGRRQKQFSGEFANALDVITRGVKSGLPLNECLKILSVESPEPVKTEFAKLVEGIA 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SL + + RM   MPL E++FF TV+ +Q + GGNL+E L NLS +LR RK M+ K+ 
Sbjct: 201 VGVSLPDGLDRMCERMPLPELNFFRTVLIIQQKTGGNLAETLGNLSVVLRSRKMMREKIG 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAK+SA IIGSLP  V  +VY T+P YM  +   P G ++L     +M IGIMVMR
Sbjct: 261 ALSSEAKSSAAIIGSLPPGVMGIVYATTPSYMGQMFTHPTGQLMLLGGLTWMFIGIMVMR 320

Query: 181 LMINFDV 187
            MINF +
Sbjct: 321 GMINFKI 327


>gi|325964125|ref|YP_004242031.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470212|gb|ADX73897.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 310

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 95/186 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR A F     + L ++   +RAG  +  A+     +S  P   E RRVI    
Sbjct: 124 LGFLAGKRRAAFDSQLGDTLQLLSGGLRAGHSILRAIDAAAAESQKPTSEEMRRVITETS 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  +++     M  ++  + S  I +  ++GGNL++ L      +R+R  +K  ++
Sbjct: 184 LGRDLLAALNDTAERMQNEDFVWISQAIQINREVGGNLADVLDQTGETIRERSEIKGHIK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+I+ ++PF +  ++   SP YMN + + P G  ++GV+   M IG + MR
Sbjct: 244 ALAAEGKFSAYILIAMPFGIVAMLVAMSPTYMNSMFSHPLGWAMIGVSFVLMTIGALWMR 303

Query: 181 LMINFD 186
            +I+  
Sbjct: 304 KIIDLK 309


>gi|53723214|ref|YP_112199.1| hypothetical protein BPSS2197 [Burkholderia pseudomallei K96243]
 gi|126444529|ref|YP_001064083.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126455490|ref|YP_001076996.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167725255|ref|ZP_02408491.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei DM98]
 gi|167744182|ref|ZP_02416956.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 14]
 gi|167821381|ref|ZP_02453061.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 91]
 gi|167829723|ref|ZP_02461194.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 9]
 gi|226194129|ref|ZP_03789729.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237509857|ref|ZP_04522572.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|242313100|ref|ZP_04812117.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|52213628|emb|CAH39682.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|126224020|gb|ABN87525.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126229258|gb|ABN92671.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|225933822|gb|EEH29809.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002062|gb|EEP51486.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|242136339|gb|EES22742.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
          Length = 325

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 141 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ L
Sbjct: 201 VSLQEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|114798049|ref|YP_761687.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738223|gb|ABI76348.1| secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 90/187 (48%), Positives = 127/187 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK R  K ++ F +ALDIIVR VR+GLP+++ + VI  +S +P+R EF    +   
Sbjct: 153 LNFLIKGRHTKMINQFADALDIIVRGVRSGLPLNECIRVIAKESPEPLRKEFLTFADNLA 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L  S++ + + +PLQE++FF+ V+ +QS+ GGNLSEAL NLS ++R RK M+ KV+
Sbjct: 213 MGAGLERSLAALYKRLPLQEINFFAIVLIIQSKAGGNLSEALHNLSTVIRSRKMMREKVK 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAKASA IIGSLP  V  +V+ T+P Y+  L     GH++L VA   M  GI VMR
Sbjct: 273 ALSSEAKASAMIIGSLPIAVGVMVFLTTPDYIMTLFTTETGHVILVVAVGMMGSGITVMR 332

Query: 181 LMINFDV 187
            M+NFD+
Sbjct: 333 NMMNFDM 339


>gi|134281818|ref|ZP_01768525.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|167908137|ref|ZP_02495342.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei NCTC
           13177]
 gi|134246880|gb|EBA46967.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 325

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 141 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ L
Sbjct: 201 VSLQEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGMLLVGVTIASMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|56477521|ref|YP_159110.1| putative Flp pilus assembly protein [Aromatoleum aromaticum EbN1]
 gi|56313564|emb|CAI08209.1| putative Flp pilus assembly protein [Aromatoleum aromaticum EbN1]
          Length = 324

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 100/185 (54%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +   +F    P ALD++ R++RAG     A+ ++  +  DP+  EFR + +  + G
Sbjct: 140 RARNQHMQRFELQLPEALDLMGRALRAGHAFPTAIKMVAEEMKDPIGGEFRILFDEMNYG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +    ++  +       ++S+F   + +Q   GGNL+E L N+S+I+R R  +  +++ L
Sbjct: 200 VPQQTAMLNLASRTDSTDLSYFVIAVLIQRDSGGNLAELLDNISKIVRARLKLYGEIRTL 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SAWI+G LPF  + L+   +PG+M VL  DP G   +  A   M++G++ MR +
Sbjct: 260 SAEGKLSAWILGCLPFATAALINIVNPGFMKVLWEDPAGINFIYGAMGMMVLGVVWMRKI 319

Query: 183 INFDV 187
           I   V
Sbjct: 320 IRIRV 324


>gi|76818607|ref|YP_336474.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 1710b]
 gi|167851190|ref|ZP_02476698.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei B7210]
 gi|167899820|ref|ZP_02487221.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 7894]
 gi|167916484|ref|ZP_02503575.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 112]
 gi|167924341|ref|ZP_02511432.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei BCC215]
 gi|254187128|ref|ZP_04893643.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254263188|ref|ZP_04954053.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|254296490|ref|ZP_04963946.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|76583080|gb|ABA52554.1| Flp pilus assembly protein TadB [Burkholderia pseudomallei 1710b]
 gi|157806462|gb|EDO83632.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934811|gb|EDO90481.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254214190|gb|EET03575.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 325

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 141 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ L
Sbjct: 201 VSLQEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|296122168|ref|YP_003629946.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014508|gb|ADG67747.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 321

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR  +F    P+A++++ R++R+G  ++  + ++  +   P+   FR   ETQ+
Sbjct: 135 LSFRRKKRFKQFAKQLPDAMELMGRALRSGHSLASGLHLVCDEMPPPISQVFRSAYETQN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ +  ++   ++ MP  +  FF T +++Q Q GG+L+E L  +S ++R+R  +   VQ
Sbjct: 195 LGVPVESALKESLKKMPNLDYKFFVTAVAIQRQTGGDLAEILDKISEVIRERFKILGTVQ 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E + S  ++ ++P  +   VY+ +P Y+ VL     G  ++ V     ++G + ++
Sbjct: 255 ALTGEGRLSGAVLMAMPIAIFFAVYYLNPNYVMVLFTTDLGKKMIAVGIVMQILGAVAIK 314

Query: 181 LMINFDV 187
            +I+  V
Sbjct: 315 KIIDIKV 321


>gi|73542333|ref|YP_296853.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119746|gb|AAZ62009.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 325

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR  +     P+A+D+I R++RAG   S A+ ++  +   P+  EFR   E  +
Sbjct: 139 IMRLRAKRIQQMESQLPDAVDMIARALRAGHSFSGALGMVGQEMKAPIAPEFRTTFEEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G++L E+++ +   +P+ ++ +F   + +Q + GGNL+E L  +  ++R+R  + AK++
Sbjct: 199 YGIALDEAMTNLAIRVPVGDLRYFVIAVLIQRESGGNLAEILDTIGNMVRERLKLFAKIR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAW++G LPF    ++   +P +M VL  DP G  ++G A   M++G++ MR
Sbjct: 259 VLSAEGRMSAWVLGLLPFATGGMILVVNPDFMKVLWEDPIGLKMVGAAVGMMMLGVLWMR 318

Query: 181 LMINFDV 187
            +I   V
Sbjct: 319 KIIRIRV 325


>gi|329847257|ref|ZP_08262285.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842320|gb|EGF91889.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 337

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 81/186 (43%), Positives = 123/186 (66%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +   R  KF ++FPNA+DI+VR +++GLPV D + +I  +S  P+  EF R++E   
Sbjct: 151 LGMMATGRLKKFTEEFPNAMDILVRGIKSGLPVHDGLKIISKESPAPLGPEFLRLVENVG 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+S+  ++ +M   +P  E+ FF+ VI++Q++ GGNL+EAL NLS +LR RK M+ K++
Sbjct: 211 VGMSVEGALEKMSERIPSPELRFFTIVIAIQAKTGGNLAEALNNLSTVLRARKMMREKIK 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA IIG LP  V  ++  T P Y+  +  DPRG ++L   A +M +GI +MR
Sbjct: 271 ALSSEAIASASIIGVLPPGVGVMISLTRPEYIGGMFTDPRGQIMLLGGAIWMALGIFMMR 330

Query: 181 LMINFD 186
            MINF 
Sbjct: 331 KMINFK 336


>gi|149186258|ref|ZP_01864572.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
 gi|148830289|gb|EDL48726.1| hypothetical protein ED21_31014 [Erythrobacter sp. SD-21]
          Length = 323

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 118/187 (63%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IKKRT +F   F +A++++VR +R+GLPV++ + V+  +   PV  EF+ ++E   
Sbjct: 137 VGRAIKKRTNQFNVKFADAIELLVRGLRSGLPVTETLNVVSQEIPGPVGEEFKSIVERIK 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ ES+      + + E +FF   +++Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 197 IGRTMEESLQETADRLGIPEFNFFCITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+GSLPF V  L+++ +P Y+     D R  +       +M IG+ +M 
Sbjct: 257 AMSSESKASAYIVGSLPFIVFGLIFWINPEYLGGFFTDDRLIVTGLGGLTWMGIGVFIMA 316

Query: 181 LMINFDV 187
            M++F++
Sbjct: 317 KMVSFEI 323


>gi|311743552|ref|ZP_07717358.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
 gi|311312682|gb|EFQ82593.1| type II secretion system protein [Aeromicrobium marinum DSM 15272]
          Length = 314

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 94/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    KR  +F       L ++  S+RAG     A+      +  P++ E  R++    
Sbjct: 128 VKMRTAKRRREFNAQLDGMLQMLASSMRAGQSFQQAMGSCARDADSPMQDELTRILNENR 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  +  S++     M  ++  + +  + +  + GGNL+E +  +++++RDR  ++ KV 
Sbjct: 188 LGRDIIASMNDTAERMECEDFVWLAEAVELTRESGGNLNEIIDRVAQMIRDRSEIREKVH 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + E + S++I+ SLP  ++    F +PGY++ L +   G  L+G +     I  + MR
Sbjct: 248 AYASEGRFSSYILMSLPLLIAVAYSFITPGYLDPLFSTGLGLALVGGSVVMYTIAFLWMR 307

Query: 181 LMINFDV 187
           ++++  V
Sbjct: 308 IIVDIKV 314


>gi|167648148|ref|YP_001685811.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350578|gb|ABZ73313.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 325

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 87/186 (46%), Positives = 129/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K RT KF + F +A+DIIVR +++GLPV+D + +I  +  +P+  EFR ++E   
Sbjct: 139 VGMMAKARTKKFTEAFSDAIDIIVRGIKSGLPVNDCLKIIGKECPEPLAGEFRVLVENTG 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+S+ +++ RM   MP  E+ FF+ V+++Q++ GGNL+EAL NLS +LR RK M  K++
Sbjct: 199 MGMSMDQALERMYERMPTNELRFFTIVLTIQAKTGGNLAEALGNLSTVLRARKLMGEKIK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA+IIG+LP  V  L+  T+P YM  +  D RGH++L VAA +M +GI VMR
Sbjct: 259 ALSAEAVASAFIIGALPPGVVILISVTAPTYMAPMFTDQRGHLMLMVAAFWMTVGIFVMR 318

Query: 181 LMINFD 186
            MINF 
Sbjct: 319 KMINFK 324


>gi|239908017|ref|YP_002954758.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239797883|dbj|BAH76872.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 326

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 114/185 (61%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR A F    P AL+++ R++RAG   +  + ++V + +DP+R EF+  +E  + G
Sbjct: 142 MRKDKRMADFERQLPEALELVGRALRAGHTFTSGMGMVVSEFADPIRVEFQTTLEEINFG 201

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + ++ ++  ++  +   +++FF   + +Q++ GGNL+E + N+S ++R+R  +K ++Q L
Sbjct: 202 MGVTTALDNLMDRVDCPDLNFFVVSVKIQNESGGNLAEIIGNISGLIRERFKLKGRIQVL 261

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +AW++  LPF V+ ++ F +PGY+ +L  DP G ++    A  + +GI+V+R M
Sbjct: 262 SAEGRMAAWVLCLLPFGVAAVIQFVNPGYLGLLFTDPMGRIMSYGVAGLITMGILVIRKM 321

Query: 183 INFDV 187
           +  +V
Sbjct: 322 VRIEV 326


>gi|217424158|ref|ZP_03455657.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|254192376|ref|ZP_04898815.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|169649134|gb|EDS81827.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|217392623|gb|EEC32646.1| type II secretion system protein [Burkholderia pseudomallei 576]
          Length = 330

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 146 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 205

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ L
Sbjct: 206 VSLQEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVL 265

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +
Sbjct: 266 SAEGKLSALILTLLPFGTAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHI 325

Query: 183 INFDV 187
           I   V
Sbjct: 326 IRIRV 330


>gi|260462612|ref|ZP_05810818.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031518|gb|EEW32788.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 324

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 110/186 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR  KF    P+ALD+IVRS+RAG P + A+ ++  +  DP+ +EF  V +   
Sbjct: 138 LRRARNKRIQKFAAQLPDALDMIVRSLRAGHPTTVAIGLVAREMPDPLGTEFGIVSDEIT 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GLSL +++ ++ + +  + +   S  +S+Q++ GGNL+E LANLS +LR+R+ ++ K++
Sbjct: 198 FGLSLEQAVRKLSQRVGFEGLHLLSVSLSIQAKTGGNLTEILANLSSVLRERRKLRMKIK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWII   P  +  ++   +P +   + + P    +  +   + L+G  +M 
Sbjct: 258 ALSAEGRMSAWIISLFPVVMFGILLLVAPKFYGEVWDSPLILPVFVIFGLWALLGDFIMY 317

Query: 181 LMINFD 186
            M+NFD
Sbjct: 318 RMVNFD 323


>gi|304320651|ref|YP_003854294.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
 gi|303299553|gb|ADM09152.1| hypothetical protein PB2503_05392 [Parvularcula bermudensis
           HTCC2503]
          Length = 330

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 85/187 (45%), Positives = 128/187 (68%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF ++F NA+D+IVR V++GLPV++ + +I   +  PV+ EF+ ++E Q 
Sbjct: 144 LYQTRRKRQKKFENEFSNAIDVIVRGVKSGLPVNECLKIISRDAQSPVKEEFQLLVEGQR 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L +S+ R+   MP+ +V+FF+ V+ +Q Q GGNL++AL NLS +LR RK M  K+ 
Sbjct: 204 IGLTLEQSLERLYNRMPISDVNFFAIVLVIQQQTGGNLADALGNLSTVLRSRKTMLGKIA 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA I+ ++PF VS LVY  +P Y+  L +   G  +L  A  +MLIGI+VM+
Sbjct: 264 ALSMEAKASAAILAAMPFFVSGLVYLAAPDYIAPLFSTQTGQFMLMGAGMWMLIGIVVMK 323

Query: 181 LMINFDV 187
            MI+  V
Sbjct: 324 NMISIKV 330


>gi|317123666|ref|YP_004097778.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315587754|gb|ADU47051.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 652

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 96/172 (55%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
            P +L ++  S+R+G  +  A+  I   + DP+  EF R +    +G  +++++ RM   
Sbjct: 481 LPQSLMLVSTSLRSGFGLPQALDSIAKDAPDPLAKEFSRGLAETRIGTDIADALERMADR 540

Query: 76  MPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGS 135
           M  + +      I +Q ++GGNL+E L   +R LR+R+++  +V+ALS E + SA+I+ +
Sbjct: 541 MGSRSMRMAVMAIRIQREVGGNLAETLETTARTLRERESLHRQVRALSAEGRLSAYILIA 600

Query: 136 LPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           LP  +   + + + GY+++L   P G M+L      ++ GI  MR ++  +V
Sbjct: 601 LPIGLFFYMMWVNYGYISLLWTHPLGLMMLVGGIVLLIGGIFWMRQVVKIEV 652


>gi|149911402|ref|ZP_01900020.1| hypothetical Flp pilus assembly protein TadB [Moritella sp. PE36]
 gi|149805510|gb|EDM65515.1| hypothetical Flp pilus assembly protein TadB [Moritella sp. PE36]
          Length = 321

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I KR  +    FP ALDI+ R ++AG   SD++ ++  +    +  EF+ +    +
Sbjct: 135 LNRNINKRMERIEQQFPEALDILKRGLQAGYAFSDSIKLVYEELEGELSDEFKLMFNRIN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  ++   V+ +P      F + +S+  + GGNL+E + NLSRI+R R   K +V+
Sbjct: 195 FGNDVHTALLSFVKRVPSTSAMAFCSSVSIHKETGGNLAENIDNLSRIIRQRFTFKRRVK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + S W++   PF +  ++Y +SP Y ++LIN P G  LL      ML+GI  + 
Sbjct: 255 TLSAEGRLSGWVLVLTPFVLFAVLYISSPDYASILINTPEGLNLLKWGGIGMLLGIWWIS 314

Query: 181 LMINFDV 187
            +I  +V
Sbjct: 315 KLIKIEV 321


>gi|317122044|ref|YP_004102047.1| type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
 gi|315592024|gb|ADU51320.1| Type II secretion system F domain [Thermaerobacter marianensis DSM
           12885]
          Length = 401

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R   F    P+AL ++  ++++G     A  V+  +   P+  EF  +++   
Sbjct: 215 VARRYRQRLQAFDAQLPDALTLMANALKSGYSFLQAADVVAREMPAPIAEEFGWLVKETR 274

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           + + L ++++ ++  +P  ++    T + +Q Q+GGNL+  L   +  +R+R  ++ +++
Sbjct: 275 VNIPLEDALANLLDRVPSPDLDLVVTAVLIQKQVGGNLAGVLERTAETIRERVRLQGQIR 334

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S WI+GSLP  +  L+   +P Y+  L+  P G MLLG      + G++V+R
Sbjct: 335 TLTAQGRLSGWIVGSLPVALLVLLSAMNPAYLQPLLATPVGWMLLGAGVVMEVAGVLVIR 394

Query: 181 LMINFDV 187
            +I  D+
Sbjct: 395 ALIRVDI 401


>gi|168702878|ref|ZP_02735155.1| secretion system protein TadB [Gemmata obscuriglobus UQM 2246]
          Length = 319

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R   F    P+A++++ R++RAG  ++  + V+  +   P+  EF RV E Q+
Sbjct: 133 LHMKRSSRLKAFAAQLPDAMELVARALRAGHSLAAGMHVVAEEMPAPICKEFGRVYEEQN 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  M   +P  ++ FF T +++Q Q GG+L+E L  +  I+R+R  +  +V+
Sbjct: 193 LGIPLEEALKGMCDRVPNLDLKFFVTSVAIQRQTGGDLAEILDRIGHIIRERFKILGQVK 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E + S  ++ +LP  +  ++ +T P Y+ +L  D  G  +   A   MLIG   ++
Sbjct: 253 ALTAEGRLSGVVLIALPIGLFVMMLWTKPDYVEMLWKDDLGIKMSIGAIVLMLIGSYAIK 312

Query: 181 LMINFDV 187
            +++  V
Sbjct: 313 KIVDIKV 319


>gi|78186666|ref|YP_374709.1| TadB protein [Chlorobium luteolum DSM 273]
 gi|78166568|gb|ABB23666.1| TadB protein [Chlorobium luteolum DSM 273]
          Length = 322

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 60/176 (34%), Positives = 103/176 (58%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F D  P ALD I RS+RAG  ++ A+ ++  +  DP+  EF+ V +    G+   ++I  
Sbjct: 147 FGDKLPEALDYISRSMRAGHSLTSAIGMLGTEFRDPIGHEFKTVFDEIGFGIPFKDAIGE 206

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           +   +   +++FF   + +Q + GGNL+E L  LS  +R R  ++ K++ LS E +ASAW
Sbjct: 207 LADRVQSTDLNFFVISLQIQHETGGNLTELLDGLSNTIRQRIKLRGKIRTLSSEGRASAW 266

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           ++GS+PF +  ++   +PGY++VL   P GH L   A   M +G  +++ ++NF V
Sbjct: 267 VLGSMPFALVAILTLINPGYISVLWTTPEGHKLTLSALGLMSVGFFLLKRIVNFKV 322


>gi|254506705|ref|ZP_05118845.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
 gi|219550286|gb|EED27271.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
          Length = 322

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 63/187 (33%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I  R A F +  P ALDI+ R ++AG PV+ A   +  +  DP+ +EF+      +
Sbjct: 136 LNKRISDRLASFEEQLPEALDIMRRMLQAGQPVTQAFNEVGNEMPDPIGTEFKNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  +S++LR R  ++ K++
Sbjct: 196 FGYDMRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSKVLRSRFKLQRKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L  DPRG  L+      + IG + +R
Sbjct: 256 TLSAESRLSAWILVLSPFLLFLFLTFINPSYVEPLYTDPRGMTLVSGGIISLFIGSIWIR 315

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 316 NIINFEV 322


>gi|254182576|ref|ZP_04889170.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|184213111|gb|EDU10154.1| type II secretion system protein [Burkholderia pseudomallei 1655]
          Length = 330

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 109/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 146 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 205

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +   +P+ ++ +F   + +Q + GGNL+E L  +++++R+R  +  K++ L
Sbjct: 206 VSLQEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIAQLIRERFKLFDKIRVL 265

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  DP G +L+GV  A M  GI+ MR +
Sbjct: 266 SAEGKLSALILTLLPFATAALLSIMNPDFISVLWEDPAGVLLVGVTIASMAFGILWMRHI 325

Query: 183 INFDV 187
           I   V
Sbjct: 326 IRIRV 330


>gi|99082190|ref|YP_614344.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038470|gb|ABF65082.1| hypothetical protein TM1040_2350 [Ruegeria sp. TM1040]
          Length = 322

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR AK  +  P+ ++++VRS+R G P S AV ++  +  DP+ +EF  + +   
Sbjct: 136 VNSKAKKRMAKIEEQLPDGVELMVRSLRVGHPFSSAVQIVAKEVEDPLATEFGIIADECA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P  V      + P Y + +I+ P       +    +   I VMR
Sbjct: 256 AITAEAQWSGKFLSGFPLFVLAGTLVSDPHYYDNVIDHPWFMPACFIVGGMLTANIFVMR 315

Query: 181 LMINFDV 187
            + N  V
Sbjct: 316 KLTNIQV 322


>gi|239814536|ref|YP_002943446.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239801113|gb|ACS18180.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 330

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 64/187 (34%), Positives = 110/187 (58%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H   +R A      P+ALD++ R++RAG   + +V +I  + S+P+  EFR V +   
Sbjct: 144 LNHRRSRRLAHLERQLPDALDLVTRALRAGHSFASSVQMIGDEMSEPIAGEFRMVADEVG 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL ++++ M   +PL ++ +F   + +Q   GGNL+E L NLSR++RDR  + A+V+
Sbjct: 204 FGVSLQQALTNMSERVPLTDLRYFVVSVLIQRDSGGNLTEVLGNLSRLIRDRLKLLARVR 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G +PF +  L+   +P +M+ L  DP G   +      M+IG +++R
Sbjct: 264 VLSAEGRLSAWILGLMPFALVALLNAFNPEFMSPLWTDPIGITAVKYMLGLMVIGAVILR 323

Query: 181 LMINFDV 187
            ++   V
Sbjct: 324 KIVKIRV 330


>gi|323499917|ref|ZP_08104876.1| Flp pilus assembly protein TadB [Vibrio sinaloensis DSM 21326]
 gi|323315158|gb|EGA68210.1| Flp pilus assembly protein TadB [Vibrio sinaloensis DSM 21326]
          Length = 322

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 63/187 (33%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I  R ++F +  P ALDI+ R ++AG PV+ A   +  +  DP+ +EF+      +
Sbjct: 136 LNKRISDRLSQFEEQLPEALDIMRRMLQAGQPVTQAFNEVGNEMPDPIGTEFKNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  +SR+LR R  ++ K++
Sbjct: 196 FGYDMRMAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVSRVLRSRFKLQRKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   +P Y+  L  DPRG  L+      + IG M +R
Sbjct: 256 TLSAESRLSAWILVLSPFLLFLFLSIINPTYVEPLYTDPRGMTLVSGGIVSLFIGSMWIR 315

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 316 NIINFEV 322


>gi|307943149|ref|ZP_07658494.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773945|gb|EFO33161.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 340

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR   F+++ PN +DIIVR V+AGLP+ D V V+  ++ DPV +EF +++ETQ 
Sbjct: 154 INRRRKKRFTAFMEELPNGVDIIVRGVKAGLPLGDCVRVVSTEAKDPVSTEFAKILETQK 213

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SL+E+  ++   +PL E +FF+ V+++Q   GG LSEAL NLSR+LR RK +K K+ 
Sbjct: 214 MGVSLAEAFMKLPERVPLPEANFFAIVVAIQQSSGGGLSEALNNLSRVLRGRKALKRKIV 273

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAK+SA IIG++P  +S  ++F +P Y+N+L+    GH+++     +MLIGI+VMR
Sbjct: 274 ALSSEAKSSAGIIGAMPVLISLALFFIAPDYINILLTTTAGHIVIAGCITWMLIGILVMR 333

Query: 181 LMINFD 186
            MINFD
Sbjct: 334 QMINFD 339


>gi|27365113|ref|NP_760641.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|37680836|ref|NP_935445.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|320155496|ref|YP_004187875.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|27361259|gb|AAO10168.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|37199585|dbj|BAC95416.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|319930808|gb|ADV85672.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 321

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  +F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      +
Sbjct: 135 LQKRITDRLNRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGNEMAPPIGIEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  FS+ + +Q + GGNLSE L  + ++LR R  +  K++
Sbjct: 195 YGYDMRLAIMQMAERTPTVSMLAFSSAVLLQKETGGNLSENLEKVGKVLRQRFKLTRKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAWI+   PF +   + F +P Y+  L  D RG  L+ +    +  G + +R
Sbjct: 255 TISAESRLSAWILVLSPFVLFVGLMFINPEYVKPLYQDERGMELVTMGIVSLFFGAIWIR 314

Query: 181 LMINFDV 187
            +INF+V
Sbjct: 315 NIINFEV 321


>gi|220922535|ref|YP_002497837.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947142|gb|ACL57534.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 314

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M +L ++R A F +  P  L+I+VRS+RAG P+  A  +   Q  DP  SE     +   
Sbjct: 128 MYYLRRRRVAAFGEQLPELLEIMVRSLRAGHPLVVAFTLAAKQMPDPAGSEIGITADEIG 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  ++  + R +  +++ FF+T +++Q+Q GGNL+E LA L+ +LR+R  ++ +V+
Sbjct: 188 YGRDVGAALYNLYRRVGFEDLRFFATAVTIQAQTGGNLAEILARLATLLRERARLRQRVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA  +   PF ++ L+   +P Y   +  +P   + L VA   ++IG +V+ 
Sbjct: 248 ALSAEGRLSALALSLFPFLLAGLITLLNPDYYGSVWGNPLFDLALTVAGGMLIIGNIVLY 307

Query: 181 LMINFDV 187
            ++NF +
Sbjct: 308 RIVNFRI 314


>gi|221067369|ref|ZP_03543474.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220712392|gb|EED67760.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 329

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 62/187 (33%), Positives = 114/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    +R        P ALD+I R++RAG   S  + +   + S+P+  EFR V +  +
Sbjct: 143 LQRKRNQRLGLLERQIPEALDLIARALRAGHAFSAGLQMAGEELSEPIAGEFRLVHDEIN 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G SL ++++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AK++
Sbjct: 203 YGTSLQQALNNLGERIPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKIR 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G +PF ++ L+ F +P +M+ L  DP G ++L   A  M+IG++++R
Sbjct: 263 VLSSEGRMSAWILGLMPFALAALLNFVNPEFMSTLWTDPIGIVILQWLAGLMVIGMLMLR 322

Query: 181 LMINFDV 187
            ++   V
Sbjct: 323 RIVRIRV 329


>gi|261856882|ref|YP_003264165.1| type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
 gi|261837351|gb|ACX97118.1| Type II secretion system F domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 284

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 98/185 (52%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L ++R  K     P+ L ++  S+RAGL  + A+  +   +  P+  EF  V+  Q +G
Sbjct: 100 WLKQRRIDKIQQQLPDGLMMVSGSMRAGLGFTAALESLARDTDPPLAQEFALVLREQRMG 159

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L +++      +P+Q+V+ F + +++  ++GGNL+E+L +L+  LR R  M+ KV++L
Sbjct: 160 VKLEDALLHFNDRVPVQDVTLFVSAVNISREVGGNLAESLTSLASTLRRRLIMEGKVKSL 219

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + +    ++  +P  + T +    P  M+ L + P G  ++ VA     +G  +   +
Sbjct: 220 TAQGRLQGIVMALMPVGLLTFLTLAYPDTMHDLYHTPLGWGIIAVAVVMEYLGYRMSLKI 279

Query: 183 INFDV 187
           +  D+
Sbjct: 280 VTIDI 284


>gi|87312289|ref|ZP_01094387.1| secretion system protein TadB [Blastopirellula marina DSM 3645]
 gi|87284993|gb|EAQ76929.1| secretion system protein TadB [Blastopirellula marina DSM 3645]
          Length = 320

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 65/187 (34%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K R AKF    P+AL++I R++RAG  +     ++  +S DP+  EF +V E Q+
Sbjct: 134 VHFKRKARLAKFGKQLPDALELISRALRAGHSLGAGFRLVSEESDDPIGREFAKVFEAQN 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++I+ M   +P  ++ FF T I +Q Q GG+L+E L  + R++R R  +   +Q
Sbjct: 194 LGVSLEDAITDMTERVPNLDLKFFGTAIILQRQTGGDLAEILDKIGRLVRQRLELFGTIQ 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E + S  ++  LP  +   ++  +PGY+  L  DP G+ +L VA    LIG  V++
Sbjct: 254 ALTGEGRISGIVLLGLPPALFVALWRLNPGYVMTLFTDPLGNKMLAVAIVMQLIGAWVIQ 313

Query: 181 LMINFDV 187
            +I+  V
Sbjct: 314 KIIDIKV 320


>gi|303248307|ref|ZP_07334569.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490332|gb|EFL50244.1| Type II secretion system F domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 326

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 113/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  +F    P ALD++ R++RAG   +  + ++V + ++P+ SEFR  +E  +
Sbjct: 140 IAMRKAKRMTEFERQLPEALDLVGRALRAGHTFTSGMGMVVSEFAEPISSEFRTTLEEIN 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ ++ ++  ++  +   +++FF   + +Q++ GGNL+E + N++ ++R+R  +K +++
Sbjct: 200 FGMGVTVALDNLMDRVDCPDLNFFVISVKIQNETGGNLAEIIGNIASLIRERLKLKGRIR 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + +AW++  LPF V   V   +PGY+ +L  +P G +L+ V    M +G++V+R
Sbjct: 260 VLSAEGRMAAWVLCLLPFFVCGAVQVLNPGYLGLLFTEPLGRILIYVVMGLMTLGVLVIR 319

Query: 181 LMINFDV 187
            M+  +V
Sbjct: 320 KMVRIEV 326


>gi|167842455|ref|ZP_02469139.1| Flp pilus assembly protein TadB [Burkholderia thailandensis MSMB43]
          Length = 325

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/185 (32%), Positives = 105/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P+  D I R++RAG   S A++++ G+ ++P+  EFR   +  + G
Sbjct: 141 HCRTRRLRKLERQLPDTCDTIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  KV+ L
Sbjct: 201 VPLQEALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P ++ VL  DP G +L+G+  A M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAGLLSVMNPDFIAVLWQDPAGILLVGMTIASMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|222111306|ref|YP_002553570.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221730750|gb|ACM33570.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 279

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +L ++R AK ++  P+AL+++  S+R+G  ++ A+ ++  ++  P   E   V+  Q LG
Sbjct: 95  YLKRRREAKLIEQMPDALNMLAGSLRSGASLAIAMDLVATETPPPFSQELSLVLREQKLG 154

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL ++     + + L++V+   + I++   +GGNLSE L  L+  LR +  M+ K++AL
Sbjct: 155 VSLEDAFESFAKRVNLEDVNLLVSAITISKDVGGNLSEVLERLASTLRAKAAMEGKIRAL 214

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + K    ++G LP  +  +++   P  M  L +   G  ++ V A  +++G + ++ +
Sbjct: 215 TSQGKLQGIVVGLLPVFLGFVLFQMEPEAMAPLFSTYYGWAVMAVVAVLLIMGGVFIKKI 274

Query: 183 INFDV 187
           +  DV
Sbjct: 275 VTIDV 279


>gi|116671480|ref|YP_832413.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611589|gb|ABK04313.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 310

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/186 (28%), Positives = 96/186 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR A+F     + L ++   +RAG  +  A+     +S  P   E RRVI    
Sbjct: 124 LGFLAGKRRARFDQQLGDTLQLLAGGLRAGHSILRAIDAAAAESQSPTSEEMRRVITETS 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  S++     M  ++  + +  I +  ++GGNL+E L  ++  +R+R  +K  ++
Sbjct: 184 LGRDLLASLTDTSERMKNEDFVWIAQAIQINREVGGNLAEVLDQVNETIRERSEIKGHIK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E K SA+I+ ++P  +  ++   +PGYM+ +   P G  ++  +  FM IG + MR
Sbjct: 244 ALAAEGKFSAYILIAMPIGIVLMLMAVNPGYMDAMFTHPLGWAMIAASVVFMTIGSLWMR 303

Query: 181 LMINFD 186
            +I+  
Sbjct: 304 KIIDLK 309


>gi|308050052|ref|YP_003913618.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
 gi|307632242|gb|ADN76544.1| Type II secretion system F domain protein [Ferrimonas balearica DSM
           9799]
          Length = 324

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  K  + FP ALDI+ R ++AG    DA+ +   +   P+  EF+ +    +
Sbjct: 138 LNRDFNKRMEKIEEQFPEALDILRRGIQAGYAFPDAIKLTYEEMDGPIAYEFKVMFAEIN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G     ++   +  +P      FST + VQ + GGNL+E L NL+RI+R R   + +V+
Sbjct: 198 YGKDTRRALLHFIERVPSVSAMAFSTAVQVQKETGGNLAENLENLTRIIRKRFRFQRQVK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S + + SAW++  +P  +   +Y +SP Y   L +   G+ LL +A   MLIGI  + 
Sbjct: 258 TFSAQGRMSAWVLVCVPLALFGYLYLSSPTYARELTDTEIGNTLLTIAGIGMLIGIYWIS 317

Query: 181 LMINFDV 187
            +I  +V
Sbjct: 318 RLIRIEV 324


>gi|264678229|ref|YP_003278136.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262208742|gb|ACY32840.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 329

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 112/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++     R  +     P ALD+I R++RAG   S ++ +   + ++P+  EFR V +  +
Sbjct: 143 LQRKRLLRLKRMERQLPEALDLIARALRAGHAFSASLQMAGEELTEPIADEFRLVHDEIN 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G SL ++++ +   +P+ ++ +F   + +Q + GGNL+E L+NLSR++R+R  + AKV+
Sbjct: 203 YGTSLQQALTNLGERVPITDLRYFIVAVLIQRESGGNLTEMLSNLSRLIRERLKLHAKVR 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS + + SAW +G +PF ++ L+   +P +M+ L  DP G  +L   AA M+IG++++R
Sbjct: 263 VLSADGRMSAWFLGLMPFGLAALLNLMNPEFMHPLWTDPIGITILKWLAALMVIGLLLLR 322

Query: 181 LMINFDV 187
            +    V
Sbjct: 323 RIARIRV 329


>gi|254505024|ref|ZP_05117175.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222441095|gb|EEE47774.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 339

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 93/186 (50%), Positives = 134/186 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  K+R   FL++ PN +DIIVR V+AGLP+SD V V+  ++ +PV +EFR+V ETQ 
Sbjct: 153 IGNKRKRRFNAFLNELPNGIDIIVRGVKAGLPLSDCVKVVAREAREPVATEFRKVTETQV 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SL+E++S+M   +PL E +F + V+S+Q + GG L+EAL NLSR+LR RK MKAK++
Sbjct: 213 MGVSLAEALSKMPDRVPLPETNFLAIVVSIQQKAGGGLAEALGNLSRVLRQRKAMKAKIK 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAK+SA IIG+LPF V  +++F +P YM +L     G +++     +M  GIMVMR
Sbjct: 273 ALSSEAKSSAAIIGALPFVVGGILFFIAPDYMMILFTATTGKIIVAGCLFWMFCGIMVMR 332

Query: 181 LMINFD 186
            MINFD
Sbjct: 333 SMINFD 338


>gi|16263304|ref|NP_436097.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304377|ref|ZP_07584128.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
 gi|14523983|gb|AAK65509.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306902579|gb|EFN33173.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 333

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 130/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R  +F  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q 
Sbjct: 147 VNMKRNARFTRFAAEFPNAVDVIVRGLKAGLPMPDCLRVIAMEAQEPVKGEFLAIVQDQT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++ RM   MPL E +FF+ V+++QS+ GG+LSEAL NLS++LR+RK MK K++
Sbjct: 207 LGIPVDEAVKRMSERMPLAEANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIK 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIG+LPF V+  VYF SP YM +L     G +++     +M IGI+VMR
Sbjct: 267 AMSSEAKSSAGIIGALPFLVAGAVYFMSPDYMALLFTTMIGKVVVVGCGLWMGIGILVMR 326

Query: 181 LMINFD 186
            MINFD
Sbjct: 327 KMINFD 332


>gi|83716413|ref|YP_440463.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
 gi|167617238|ref|ZP_02385869.1| Flp pilus assembly protein TadB [Burkholderia thailandensis Bt4]
 gi|257141111|ref|ZP_05589373.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
 gi|83650238|gb|ABC34302.1| Flp pilus assembly protein TadB [Burkholderia thailandensis E264]
          Length = 325

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ +DP+  EFR   +  + G
Sbjct: 141 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFADPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  K++ L
Sbjct: 201 VPLQEALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  D  G +L+G     M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAALLAIMNPDFISVLWEDSAGVLLVGATVTSMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|167579123|ref|ZP_02371997.1| Flp pilus assembly protein TadB [Burkholderia thailandensis TXDOH]
          Length = 325

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+A D+I R++RAG   S A++++ G+ +DP+  EFR   +  + G
Sbjct: 141 RCRTRRLRKLERQLPDACDMIARALRAGHAFSSAISMVGGEFADPMGGEFRITFDEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  K++ L
Sbjct: 201 VPLQEALLNLATRVPVPDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKIRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E K SA I+  LPF  + L+   +P +++VL  D  G +L+G     M  GI+ MR +
Sbjct: 261 SAEGKLSALILTLLPFGTAALLAIMNPDFISVLWEDSAGVLLVGATVTSMAFGILWMRHI 320

Query: 183 INFDV 187
           I   V
Sbjct: 321 IRIRV 325


>gi|269960463|ref|ZP_06174835.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834540|gb|EEZ88627.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 322

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKMIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGNEMSAPLGPEFLNTFNMLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS+ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSQILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFGLYVIISLIRPEYIELLHTTPMGVKMIIGGMVSLFIGTIWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|254229336|ref|ZP_04922753.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262393423|ref|YP_003285277.1| flp pilus assembly protein TadB [Vibrio sp. Ex25]
 gi|151938144|gb|EDN56985.1| bacterial type II secretion system protein F domain [Vibrio sp.
           Ex25]
 gi|262337017|gb|ACY50812.1| flp pilus assembly protein TadB [Vibrio sp. Ex25]
          Length = 322

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKRIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFMNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFGLYVIISLVRPEYIELLHTHPMGIKMVIGGMVALFIGTLWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|307318084|ref|ZP_07597520.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
 gi|306896125|gb|EFN26875.1| Type II secretion system F domain protein [Sinorhizobium meliloti
           AK83]
          Length = 333

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 130/186 (69%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R  +F  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q 
Sbjct: 147 VNMKRNARFTRFAAEFPNAVDVIVRGLKAGLPMPDCLRVIAMEAQEPVKGEFLAIVQDQT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++ RM   MPL E +FF+ V+++QS+ GG+LSEAL NLS++LR+RK MK K++
Sbjct: 207 LGIPVDEAVKRMSERMPLAEANFFAIVVAIQSRTGGSLSEALGNLSKVLRERKKMKGKIK 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIG+LPF V+  VYF SP YM +L     G +++     +M IGI+VMR
Sbjct: 267 AMSSEAKSSAGIIGALPFLVAGAVYFMSPDYMALLFTTMIGKVVVVGCGLWMGIGILVMR 326

Query: 181 LMINFD 186
            MINFD
Sbjct: 327 KMINFD 332


>gi|85373128|ref|YP_457190.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
 gi|84786211|gb|ABC62393.1| hypothetical protein ELI_01505 [Erythrobacter litoralis HTCC2594]
          Length = 323

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 119/187 (63%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I KRTA F   FP+A++++VR +R+GLPV++ +AV+  +   PV  EF+ ++E   
Sbjct: 137 VGFFINKRTADFNSKFPDAIELLVRGLRSGLPVTETLAVVAQEVPGPVGVEFKSIVERIK 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ E +      + + E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++
Sbjct: 197 IGKTMEEGLQDTADKLNIPEFNFFCITLAIQRETGGNLAETLSNLSEVLRKRGQMKLKIR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+G+LPF V  ++++ +P Y++    D R  ++      +M IG  +M 
Sbjct: 257 AMSSESKASAYIVGALPFIVFAMIWWINPTYIDGFFTDERLIVIGLGGMVWMSIGAFIMA 316

Query: 181 LMINFDV 187
            M++F++
Sbjct: 317 KMVSFEI 323


>gi|259417689|ref|ZP_05741608.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346595|gb|EEW58409.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 322

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR AK  +  P+ ++++VRS+R G P S AV ++  +  DP+ +EF  + +   
Sbjct: 136 VNSKAKKRMAKLEEQLPDGVELMVRSLRVGHPFSSAVQIVAKEVDDPLATEFGIIADECS 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P           P Y + +++ P       +    +   I VMR
Sbjct: 256 AITAEAQWSGKFLSGFPLFTLGGTLVMDPHYYDSVLDHPWFMPACFIVGGMLTANIFVMR 315

Query: 181 LMINFDV 187
            + +  V
Sbjct: 316 KLTDIQV 322


>gi|258627497|ref|ZP_05722278.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|262165915|ref|ZP_06033652.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
 gi|262171239|ref|ZP_06038917.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|258580303|gb|EEW05271.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|261892315|gb|EEY38301.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|262025631|gb|EEY44299.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
          Length = 321

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R ++F +  P+ALDII R ++AG PV+ A   +  + + P+  EF+      +
Sbjct: 135 LQKRIADRLSRFEEQLPDALDIIRRMLQAGQPVTQAFNEVGKEMAAPIGLEFKNTFNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +  +I +M    P   +  F++ + +Q + GGNLSE L  + ++LR R  +  K++
Sbjct: 195 YGYDMRLAIMQMAERTPTVSMLAFASAVMLQKETGGNLSENLEKVGKVLRQRFKLTRKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   + F +P Y+  L  D RG  ++ V    +  G + +R
Sbjct: 255 TLSAESRLSAWILVLSPFVLFIGLMFINPDYVTPLYQDARGMEMVSVGMVSLFFGAIWIR 314

Query: 181 LMINFDV 187
            +I+F+V
Sbjct: 315 KIISFEV 321


>gi|218530658|ref|YP_002421474.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
 gi|218522961|gb|ACK83546.1| type II secretion system protein [Methylobacterium chloromethanicum
           CM4]
          Length = 323

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|163851907|ref|YP_001639950.1| type II secretion system protein [Methylobacterium extorquens PA1]
 gi|163663512|gb|ABY30879.1| type II secretion system protein [Methylobacterium extorquens PA1]
          Length = 323

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|153834070|ref|ZP_01986737.1| Flp pilus assembly protein TadB [Vibrio harveyi HY01]
 gi|148869625|gb|EDL68615.1| Flp pilus assembly protein TadB [Vibrio harveyi HY01]
          Length = 322

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKMIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LSRILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSRILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFGLYIIISLVRPDYIELLHTSPMGIKMVIGGMISLFIGTLWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|220923699|ref|YP_002499001.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948306|gb|ACL58698.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 327

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 88/172 (51%), Positives = 126/172 (73%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
           +FPNA+D+IVR V+AGLP+ D + ++  ++ +PV+SEFR ++E Q LG+ L +++ R+  
Sbjct: 155 EFPNAIDVIVRGVKAGLPLVDCLNIVAAEAQEPVKSEFRALVEDQTLGMPLQDAVERLPE 214

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            MPL E  FF+ VI++QS+ GG+LSEAL NLSR+LR+RK M+ K++A+S EAKASA II 
Sbjct: 215 RMPLSEARFFAIVIAIQSRTGGSLSEALGNLSRVLRERKKMQGKIKAVSSEAKASAGIIA 274

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +LP  V +LVY TSP YM +L   P G  +L     +ML+G ++MR MINFD
Sbjct: 275 ALPIVVGSLVYLTSPAYMALLFTTPIGKAVLAGCVVWMLLGTLMMRKMINFD 326


>gi|84501672|ref|ZP_00999844.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390293|gb|EAQ02852.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 322

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR +   +  P+A++++VRS+R G P S A+ ++  + +DP+ SEF  + +   
Sbjct: 136 VNSKAKKRMSLIEEQLPDAVELMVRSLRVGHPFSSAIQIVSREVADPLGSEFGIIADENA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  +   + LQ++ F +  +++Q Q GGNL+E LA L+ ++R R  +  +V+
Sbjct: 196 YGRDMGEALKDLAERIGLQDLRFLAVAVTIQQQSGGNLAEILAGLANVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   + + P      +    P Y + +++ P         A F+ + ++VMR
Sbjct: 256 AITAEAQWSGMFLSAFPIVALIAINVMDPHYYDEVMDHPFFLPACFAVAGFLGVNLIVMR 315

Query: 181 LMINFDV 187
            +++  V
Sbjct: 316 KLVDIKV 322


>gi|269926133|ref|YP_003322756.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789793|gb|ACZ41934.1| type II secretion system protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 336

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R +      P A+D++  ++ AG  ++ A+ +   + S+P+  E  +V+  Q 
Sbjct: 150 LALRRKRRLSALERQLPGAIDVLAGALEAGSSLAQAMMLAAREMSNPISDELIKVVRDQE 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS  E++ RM+   P +++    T I++Q ++GG+L+  L ++S  +R+R  +K +++
Sbjct: 210 LGLSQEEALRRMLERCPSEDLDMMITAINIQYRVGGSLAHVLKSISTTIRERLRIKGEIK 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + SA+I+ ++PF ++ +++  +  Y+  L     G ++L VA A +++G  +MR
Sbjct: 270 VLTAQGRISAYIVTAIPFLLTAVIFLLNRSYIMPLFTTNMGRIMLAVALAGIMMGYYMMR 329

Query: 181 LMINFDV 187
            +I   V
Sbjct: 330 RIIAIKV 336


>gi|254255260|ref|ZP_04948576.1| Flp pilus assembly protein TadB [Burkholderia dolosa AUO158]
 gi|124900997|gb|EAY71747.1| Flp pilus assembly protein TadB [Burkholderia dolosa AUO158]
          Length = 325

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/181 (27%), Positives = 101/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  K     P+  D+I R++R+G   +  + ++  +  DP+  EFR   +  + G+ L+
Sbjct: 145 RRMRKLQRQLPDVCDMIARALRSGHSFTSTLGMVGDEFPDPMGGEFRVTFDEVNYGVPLN 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E 
Sbjct: 205 DALKNLATRVPAQDLRYFVIAVLIQRETGGNLAELLDSIAALIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF    ++   +  +++VL  DP G  ++G     M  G++ +R ++   
Sbjct: 265 RLSAWILGLLPFGTGAVMALVNREFLSVLWQDPAGIRMVGTMLVSMAFGLLWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|254464012|ref|ZP_05077423.1| type II secretion system protein [Rhodobacterales bacterium Y4I]
 gi|206684920|gb|EDZ45402.1| type II secretion system protein [Rhodobacterales bacterium Y4I]
          Length = 322

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P + AV ++  +  DP+ +EF  + +   
Sbjct: 136 VNKKAAKRMAMIEEQLPDAVELMVRSLRVGHPFTSAVQIVANEVEDPLATEFGIISDECA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDIGEALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P      +    P Y + +++ P            +   + VMR
Sbjct: 256 AITAEAQWSGKFLSGFPLFCLAGILVKDPNYYDKVLDHPWFIPACFTVGVMLTANLFVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 MLTNIKV 322


>gi|240139030|ref|YP_002963505.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
 gi|240009002|gb|ACS40228.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens AM1]
          Length = 323

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 92/187 (49%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQKRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|84387238|ref|ZP_00990259.1| Flp pilus assembly protein TadB [Vibrio splendidus 12B01]
 gi|84377885|gb|EAP94747.1| Flp pilus assembly protein TadB [Vibrio splendidus 12B01]
          Length = 321

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +  R A+F +  P ALDII R+++AG P+  +   +  +  DP+  EF+      +
Sbjct: 135 VQNRVTYRMARFEEQLPEALDIIRRALQAGQPLVQSFNEVGEELPDPIGVEFKNTYNLLN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M   +P   +  FS+ + +Q + GGNLSE L  +S +LR R  ++ K++
Sbjct: 195 YGYDLRLAILQMTERVPTVSMLAFSSAVMLQKETGGNLSENLQKVSEVLRARFKLERKIK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E++ SAWI+   PF +   +   SP Y+  L  DPRG  ++ V    + IG + ++
Sbjct: 255 TLSAESRLSAWILTLSPFGLFFALRVASPEYIEPLYKDPRGLSMVSVGIVLLAIGALWIK 314

Query: 181 LMINFDV 187
            +I+ ++
Sbjct: 315 KIISIEI 321


>gi|301165544|emb|CBW25115.1| putative pilus assembly-related protein [Bacteriovorax marinus SJ]
          Length = 296

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 90/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L+ +R   +     +AL ++   +RAGL V  A+ ++V +   PV  EF  +++   
Sbjct: 110 INYLVDRRINAYSAQMVDALTLLSNGIRAGLSVPQAIGMVVDEMPAPVSQEFNMILQQNR 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E    + + +P ++   F + I++  + GGNL+E    +  ++R+R  +K K+ 
Sbjct: 170 IGVPLEECFDNLSKRIPTEDNDMFVSSINILRETGGNLAEVFDTIVDVIRERVRLKQKID 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + +       I  +P+ +  + + + P  +  +   P G +L   A AF   G  V+ 
Sbjct: 230 TFTAQGMFQGLTIFLMPYGIGLIYFVSDPESVKPMFTHPLGIILTLAALAFDFAGGFVIL 289

Query: 181 LMINFDV 187
            ++   V
Sbjct: 290 KIVKIKV 296


>gi|170734861|ref|YP_001773975.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169820899|gb|ACA95480.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 325

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  K     P+  D+I R++R+G   +  + ++  +  +P+  EFR   +  + G
Sbjct: 141 RCRAKRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFPEPMGGEFRVTFDEVNYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ L
Sbjct: 201 VSLHDALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R +
Sbjct: 261 SAEGRLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRI 320

Query: 183 INFDV 187
           +   V
Sbjct: 321 VRIRV 325


>gi|302037433|ref|YP_003797755.1| pilus assembly protein TadB [Candidatus Nitrospira defluvii]
 gi|300605497|emb|CBK41830.1| Pilus assembly protein TadB [Candidatus Nitrospira defluvii]
          Length = 313

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 105/186 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R A F    P+ALD++ RS+RAG      + ++  +   P+ +EFR V+E   
Sbjct: 127 LSWRAAARRAHFQRQLPDALDMMARSLRAGHAFLAGMKIVAEEFPAPIGAEFRSVVEEVA 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+S++E++ R+   +    ++FF T + +Q + GGNL+E L  +SR+ R R  + AKV+
Sbjct: 187 FGVSVTEALQRLTARVDSPALNFFVTSVLIQRESGGNLAEILNTISRMTRKRFELAAKVR 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA I+ +LPF +  L+   +P Y+ +L  DP G  ++ V    MLIG +V +
Sbjct: 247 AVSAEGRLSAVILFALPFALGGLLLIINPDYVLLLFRDPIGRAMVTVGGVLMLIGGVVTK 306

Query: 181 LMINFD 186
            M+   
Sbjct: 307 RMVTVR 312


>gi|13475421|ref|NP_106985.1| hypothetical protein mlr6484 [Mesorhizobium loti MAFF303099]
 gi|14026173|dbj|BAB52771.1| mlr6484 [Mesorhizobium loti MAFF303099]
          Length = 323

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 111/186 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR  KF    P+ALD+IVRS+RAG P + A+A++  +  DP+ +EF  V +   
Sbjct: 137 LRSARDKRIKKFAVQLPDALDMIVRSLRAGHPTTVAIALVAREMPDPLGTEFGIVSDEIS 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GLSL +++ ++   +  + +   S  +S+Q++ GGNL+E L+NLS +LR+R+ ++ K++
Sbjct: 197 FGLSLEQAVRKLSERVGFEGLHLLSVSLSIQAKTGGNLTEILSNLSSVLRERRKLRMKIR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWII   P  +  ++   +P +   +  +P    +  +  ++ L+G  +M 
Sbjct: 257 ALSAEGRMSAWIISLFPLLMLGVLSIAAPSFYGDVWGNPIVVPVFVIFGSWALLGDFIMY 316

Query: 181 LMINFD 186
            M+NFD
Sbjct: 317 RMVNFD 322


>gi|227818620|ref|YP_002822591.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|36958876|gb|AAQ87301.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Sinorhizobium fredii NGR234]
 gi|227337619|gb|ACP21838.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 332

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 91/186 (48%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  +F  +FPNA+D+IVR ++AGLP++D + VI  ++ +PV+ EF  +   Q 
Sbjct: 146 VNTTRNRRLKRFTAEFPNAVDVIVRGLKAGLPMTDCLRVIAAEAQEPVKGEFLTIAHDQT 205

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL + E++ R+   MPL E  FF+ VI++QS+ GG+LSEAL NLS++LR+RK MKAK++
Sbjct: 206 LGLPVDEAVERLCERMPLPEARFFAIVITIQSRTGGSLSEALGNLSKVLRERKKMKAKIK 265

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIG+LPF V+  VY TSP YM++L     G M+L  +A +M IG ++MR
Sbjct: 266 AMSAEAKSSAGIIGALPFFVAGAVYLTSPDYMSLLFTTMTGKMVLVGSALWMGIGTLLMR 325

Query: 181 LMINFD 186
            MINFD
Sbjct: 326 KMINFD 331


>gi|328474277|gb|EGF45082.1| putative tight adherence TadB-like transmembrane protein [Vibrio
           parahaemolyticus 10329]
          Length = 322

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKKIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFALYVIISLVRPEYIELLHTHPMGIKMVIGGMVALFIGTLWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|28899185|ref|NP_798790.1| putative tight adherence TadB-like transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836794|ref|ZP_01989461.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|260361576|ref|ZP_05774603.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
 gi|260876733|ref|ZP_05889088.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|260898189|ref|ZP_05906685.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|260900404|ref|ZP_05908799.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|28807409|dbj|BAC60674.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749940|gb|EDM60685.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|308089098|gb|EFO38793.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|308091412|gb|EFO41107.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|308109112|gb|EFO46652.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308114015|gb|EFO51555.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
          Length = 322

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  KF +  P ALDII R ++AG P++ A   +  + S P+  EF       +
Sbjct: 136 LQKKIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVSAPLGPEFLNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFALYVIISLVRPEYIELLHTHPMGIKMVIGGMVALFIGTLWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|254561625|ref|YP_003068720.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
 gi|254268903|emb|CAX24864.1| Pilus assembly protein, type II secretion protein [Methylobacterium
           extorquens DM4]
          Length = 323

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 91/187 (48%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   ++R   F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E+Q 
Sbjct: 137 LKRRQRRRVEAFIEELPNAMDVVVRGLRSGIPLGDCLRMIAREAKEPLRSEFRVTMESQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 197 LGLSMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALGNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V    Y +SP Y  +L     G + L ++  +ML G+ VM+
Sbjct: 257 AMSMEAKASAAIIGALPFVVGGGTYLSSPDYTALLWTTSFGKIALVISGLWMLTGVFVMK 316

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 317 KMINFDI 323


>gi|116687152|ref|YP_840399.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|116652867|gb|ABK13506.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 325

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 105/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G
Sbjct: 141 RCRAKRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ L
Sbjct: 201 VSLHDALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R +
Sbjct: 261 SAEGRLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRI 320

Query: 183 INFDV 187
           +   V
Sbjct: 321 VRIRV 325


>gi|330811032|ref|YP_004355494.1| type II secretion system protein; membrane protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379140|gb|AEA70490.1| putative type II secretion system protein; putative membrane
           protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 328

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 65/183 (35%), Positives = 102/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             KR A F +  P+ALD + R++RAG P ++ + ++  +   PV  EF       + G  
Sbjct: 146 RNKRFAAFEEGLPDALDAMCRALRAGHPFNETLRLVAEEHKGPVAQEFGMTFSDINYGND 205

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  ++  MP   V    T I +  + GGNL+E L  LSR++R R   + K++ LS 
Sbjct: 206 VRRAMLGLLERMPSMTVMMLVTSILIHRETGGNLTEVLERLSRLIRGRFRFQRKIRTLSA 265

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + SAW++ ++PF ++  +  TSP YM VLINDP GH L+  A   MLIGI  ++ +I 
Sbjct: 266 EGRMSAWVLVAIPFVLAIAIVLTSPSYMPVLINDPIGHKLIIGAFCAMLIGIFWIKKIIR 325

Query: 185 FDV 187
             V
Sbjct: 326 IQV 328


>gi|134299963|ref|YP_001113459.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052663|gb|ABO50634.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 323

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 108/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   +KR AKF     +AL I+  S+R+G     A+ ++  +  +P+  EF R  +  +
Sbjct: 137 IRIKRQKRLAKFNSQISDALVIMSNSLRSGFSFLQAMDMVRKELPNPISKEFGRTFQEMN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG    E++  M + +   ++    T + +Q Q+GGNL+E + N++  +R+R  +K +++
Sbjct: 197 LGTQAEEALENMAQRVKSDDLDLLITAVLIQRQVGGNLAEVMDNIADTIRERVRVKGQIR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S ++IG LPF ++T++   SP Y+  L N   G +++G+A    +IG+M ++
Sbjct: 257 TLTAQGRISGFVIGLLPFGLTTVMITISPSYILTLFNSQLGLLMMGMAIISEVIGVMFIK 316

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 317 KIVNIEV 323


>gi|296158516|ref|ZP_06841346.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891084|gb|EFG70872.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 282

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K + KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    
Sbjct: 96  LKRMRKKRIEALEKQLPDALLMMSGALRAGASFPSALEAVVHETTPPISQEFDLLMREIR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + + +P+ ++   +  +++  ++GGNL+EAL +++R LR++  M+ K++
Sbjct: 156 LGIDLDIAMRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F  P  M  L N+P G   L V      +G + + 
Sbjct: 216 ALTSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFNEPVGWATLAVIGVMEFLGYVWIT 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 KITNIDV 282


>gi|197106462|ref|YP_002131839.1| Flp pilus assembly protein TadB [Phenylobacterium zucineum HLK1]
 gi|196479882|gb|ACG79410.1| Flp pilus assembly protein TadB [Phenylobacterium zucineum HLK1]
          Length = 305

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 74/184 (40%), Positives = 113/184 (61%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L+ +R  +FL  F  A+ +IVR +RAGLPV++ V V+  +   PV  EFRRV +   LG 
Sbjct: 122 LMGRRRGRFLKTFAEAIALIVRGLRAGLPVTETVGVVGREIEGPVGEEFRRVADEVRLGA 181

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            +  ++    R + L E  F +  ++VQ + GGNL+E+L NL  ILR R+ M+ K++A+S
Sbjct: 182 PIEGAMGEAARRIGLPEFDFLAICLAVQRETGGNLAESLENLEHILRRRQQMRLKIKAMS 241

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA ASA IIG LPF ++ L+   SP YM VL   P G +++    A + +G ++MR M+
Sbjct: 242 SEATASALIIGVLPFAMAVLMSIASPDYMRVLFTGPLGRLMIAAGLASLAVGGLIMRKMV 301

Query: 184 NFDV 187
            F++
Sbjct: 302 RFEI 305


>gi|32473986|ref|NP_866980.1| secretion system protein TadB [Rhodopirellula baltica SH 1]
 gi|32444523|emb|CAD74522.1| secretion system protein TadB [Rhodopirellula baltica SH 1]
          Length = 347

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 102/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              K+R  +F +  P AL+++ RS+RAG  ++    ++  +   P+ +EFRR  E Q  G
Sbjct: 163 FKRKRRLKRFGEQIPEALELLGRSLRAGHSLNAGFGLVGDEMEAPLATEFRRCFEEQKFG 222

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L ESI  M   +P  ++ FF+T + +Q Q GG+LSE L  +  ++R+R  +   +QAL
Sbjct: 223 IPLDESIEDMAERVPNMDLRFFATAVILQRQTGGDLSEILDKIGHLVRERLQILGTIQAL 282

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + S  ++ +LP  +  ++   +  Y+ +L  D  G M LG+A    ++G + ++ +
Sbjct: 283 TGEGRMSGAVLLALPPVLFLVMLKINAEYVLMLFTDELGRMALGMALVTQVLGALAIKKI 342

Query: 183 INFDV 187
           I   V
Sbjct: 343 ITIKV 347


>gi|329935279|ref|ZP_08285245.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
 gi|329305102|gb|EGG48961.1| type II secretion system F protein [Streptomyces griseoaurantiacus
           M045]
          Length = 315

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 94/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +  +
Sbjct: 129 LNWQRQKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLN 188

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG ++ +++  +   +P +E+    T + + ++ GG++  +L NL++ L DRK  + +V+
Sbjct: 189 LGRTVDDALGELAERLPSRELIVLVTTLVLSNKAGGSVVSSLRNLTQTLEDRKETRREVR 248

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ +  L      LV  ++ G +  +   P G  L+ ++ A   +G +V+R
Sbjct: 249 TMLSEVNATAFTVPMLGLGSLVLVNSSNEGALERVTGSPLGQALVLISLALYTVGFLVIR 308

Query: 181 LMINFDV 187
            +   +V
Sbjct: 309 RLGRIEV 315


>gi|84687273|ref|ZP_01015153.1| Putative Flp pilus assembly protein TadB [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664706|gb|EAQ11190.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2654]
          Length = 322

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 94/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR A F +  P+A++++VRS+R G P S A+ ++  +  DP+ SE   + +   
Sbjct: 136 INGKAKKRMAMFEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGSEIGIIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + +S+  M   M +Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDIGDSLKAMAERMDMQDLRFLAVAVTIQQTSGGNLAEILDGLAKVIRSRFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P     ++    P Y + +           V   F++    VM+
Sbjct: 256 AITAEAKWSGTFLSGFPILAIVMINVIQPNYYDDVKETGFFIPAALVCLGFLIANYFVMK 315

Query: 181 LMINFDV 187
            + N  V
Sbjct: 316 ALTNIKV 322


>gi|296134294|ref|YP_003641541.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032872|gb|ADG83640.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 320

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   +KR A+F     +AL I+  S+RAG     A+ ++  +   P+  EF R +   +
Sbjct: 134 VKAAKQKRVARFNAQIGDALIIMANSLRAGFSFLQAMELVSKEMPAPISVEFARALREMN 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  E++  +   +  +++    T + +Q Q+GGNLS+ L  +S  +R+R  +K +++
Sbjct: 194 LGTATEEALQNLCNRVESEDLDLVITAVLIQRQVGGNLSQILEGISHTIRERVRIKGEIK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+G+LP  +  ++   +PGY+ +L +D  G +L+       LIG+ +++
Sbjct: 254 TLTAQGRISGMIVGALPVGMGLILAVINPGYIGILFSDSLGLVLIVAGVILQLIGVALIK 313

Query: 181 LMINFDV 187
            +++  V
Sbjct: 314 KIVDIKV 320


>gi|197295160|ref|YP_002153701.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944639|emb|CAR57243.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 325

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G
Sbjct: 141 RCRARRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL +++  +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ L
Sbjct: 201 VSLHDALMNLATRVPVQDLRYFVIAVLIQRETGGNLAELLDSIAGLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R +
Sbjct: 261 SAEGRLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGTMLVSMLFGLFWIRRI 320

Query: 183 INFDV 187
           +   V
Sbjct: 321 VRIRV 325


>gi|224824219|ref|ZP_03697327.1| type II secretion system protein [Lutiella nitroferrum 2002]
 gi|224603638|gb|EEG09813.1| type II secretion system protein [Lutiella nitroferrum 2002]
          Length = 324

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 106/185 (57%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR AKF +  P+A+D++ R++RAG  +  ++ +I  + SDP+  EFR   +  + G
Sbjct: 140 RFRHKRLAKFEEQLPDAIDLMCRALRAGHALPQSLKMIGDEMSDPISGEFRTTFDEVNYG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            SL E++  +   +P  ++ +    + +Q + GGNL+E L N+S ++R R  +   ++ L
Sbjct: 200 FSLQEAMMNLATRIPSTDLRYMVIAVLIQRETGGNLAELLGNISALIRARLKLYGTIRVL 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E K SAWI+  LPF V+ +++  +PG+M VL  D  G M++ +    ML GI  MR +
Sbjct: 260 AAEGKLSAWILTILPFAVALVIHLLNPGFMKVLWEDQTGLMMVSIIGLMMLAGIFWMRQI 319

Query: 183 INFDV 187
           I   V
Sbjct: 320 IKIQV 324


>gi|299067811|emb|CBJ39022.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CMR15]
          Length = 325

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 95/185 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  +  +  P A D++ R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 RCRAKRLLRLEEQLPEAADLLSRALRAGHSLPSALDMAGSELPAPIGAELALVFSEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + + ++++ +   +P++++ +    + +Q + GGNL+E L N+  ++R R  +  KV+ L
Sbjct: 201 VPMGDALTGLTDRVPIEDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  V  +VY  +P  ++ L  DP G  +L  A     +G++ +R +
Sbjct: 261 SAEGRMGGWILTLLPPVVGVIVYELNPDLISTLWKDPTGLKMLWYAITMTCVGVIWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|153006802|ref|YP_001381127.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030375|gb|ABS28143.1| type II secretion system protein [Anaeromyxobacter sp. Fw109-5]
          Length = 320

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 64/185 (34%), Positives = 105/185 (56%), Gaps = 1/185 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              +R+ K  +  P AL+++ RS+RAG  ++ A  V+ G+  +PV  EF R  + Q LGL
Sbjct: 136 ARSRRSQKISEQLPEALEMMARSLRAGHALTSAFQVVAGEMPEPVCVEFARSYDEQRLGL 195

Query: 64  SLSESISRMVRYMP-LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           SL +++  M    P   +V  F+    +Q + GGNL+E L  +S  +R R     K++AL
Sbjct: 196 SLEQAVLHMAERCPGNSDVKIFAVSAVIQRETGGNLAEILEKISDTIRQRYRFYGKLRAL 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +ASAW++G LPF V+  V   +PGY+  L  +P GH ++G A     +GI+ +R +
Sbjct: 256 TGEGRASAWVLGLLPFIVALAVSVMNPGYLRTLAENPSGHWIVGYAIVSWAVGIVWLRRL 315

Query: 183 INFDV 187
              ++
Sbjct: 316 TQLEI 320


>gi|110636325|ref|YP_676533.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287309|gb|ABG65368.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 337

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 107/187 (57%), Positives = 147/187 (78%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L ++R   FL++FPNALDIIVR+V++GLP++DAV +I  ++ +PVR+EFRR++E Q 
Sbjct: 151 IAYLRRRRVQAFLNEFPNALDIIVRAVKSGLPLNDAVRMIAVEAQEPVRTEFRRLVEAQQ 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL ++E+  RM   MP  EV+FF  V+ +QSQ GGNLSEAL NLSR+LR+RK +KA+VQ
Sbjct: 211 LGLPMAEAAMRMSETMPCPEVNFFGIVLQIQSQAGGNLSEALGNLSRVLRERKKIKARVQ 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALSMEAKASA IIG+LP  V+ LVY TSP Y+  L ++  GH++LG++A +M IGI VMR
Sbjct: 271 ALSMEAKASAVIIGALPIVVAALVYITSPAYIMPLFSESVGHLILGLSAVWMSIGIFVMR 330

Query: 181 LMINFDV 187
            M+NF+V
Sbjct: 331 QMMNFEV 337


>gi|54302282|ref|YP_132275.1| Flp pilus assembly protein TadB [Photobacterium profundum SS9]
 gi|46915704|emb|CAG22475.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum SS9]
          Length = 288

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  +KR   F + F  ALD++ R++  G P ++ +  +  +   P+  EF +     +
Sbjct: 102 LKYKAEKRLCLFEEQFVEALDVMKRALLVGYPFTEVMKTVSQEMPAPISVEFGKTFSELN 161

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ + +  P   V  F++ + +Q + GGNL+E L NLS ++R R  +  KV+
Sbjct: 162 YGVDIKVALANLAQRNPSISVLAFNSAVIIQKETGGNLAETLENLSEVIRGRFRLLRKVR 221

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SAWI+  +PF +  ++Y ++P Y++ L    RG  LL +    M++G++ +R
Sbjct: 222 SLSAEGRMSAWILMCVPFVLVIMIYLSTPDYLDPLFESDRGANLLMITGVCMILGMIWIR 281

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 282 KILRIEV 288


>gi|220922783|ref|YP_002498085.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219947390|gb|ACL57782.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 322

 Score =  117 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 88/187 (47%), Positives = 137/187 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R A+F+ + PNA+D+IVR +++GLP+ D + +I  ++ DPV++EFR ++E+Q 
Sbjct: 136 LAYLRKRRMARFVLELPNAMDVIVRGIKSGLPIGDCLRIIAREAPDPVKTEFRAIVESQA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL L E+ +++   MP+ E +FF+ VI +QS+ GGNLSEAL NLSR+LRDR+ M  KV 
Sbjct: 196 IGLPLPEAAAKLYERMPIPEANFFAIVIGIQSKSGGNLSEALGNLSRVLRDRRRMADKVS 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEA+ASA II SLPF V+ L Y +SP Y+++L     G + +  +  +MLIG++VM+
Sbjct: 256 AMSMEARASAAIIASLPFAVAILCYLSSPDYISLLWTTQVGQIAIAASGLWMLIGVLVMK 315

Query: 181 LMINFDV 187
            MI F++
Sbjct: 316 RMITFEI 322


>gi|186474107|ref|YP_001861449.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184196439|gb|ACC74403.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 326

 Score =  117 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR  +     P+A D+I R++RAG     A+ ++  +   P+  EFR   +  +
Sbjct: 140 LRSRRAKRVVQLERLLPDAADLIARALRAGHSFPAALGMVADELPQPLGGEFRIAFDEIN 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+S+++++  +V  +P+ +V +F   + +Q + GGNL+E L N++ I+R+R  + AKV+
Sbjct: 200 CGVSMNDALMNLVSRVPVDDVRYFVIAVLIQREAGGNLAEILGNIATIIRERLKLLAKVR 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G LPF V   +   +PGY  V   D  G  + GVA + M +G++ +R
Sbjct: 260 VLSAEGRLSAWILGLLPFIVIAALSVLNPGYCKVFWEDETGQKIAGVALSMMALGVLWLR 319

Query: 181 LMINFDV 187
             +   V
Sbjct: 320 KTVRIRV 326


>gi|296444391|ref|ZP_06886356.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
 gi|296258038|gb|EFH05100.1| Type II secretion system F domain protein [Methylosinus
           trichosporium OB3b]
          Length = 322

 Score =  117 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 93/187 (49%), Positives = 138/187 (73%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R AKF++ FP ++DII+R ++AGLPV D   +I  ++ +PVRSEFR+++E+Q 
Sbjct: 136 LGFLARRRVAKFIEAFPGSVDIIIRGIKAGLPVGDCFRMIASEADEPVRSEFRQIVESQT 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GLS+ E+  R    MP+ E SFFS VIS+Q + GGNLSEAL+NL+ +LR+RK MKAKV+
Sbjct: 196 IGLSIGEATERFAERMPVAEASFFSIVISLQEKSGGNLSEALSNLAGVLRERKKMKAKVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA IIGSLPF V   V+FT+  YM VL +   G+M++  +  +M +G+ +M+
Sbjct: 256 AMSAEAKASAGIIGSLPFLVGLAVWFTNKPYMAVLFDTTVGNMIIAGSLLWMAVGVFIMK 315

Query: 181 LMINFDV 187
            MI+F++
Sbjct: 316 NMIDFEI 322


>gi|269966899|ref|ZP_06180972.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           alginolyticus 40B]
 gi|269828566|gb|EEZ82827.1| putative tight adherence TadB-related transmembrane protein [Vibrio
           alginolyticus 40B]
          Length = 322

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 95/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I  R  KF +  P ALDII R ++AG P++     +  + S P+  EF       +
Sbjct: 136 IQKRIADRLMKFEEQLPEALDIIKRVLQAGQPITQGFGEVGREVSAPLGPEFMNTFNLLN 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I +M    P   +  FS+ + +Q + GGNL E +  LS ILR R  +  K++
Sbjct: 196 YGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKLSHILRARFKLARKIK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +S E++ SAW++   PF +  ++    P Y+ +L   P G  ++      + IG + +R
Sbjct: 256 TISAESRMSAWVLVLAPFGLYVIISLVRPEYIELLHTHPMGIKMVIGGMVALFIGTLWIR 315

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 316 KIVNIEV 322


>gi|107028241|ref|YP_625336.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|105897405|gb|ABF80363.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
          Length = 325

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  K     P+  D+I R++R+G   +  + ++  + S+P+  EFR   +  + G
Sbjct: 141 RCRAKRMRKLERQLPDICDMIARALRSGHSFTSTLGMVGDEFSEPMGGEFRVTFDEVNYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL ++++ +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ L
Sbjct: 201 VSLHDALTNLATRVPVQDLRYFVIAVLIQRETGGNLAELLESIAGLIRERFKLFDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LPF  + ++   +  ++ VL  DP G  ++G     ML G+  +R +
Sbjct: 261 SAEGRLSAWILGLLPFGTAAVMALLNREFLLVLWEDPAGIRMVGTMLVSMLFGLFWIRRI 320

Query: 183 INFDV 187
           +   V
Sbjct: 321 VRIRV 325


>gi|78060307|ref|YP_366882.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
 gi|77964857|gb|ABB06238.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
          Length = 325

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 102/181 (56%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K     P+  D+I R++R+G   +  + ++  +  DP+  EFR   +  + G+SL 
Sbjct: 145 KRMRKLERQLPDICDMISRALRSGHSFTSTLGMVGDEFPDPMGGEFRVTFDEVNYGVSLH 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  +   +P+Q++ +F   + +Q + GGNL+E L  +S ++R+R  +  KV+ LS E 
Sbjct: 205 DALMNLATRVPVQDLRYFVIAVLIQRETGGNLAELLDCISALIRERFKLFDKVRVLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     ML G+  +R ++   
Sbjct: 265 RLSAWILGLLPFGTAAVMALLNREFLSVLWEDPAGIRMVGGMLVSMLFGLFWIRRIVRIR 324

Query: 187 V 187
           V
Sbjct: 325 V 325


>gi|167584965|ref|ZP_02377353.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 325

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 102/183 (55%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             +R  K     P+  D+I R++R+G   + A+ ++  + SDP+  EFR   +  + G+S
Sbjct: 143 RARRMRKLERQLPDVCDMIARALRSGHAFTSAIGMVSDEFSDPMGGEFRITFDEINYGVS 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +   +P++++ +F   + +Q + GGNL+E L +++ ++R+R  +  K++ LS 
Sbjct: 203 LHDALMNLANRVPVRDLRYFVIAVLIQRETGGNLAELLDSIAALIRERFKLFDKIRVLSA 262

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + SAW++G LPF  +  +   +P ++ VL  D  G  ++      M  G++ MR +I 
Sbjct: 263 EGRMSAWVLGLLPFATAGAMMVLNPEFLAVLWQDSAGIKMVATTLVSMAFGVLWMRRIIR 322

Query: 185 FDV 187
             V
Sbjct: 323 IHV 325


>gi|91777215|ref|YP_552423.1| putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
 gi|91689875|gb|ABE33073.1| Putative type II secretion system protein F [Burkholderia
           xenovorans LB400]
          Length = 282

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K + KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    
Sbjct: 96  LKRMRKKRIEALEKQLPDALLMMSGALRAGASFPAALEAVVYETAPPISQEFDLLMREIR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + + +P+ ++   +  +++  ++GGNL+EAL +++R LR++  M+ K++
Sbjct: 156 LGIDLDIAMRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F     M  L ++P G   L V      +G   + 
Sbjct: 216 ALTSQGRMQGIVMTCLPLFLMLVLRFMEAKAMAPLFSEPVGWATLAVIGVMECLGYFWIS 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 RITNIDV 282


>gi|144897190|emb|CAM74054.1| pilus assembly protein TadB [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 279

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 87/186 (46%), Positives = 122/186 (65%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R A+F   F +ALDI+VR +R+GLP+ + +A+I  +  +P+  EFR V+E Q 
Sbjct: 93  VGWLGKRRIARFTTLFADALDIVVRGLRSGLPLGECMAIIGREVPEPLGPEFRLVMEGQK 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLSL ES++R V   P  +  +F+ V+ +Q Q GGNL+E LA LS +LR RK M+ K++
Sbjct: 153 LGLSLEESLARAVERTPTADFKYFAIVLGIQQQTGGNLAETLAKLSEVLRARKRMRDKIK 212

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S EA ASA IIGSLP  V+ L+    P Y+ +L + P GH+LL      M +G +VMR
Sbjct: 213 AFSSEATASAMIIGSLPVVVALLLTAVGPDYIGILFSTPTGHLLLASGGLLMGMGALVMR 272

Query: 181 LMINFD 186
            MINFD
Sbjct: 273 KMINFD 278


>gi|296156493|ref|ZP_06839331.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295893092|gb|EFG72872.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 325

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 105/177 (59%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +     P+A D+I R++RAG      + ++  +  DP+  EF  V +  + G+S+++++ 
Sbjct: 149 QLERQLPDAADLIARALRAGHSFPATLGMVGQELPDPLGGEFALVFDEINYGVSMNDALL 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            MV  +P++++ +F   + +Q + GGNL+E L ++S I+R+R  +  KV+ LS E + SA
Sbjct: 209 NMVSRVPVEDLRYFVIAVLIQREAGGNLAEILGSISGIIRERLKLLGKVRVLSAEGRLSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           W++  LPF +  L+   +PGY++V   DP G  L GVA   ML GI+ MR ++   +
Sbjct: 269 WVLAVLPFAILGLLTVLNPGYISVFWKDPAGVQLAGVAITMMLFGILWMRKIVRIHI 325


>gi|85707699|ref|ZP_01038765.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
 gi|85689233|gb|EAQ29236.1| hypothetical protein NAP1_00650 [Erythrobacter sp. NAP1]
          Length = 323

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 117/187 (62%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IKKRT  F   F + ++++VR +R+GLPV++ +AV+  +   PV  EF+ ++E   
Sbjct: 137 VSFFIKKRTNDFNAKFADGIELLVRGLRSGLPVTETLAVVAQEVPGPVGLEFKGIVERIK 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ +S+      + + E +FF+  +++Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 197 IGKTMEDSLQETADRLGIPEFNFFTITLAIQRETGGNLAETLSNLADVLRKRTQMKLKIK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+GSLPF V  L+Y  +P Y+     + R  +       +M IGI +M 
Sbjct: 257 AMSSESKASAYIVGSLPFIVFGLIYSVNPSYIGGFFVEERLMVTGLGGLVWMSIGIFIMA 316

Query: 181 LMINFDV 187
            M++F++
Sbjct: 317 KMVSFEI 323


>gi|90411199|ref|ZP_01219212.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
 gi|90328045|gb|EAS44366.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
          Length = 324

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  +KR   F + F  ALD++ R++  G P ++ +  +  +   PV  EF +     +
Sbjct: 138 LKYKAEKRLCLFEEQFVEALDVMKRALLVGYPFTEVMKTVSQEMPAPVSVEFGKTFSELN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ + +  P   V  F++ + +Q + GGNL+E L NLS ++R R  +  KV+
Sbjct: 198 YGVDIKVALANLAQRNPSVSVLAFNSAVIIQKETGGNLAETLENLSEVIRGRFRLLRKVR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E + SAWI+  +PF +  ++Y ++P Y++ L    RG  LL + A  ML+G++ +R
Sbjct: 258 SLSAEGRMSAWILMCVPFVLVIMIYLSTPDYLDPLFESDRGANLLMITAVCMLVGMIWIR 317

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 318 KILRIEV 324


>gi|114764950|ref|ZP_01444123.1| type II/IV secretion system protein, TadC subfamily [Pelagibaca
           bermudensis HTCC2601]
 gi|114542662|gb|EAU45686.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. HTCC2601]
          Length = 321

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR A   +  P+A++++VRS+R G P S A+AV+  +  DP+ +EF  + +   
Sbjct: 135 VNGKAKKRLALIEEQLPDAVELMVRSLRVGHPFSSAIAVVSKEIKDPLATEFGVIADEST 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + ES+  M   + +Q++ F +  +S+Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 195 YGRDIGESLKHMAERLDMQDLRFLAVAVSIQQQSGGNLAEILEGLAKVIRARFRLFRRVK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P  V  ++  T P Y + +++ P       + A F+ + +MVMR
Sbjct: 255 AITAEAQWSGKFLSGFPVGVLLVIQLTDPHYYDEVLDHPWFVPACFIVAVFLALNLMVMR 314

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 315 MLVNIKV 321


>gi|283779213|ref|YP_003369968.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437666|gb|ADB16108.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 321

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 102/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R A F    P AL++I R++RAG  ++    ++  +   P+  EF R  E Q+LG
Sbjct: 137 MKRNRRLAHFARQLPEALELISRALRAGHSLASGFKLVADELGGPIAVEFERCYEAQNLG 196

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L E+I  M   +P  ++ FF+T + +Q Q GG+L+E L  +  ++R+R  +  ++QAL
Sbjct: 197 VPLEEAIDEMTVRVPNLDLRFFATAVILQRQTGGDLAEILDKIGHLVRERYKIWGQIQAL 256

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + S  ++ +LP  +  +++  +  Y   L  DP GH +L  A    LIG +V+R +
Sbjct: 257 TGEGRLSGIVLLALPPVLFVVMWRLNQQYCMALFTDPMGHQMLAGAVVMQLIGALVIRKI 316

Query: 183 INFDV 187
           +N  V
Sbjct: 317 VNIKV 321


>gi|146276357|ref|YP_001166516.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554598|gb|ABP69211.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 322

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +   
Sbjct: 136 VNNKAKKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVAECIRAFAERMDSQDLRFLAVAVNIQQQSGGNLAEILEGLAKVIRSRFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + +   P       V  AF++  ++ M+
Sbjct: 256 AITAEAKWSGTFLSAFPIVALVMISVLKPDYYDGVKETPLFIPAALVVGAFLVANVIFMK 315

Query: 181 LMINFDV 187
           +M+N  V
Sbjct: 316 IMVNIKV 322


>gi|326388861|ref|ZP_08210443.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206461|gb|EGD57296.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 323

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 69/187 (36%), Positives = 114/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I KR   F+  FP+AL+++VR +R+GLP+S+ + V+  +   PV  EF+ V +   
Sbjct: 137 VSWAINKRINNFITRFPDALELLVRGLRSGLPISETLVVVANELPGPVSEEFKIVTDRIR 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG ++ +++      + L E SFF   +++Q + GGNL+E LANL+ +LR R  MK K++
Sbjct: 197 LGRTMEDALQETADRLDLAEFSFFCITLAIQRETGGNLAETLANLADVLRKRAQMKLKIK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+GSLPF V  L+Y  +P Y+     D R  +       ++ +G  +M 
Sbjct: 257 AMSSESKASAYIVGSLPFIVFALIYSINPRYLGQFFVDERLMVAGIGGLIWLSMGAFIMS 316

Query: 181 LMINFDV 187
            M+NF++
Sbjct: 317 RMVNFEI 323


>gi|300856046|ref|YP_003781030.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
 gi|300436161|gb|ADK15928.1| putative type II secretion system protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 320

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K R   F  +    + II  S++AG     A+AV+  ++SDP   EF+++++   
Sbjct: 134 IRKRKKDRIKHFDSELNEGITIISNSLKAGYSFLQAIAVVSEETSDPFSKEFKKLLKEMS 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+S  +++  ++  +  +++     VI +Q  +GGNLSE L N+S  +R+R+ +K++++
Sbjct: 194 LGISEEDALKNLLSRVESEDLRLIVNVILIQKDIGGNLSEVLDNISETIRERQKIKSELK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+  +P  +   +Y  +  Y+ +L     G +++  A     +G++++R
Sbjct: 254 TLTAQGRLSGIILMLIPIFLGVTIYLFNKEYILLLFTTSIGLIMVAAAVLSEFLGLLIIR 313

Query: 181 LMINFDV 187
            +IN D+
Sbjct: 314 KIINIDM 320


>gi|294140781|ref|YP_003556759.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
 gi|293327250|dbj|BAJ01981.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
          Length = 325

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR      DFP+ LD+I R+++AG   +DA+ +   +   P+  EF+ +    +
Sbjct: 139 LNRDTNKRMDTIEADFPDGLDVIRRALQAGYSFTDAIKLATEELEGPLAKEFKLMFVNIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               +  ++   ++ +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+
Sbjct: 199 YTKDIKRALLGFIQRVPSVSALAFASAVMVQRETGGNLAENIENLTRVIRQRFKFRRRVK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+  LPF +  ++Y  +P Y+  L     GH LL   A  M IG   + 
Sbjct: 259 TLSAEGRLSAWILILLPFVLFAVIYLQTPSYVGELTGTEAGHKLLMWGAVGMTIGGWWIS 318

Query: 181 LMINFDV 187
            +I  DV
Sbjct: 319 RIIKIDV 325


>gi|332188385|ref|ZP_08390110.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
 gi|332011614|gb|EGI53694.1| bacterial type II secretion system F domain protein [Sphingomonas
           sp. S17]
          Length = 327

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 68/187 (36%), Positives = 117/187 (62%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +RT KF+  FP+A++++VR +R+GLP+++ ++V+  +   PV  EFR V +   
Sbjct: 141 VSMTINRRTTKFIARFPDAIELLVRGLRSGLPITETMSVVGQEIPGPVGDEFRAVSDRMK 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++  ++      +   E  FF   I++Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 201 IGRTMDAALQETADRLETPEFQFFVIAIAIQRETGGNLAETLSNLAEVLRKRAQMKLKIK 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+IIG+LPF V  +++  +  YM     DPR  ++ G    +M +G+ +M 
Sbjct: 261 AMSSESKASAYIIGALPFVVFAMIWMINAPYMARFFVDPRLMIIGGGGLLWMALGVFIMS 320

Query: 181 LMINFDV 187
            MINF++
Sbjct: 321 RMINFEI 327


>gi|157375502|ref|YP_001474102.1| Flp pilus assembly protein TadB [Shewanella sediminis HAW-EB3]
 gi|157317876|gb|ABV36974.1| conserved hypothetical Flp pilus assembly protein TadB [Shewanella
           sediminis HAW-EB3]
          Length = 325

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR       FP+ALD++ R+++AG   SDA+ +   +   P+  EF+ +    +
Sbjct: 139 LSRDTNKRMDAIEASFPDALDVVRRALQAGYSFSDAIKLATEELEGPIAKEFKLMFANIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               +  ++   +  +P      F++ + VQ + GGNL+E + +LSR++R+R   + +V+
Sbjct: 199 YTKDVKRALLGFIERVPSISAMAFASAVMVQKETGGNLAENIESLSRVIRERFTFRRRVK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+  LPF +  ++Y  +P Y+  L     G  LL   A  M IG   + 
Sbjct: 259 TLSAEGRLSAWILILLPFVLFAVIYLQTPSYVGELTGTEGGKKLLMWGAIGMTIGGWWIS 318

Query: 181 LMINFDV 187
            +I  D+
Sbjct: 319 KIIRIDM 325


>gi|163738366|ref|ZP_02145781.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742217|ref|ZP_02149605.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384547|gb|EDQ08928.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388287|gb|EDQ12641.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 322

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ +EF  + +   
Sbjct: 136 VNKKAAKRMAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVANEVEDPLATEFGVIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P      +    PGY + +I+ P       V  A + + + VMR
Sbjct: 256 AITAEAQWSGKFLSGFPLFCLGGILAKDPGYYDSVIDHPWFIPACFVVGAMLTVNLFVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 MLTNIKV 322


>gi|89899610|ref|YP_522081.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89344347|gb|ABD68550.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 322

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 61/173 (35%), Positives = 106/173 (61%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
            FP ALD++ R++RAG     AV ++  + +DP+  +FR + +  + G+  +++++ +  
Sbjct: 150 QFPEALDLMSRAMRAGHSFPSAVKMVADEMTDPLGHDFRVLFDEMNYGVPTNDALANLAE 209

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P+ +VS+F   + +Q + GGNL+E L  +S I+R+R  +  +V+ LS E K SA I+ 
Sbjct: 210 RVPVPDVSYFVVAVMIQRESGGNLAELLDKISLIVRERLKLLGEVRTLSAEGKLSAIILT 269

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           +LPF V  +V   +P +M VL  DP G  ++G+A   ML+GI+ MR +I   V
Sbjct: 270 ALPFGVGLVVNLVNPKFMAVLWTDPAGLRMVGLALFMMLLGILWMRSIIRIRV 322


>gi|159043674|ref|YP_001532468.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
 gi|157911434|gb|ABV92867.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
          Length = 322

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R A   +  P+A++++VRS+R G P S A+ ++  + +DP+ +EF  + +   
Sbjct: 136 VNKKAKQRLAMIEEQLPDAVELMVRSLRVGHPFSSAINIVAKEVADPLGTEFGMIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++E++  +   M +Q++ F +  +S+QSQ GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVTEALKELAERMDMQDLRFLAVAVSIQSQSGGNLAEILDGLAKVIRARFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   PF     +    P Y   + + P       V A F+ I I+ M+
Sbjct: 256 AITAEAKWSGMFLSGFPFLALVGINLMEPDYYADVKDTPAFIPACVVVAVFLTINIIFMK 315

Query: 181 LMINFDV 187
           +M+N  V
Sbjct: 316 MMVNIKV 322


>gi|302343415|ref|YP_003807944.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301640028|gb|ADK85350.1| Type II secretion system F domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 322

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 116/187 (62%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +  KR + F   FP A++++ R++RAG   S  + ++  +  +PV SEF +  E   
Sbjct: 136 VSKIKAKRLSVFESQFPEAVELVGRALRAGHSFSAGLRMVGEELGEPVASEFNKTFEDYS 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G ++ E+++ +VR + L++V FF++ +S+Q + GGNL+E L N++ I+R+R  ++  V+
Sbjct: 196 FGKTMEEALTGLVRRVELEDVKFFASAVSLQRETGGNLTEILDNIAYIIRERFRLQRTVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + S WI+  +P  +  ++Y+++P Y+N+ + +P G  +L   A   ++GI+V++
Sbjct: 256 ALSAEGRLSGWILSLMPPALFAMLYWSTPEYINMALGNPIGQTILLSGACLEVLGIVVIK 315

Query: 181 LMINFDV 187
            +I   V
Sbjct: 316 QIIKMRV 322


>gi|150377236|ref|YP_001313831.1| type II secretion system protein [Sinorhizobium medicae WSM419]
 gi|150031783|gb|ABR63898.1| type II secretion system protein [Sinorhizobium medicae WSM419]
          Length = 332

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 93/186 (50%), Positives = 131/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R AKF  +FPNA+D+IVR ++AGLP+ D + VI  ++ +PV+ EF  +++ Q 
Sbjct: 146 VNIKRNARFAKFTAEFPNAVDVIVRGLKAGLPMPDCLRVIATEAQEPVKGEFLAIVQDQT 205

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++ RM   MPL E  FF+ VI++QS+ GG+LSEAL NLS++LR+RK MKAK++
Sbjct: 206 LGIPVDEAVKRMSERMPLAEAHFFAIVIAIQSRTGGSLSEALGNLSKVLRERKKMKAKIK 265

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAK+SA IIG+LPF V+  VYF SP YM +L     G ++L     +M IGI+VMR
Sbjct: 266 AMSSEAKSSAGIIGALPFLVAGAVYFASPDYMALLFATVTGKIVLVGCGLWMGIGILVMR 325

Query: 181 LMINFD 186
            MINFD
Sbjct: 326 KMINFD 331


>gi|327543263|gb|EGF29696.1| Flp pilus assembly protein TadB [Rhodopirellula baltica WH47]
          Length = 321

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 102/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              K+R  +F +  P AL+++ RS+RAG  ++    ++  +   P+ +EFRR  E Q  G
Sbjct: 137 FKRKRRLKRFGEQIPEALELLGRSLRAGHSLNAGFGLVGDEMEAPLATEFRRCFEEQKFG 196

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L ESI  M   +P  ++ FF+T + +Q Q GG+LSE L  +  ++R+R  +   +QAL
Sbjct: 197 IPLDESIEDMAERVPNMDLRFFATAVILQRQTGGDLSEILDKIGHLVRERLQILGTIQAL 256

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + S  ++ +LP  +  ++   +  Y+ +L  D  G M LG+A    ++G + ++ +
Sbjct: 257 TGEGRMSGAVLLALPPVLFLVMLKINAEYVLMLFTDELGRMALGMALVTQVLGALAIKKI 316

Query: 183 INFDV 187
           I   V
Sbjct: 317 ITIKV 321


>gi|328545275|ref|YP_004305384.1| Bacterial type II secretion system protein F domain [polymorphum
           gilvum SL003B-26A1]
 gi|326415017|gb|ADZ72080.1| Bacterial type II secretion system protein F domain [Polymorphum
           gilvum SL003B-26A1]
          Length = 339

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 88/186 (47%), Positives = 132/186 (70%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   FL++ PNA+DIIVR V+AGLP+ D + ++  ++ DPV  EFR+++E Q 
Sbjct: 153 LARRRRKRFDAFLNELPNAVDIIVRGVKAGLPLGDCIKIVASEARDPVAGEFRKIVEAQV 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L+E++ R+   +PL E +FF+ V+++Q Q GG LSEAL NL ++LR RK +K K++
Sbjct: 213 MGLTLTEAVGRLPDRVPLAEANFFAIVVAIQQQAGGGLSEALGNLGKVLRGRKTLKGKIR 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EAK+SA IIGSLPF VS ++Y  +P Y+ +L  +  G+M++     +M IG MVM+
Sbjct: 273 ALSSEAKSSAAIIGSLPFIVSLILYLIAPDYIMLLFTETAGNMIIAGGLLWMFIGSMVMK 332

Query: 181 LMINFD 186
            MINFD
Sbjct: 333 NMINFD 338


>gi|254476377|ref|ZP_05089763.1| type II secretion system protein [Ruegeria sp. R11]
 gi|214030620|gb|EEB71455.1| type II secretion system protein [Ruegeria sp. R11]
          Length = 322

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR +   +  P+A++++VRS+R G P + AV ++  +  DP+ +EF  + +   
Sbjct: 136 VNKKAAKRMSMIEEQLPDAVELMVRSLRVGHPFASAVQIVANEVEDPLATEFGIIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKEMAERLDMQDMRFLAVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P      +    PGY + +I+ P       V  A + + + VMR
Sbjct: 256 AITAEAQWSGKFLSGFPLFCLGGILAKDPGYYDSVIDHPWFIPACFVVGAMLTVNLFVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 MLTNIKV 322


>gi|17545370|ref|NP_518772.1| tight adherence TadB-related transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17427662|emb|CAD14181.1| probable pilus assembly tadb transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 325

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 96/185 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR  +  +  P A D++ R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 RCRAKRLLRLEEQLPEAADLLSRALRAGHSLPSALDMAGSELPAPIGAELALVFSEINYG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + ++++++ +   +P++++ +    + +Q + GGNL+E L N+  ++R R  +  KV+ L
Sbjct: 201 VPMNDALAGLTDRVPIEDLHYLVIAVLIQRESGGNLAEILDNVGSLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  V  +VY  +P  ++ L  DP G  +L  A     +G++ +R +
Sbjct: 261 SAEGRMGGWILTLLPPVVGVIVYELNPDLISTLWKDPTGLKMLWYAITMTCVGVIWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|77919351|ref|YP_357166.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
 gi|77545434|gb|ABA88996.1| Flp pilus assembly protein TadB [Pelobacter carbinolicus DSM 2380]
          Length = 325

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 104/177 (58%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
           A+F D  P ALD++ R++R+G  ++  + ++  +   P+ SEF   ++  +LGL+  E+ 
Sbjct: 148 ARFQDQLPEALDLLARALRSGHAMTSGLEMVAAEMDPPISSEFGAAVDEINLGLTFQEAF 207

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
             +   +P  ++ FF+  + +Q + GGN++E L ++SR++R+R   K +V+AL+ E + S
Sbjct: 208 ENLCERVPSTDLRFFAISVIIQRETGGNVAEILDSISRLIRERIQFKRQVKALTAEGRLS 267

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           A ++  LP  +   ++F +  Y+++L  +P G  +L  A    ++G  +++ ++  +
Sbjct: 268 AMVLIGLPIALFGYIFFVNHQYLSLLWTEPLGQYMLAGAIVLQILGAFIIKKIVTIE 324


>gi|116748936|ref|YP_845623.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698000|gb|ABK17188.1| type II secretion system protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 321

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 111/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+R  KF    P ALD++ R+++AG   S  + ++  +  DP+  EF + ++  +
Sbjct: 135 LMSRRKQRMEKFQRQLPEALDLVSRALKAGHAFSGGMKMVADEMDDPIGPEFDKTLDEIN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+S+++++  +   +   ++S+F   + +Q + GGNL++ +A+++ ++R+R  +  +++
Sbjct: 195 FGVSVADALKNLAARVACPDLSYFVVAVLIQRESGGNLADLIASITHLIRERFKLYGRIR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E +ASA I+ ++P  V+  +   S  Y+  L +D  G +L+G+A   M+ G++VMR
Sbjct: 255 VLSAEGRASAIILIAIPIFVAAALLVVSRSYITTLADDRIGRVLIGIAVCMMIFGVVVMR 314

Query: 181 LMINFDV 187
            MI  DV
Sbjct: 315 KMIRIDV 321


>gi|87199098|ref|YP_496355.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134779|gb|ABD25521.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 324

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 114/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I KR   F+   P+ALD++VR +R+GLPV++ + V+  +   PV  EF+ V +   
Sbjct: 138 VGRAINKRIDNFVTRLPDALDLLVRGLRSGLPVTETLGVVAAELPGPVGEEFKLVTDRIK 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ E++      + L E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++
Sbjct: 198 VGRTMEEALQDTADRLNLPEFNFFCITLAIQRETGGNLAETLSNLSDVLRKRAQMKLKIK 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+G+LPF V  L+Y+ +P Y+     D R  +       ++ IG  +M 
Sbjct: 258 AMSSESKASAYIVGALPFIVFALIYWINPVYLGKFFVDERLIIAGLGGLTWLGIGAFIMA 317

Query: 181 LMINFDV 187
            M++F++
Sbjct: 318 KMVSFEI 324


>gi|148557758|ref|YP_001265340.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148502948|gb|ABQ71202.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 324

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 72/187 (38%), Positives = 112/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R A+F+  FP+A++++VR +RAGLP+++ +  +  +   PV SEF+ V +   
Sbjct: 138 LNILAKRRIAQFITRFPDAIELLVRGLRAGLPIAETMGAVASEIEGPVGSEFQAVSDRMR 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G +L  ++      +   E  FF   +++Q + GGNL+E L NL+ +LR R  MK K+ 
Sbjct: 198 IGRTLEGALQETADRLGTAEFQFFVITLAIQRETGGNLAETLGNLADVLRKRMQMKLKIS 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+IIG LPF V  L+ F SP YM     D R  +       +M IG  +MR
Sbjct: 258 AMSSESKASAYIIGVLPFVVFGLISFISPTYMAGFFADQRLMIAGAGGLIWMSIGAYIMR 317

Query: 181 LMINFDV 187
            MINF++
Sbjct: 318 QMINFEI 324


>gi|103486614|ref|YP_616175.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98976691|gb|ABF52842.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 310

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 71/187 (37%), Positives = 112/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IKKR A+F   FP+A+D++VR +R+GLPV++   V+  +   PV  EF+ V+E   
Sbjct: 124 VGMAIKKRVAQFNARFPDAIDLLVRGLRSGLPVTETFQVVSQELPGPVGEEFKGVVERIR 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++  ++      +   E  FF   I +Q + GGNL+E LANLS +LR R  MK K++
Sbjct: 184 IGNTMEAALQETAEMLGTPEFQFFCITIQIQRETGGNLAETLANLSDVLRKRAQMKLKIR 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S EAKASA+I+G+LPF V  +V+  +P Y+     + R  +       +M IG  +M 
Sbjct: 244 AMSSEAKASAYIVGALPFFVFGVVWTVNPSYLAGFFVEQRLIVAGIGGLIWMSIGAGIMA 303

Query: 181 LMINFDV 187
            M+NF++
Sbjct: 304 KMVNFEI 310


>gi|296284555|ref|ZP_06862553.1| hypothetical protein CbatJ_13051 [Citromicrobium bathyomarinum
           JL354]
          Length = 323

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 69/187 (36%), Positives = 121/187 (64%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   +K+RTA+F   FP+A+D++VR +R+GLPV++ +AV+  +   PV  EF+ +IE   
Sbjct: 137 VGFFMKRRTAQFNARFPDAIDLLVRGLRSGLPVTETLAVVAQEIPGPVGIEFKGIIERIK 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ E++      + + E +FF   +++Q + GGNL+E L+NLS +LR R  MK K++
Sbjct: 197 IGRSMEEAMQESADRLGIAEFNFFVIALAIQRETGGNLAETLSNLSDVLRKRAQMKLKIK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E+KASA+I+GSLPF V  ++++ +P Y+     D R  +       +M +G+ +M 
Sbjct: 257 AMSSESKASAYIVGSLPFLVFAMIWWVNPSYLGAFFIDERLMIAGIGGLVWMSLGVFIMS 316

Query: 181 LMINFDV 187
            M++F++
Sbjct: 317 KMVSFEI 323


>gi|170692560|ref|ZP_02883722.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170142216|gb|EDT10382.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 327

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 103/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              +KR        P A D+I R++RAG   S A+ ++  + ++P+  EFR V +  + G
Sbjct: 143 RARRKRLRVLERQLPEAADMISRALRAGHSFSSALGMLGSEFAEPMAGEFRIVFDEINYG 202

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L+E++  +   +P+ ++ +F   + +Q + GGNL+E L +++ ++R R  +  KV+ L
Sbjct: 203 VTLNEALLNLATRVPVGDLRYFVIAVLIQRETGGNLAEILDSIASLVRARLQLFDKVRVL 262

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + S WI+  LPF  +  +   +P + +VL  DP G  ++      M++GI+ MR +
Sbjct: 263 SAEGRLSGWILALLPFASAGAMQVVNPTFFSVLWEDPAGLQIIETMLVSMVLGILWMRRI 322

Query: 183 INFDV 187
           +   V
Sbjct: 323 VQIRV 327


>gi|255263835|ref|ZP_05343177.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255106170|gb|EET48844.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 322

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR A   +  P+A++++VRS+R G P + AVA++  +  DP+ SE   + +   
Sbjct: 136 VNNKAKKRLALIEEQLPDAVELMVRSLRVGHPFTSAVAIVAKEVPDPLGSEMGVISDEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKAMAERLEMQDMRFLAVAVTIQQQAGGNLAEILHGLAQVIRARFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P     ++    P Y + +           V A F++  + VMR
Sbjct: 256 AITAEAKWSGMFLSLFPLGALVMINVIQPNYYDAVSETSVFIPACLVVAGFLVANMFVMR 315

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 316 MLVNIKV 322


>gi|300692335|ref|YP_003753330.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum PSI07]
 gi|299079395|emb|CBJ52066.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum PSI07]
          Length = 325

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/177 (27%), Positives = 92/177 (51%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P A D++ R++RAG     A+ +   +   P+ SEF  V    + G+ + E+++
Sbjct: 149 KLEAQLPEATDLLARALRAGHSFPSALDMAGSELPAPIASEFALVFSEINYGVPMGEALA 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
              R +P++++ F    + +Q + GGNL+E L N+  ++R R  +  K++ LS E +   
Sbjct: 209 AFSRRVPIEDLRFLVIAVLIQRESGGNLAEILDNIGTLIRKRLQLLDKIRVLSAEGRLGG 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+  +P  +  L+YF +P  ++ L   P G  LL  A     +G++ +R ++   V
Sbjct: 269 WILSLMPPVLGVLMYFLNPTLVSSLWTHPLGIQLLWAAIIMTGVGMLWIRHLVRIHV 325


>gi|225174957|ref|ZP_03728954.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169597|gb|EEG78394.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 322

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/181 (30%), Positives = 101/181 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R     +  P AL+II   +RAG     A+AV+  +   P+  EF RV+    LG S+ 
Sbjct: 142 RRMQALNNQLPEALNIISSGLRAGYSFPQAMAVVGREMDAPIADEFNRVLRDNRLGKSMD 201

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  M      +++    T + +Q Q+GGN++E L  +   +R+R  +K +++AL+ + 
Sbjct: 202 DALLEMTARTDNEDLDLVVTSLLIQRQVGGNMAEVLNKIEHTIRERMRIKGEIRALTAQQ 261

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SA II  LP  V+ L+   +P YM  L+ +P G M+L +A    ++GIM++R ++  +
Sbjct: 262 RMSAVIIVLLPIAVALLLLVINPEYMLTLVTEPIGIMVLSIAVIMQIVGIMIIRRIVQIE 321

Query: 187 V 187
           V
Sbjct: 322 V 322


>gi|323529409|ref|YP_004231561.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386411|gb|ADX58501.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 327

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 104/185 (56%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR        P A D+I R++RAG   S A+ ++  + ++P   EFR V +  + G
Sbjct: 143 RARSKRLRLLERQLPEAADMISRALRAGHSFSSAIGMLGNEFAEPTGGEFRIVFDEINYG 202

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L+E++  +   +P++++ FF   + +Q + GGNL+E L  ++ ++R+R  +  +V+ L
Sbjct: 203 VTLNEALLNLATRVPVRDLRFFVIAVLIQRETGGNLAEILDGIASLVRERLRLFDQVRVL 262

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWIIG LPF  +  +   +P +++VL  DP G  ++      M+ G++ MR +
Sbjct: 263 SAEGRLSAWIIGLLPFAAAGGMNLLNPSFLSVLWEDPAGLKVIEAVLVSMVFGVLWMRRI 322

Query: 183 INFDV 187
           +   V
Sbjct: 323 VRIRV 327


>gi|253996762|ref|YP_003048826.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983441|gb|ACT48299.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 322

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 105/184 (57%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             +KR        P+ALD++ R++ AG     A+ ++  +  +P+ SEFR V +  + G+
Sbjct: 139 AKQKRINTIEQQLPSALDLMGRAMVAGHAFPSALQMVGTEMPEPIASEFRIVFDEINYGI 198

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
             SE++  +++ +P  +VS+F   + +Q + GGNL+E L N+S ++R R  +   V+ LS
Sbjct: 199 PTSEALMNLIQRVPSTDVSYFVIAVLIQRETGGNLAELLGNISELIRARLKLLGSVRVLS 258

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+  LPF +  ++   +P ++++L  DP G  ++ +A   M+ GI VM  +I
Sbjct: 259 AEGRLSAWILTLLPFALGAVLQLVNPKFLSILWTDPNGLKMVIIALILMVFGIFVMWRII 318

Query: 184 NFDV 187
              V
Sbjct: 319 KIRV 322


>gi|187251610|ref|YP_001876092.1| TadB [Elusimicrobium minutum Pei191]
 gi|186971770|gb|ACC98755.1| TadB [Elusimicrobium minutum Pei191]
          Length = 535

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+L ++R  K  +   ++L ++  S++AG+ +  A  ++      P+  EF  VI+   
Sbjct: 349 LKNLKRRRGTKINNQLMDSLILLSNSLKAGMDIVQAFEMVSKDMKPPIADEFGLVIKNYQ 408

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  +++  M   +  + +S+    I +Q Q+GGNL++    +   +R+   ++ K+Q
Sbjct: 409 LGSSFEQALEMMEDRVENRLLSYMIKAIVLQRQVGGNLTKIFERIVETIREESKLEEKLQ 468

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ + +  + ++G +P+ + ++++   P  M        G ++L     ++L+G+ ++ 
Sbjct: 469 AMTAQQRIQSIVVGIMPWLMISVMFLFRPDAMINFYTSGIGLIVLFFCIFWILMGMKMVS 528

Query: 181 LMINFDV 187
            +    V
Sbjct: 529 KLGEIKV 535


>gi|188581664|ref|YP_001925109.1| type II secretion system protein [Methylobacterium populi BJ001]
 gi|179345162|gb|ACB80574.1| type II secretion system protein [Methylobacterium populi BJ001]
          Length = 323

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 90/187 (48%), Positives = 136/187 (72%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R A F+++ PNA+D++VR +R+G+P+ D + +I  ++ +P+RSEFR  +E Q 
Sbjct: 137 LKWRQKRRVAAFVEELPNAMDVVVRGLRSGIPLGDCLRMISREAKEPLRSEFRVAMEAQA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL +S++I RM   +P+ EV+FFS VI +Q + GGNLSEAL+NLSR+LR+RK M  K+Q
Sbjct: 197 MGLPMSDAILRMYERVPVTEVNFFSIVIGIQQKAGGNLSEALSNLSRVLRERKKMAGKIQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF +    Y +SP Y ++L     G + L ++  +ML G++VM+
Sbjct: 257 AMSMEAKASAGIIGALPFLIGGGTYLSSPDYTSLLWTTSVGKIALVISGLWMLAGVLVMK 316

Query: 181 LMINFDV 187
            MI+FDV
Sbjct: 317 KMISFDV 323


>gi|170740617|ref|YP_001769272.1| type II secretion system protein [Methylobacterium sp. 4-46]
 gi|168194891|gb|ACA16838.1| type II secretion system protein [Methylobacterium sp. 4-46]
          Length = 322

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 88/187 (47%), Positives = 141/187 (75%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R A+F+ + PNA+D+IVR +++GLPV D + +I  ++ +PVR+EFR ++E+Q 
Sbjct: 136 LGYLRKRRIARFVLELPNAMDVIVRGIKSGLPVGDCLRIIAREAPEPVRTEFRALVESQA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SLSE+ +++   MP+ E +FF+ VI +Q++ GGNLSEAL NLSR+LRDR+ M  KV 
Sbjct: 196 VGVSLSEAATKLFERMPVSEANFFAIVIGIQAKSGGNLSEALGNLSRVLRDRRRMADKVS 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEA+ASA II SLPF V+ L YF+SP Y+++L     G + + ++  +M++G++VM+
Sbjct: 256 AMSMEARASAAIIASLPFVVAVLCYFSSPDYISLLWTTQVGQIAITLSGLWMVVGVLVMK 315

Query: 181 LMINFDV 187
            MI F++
Sbjct: 316 RMITFEI 322


>gi|284991839|ref|YP_003410393.1| Type II secretion system F domain-containing protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284065084|gb|ADB76022.1| Type II secretion system F domain protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 310

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 93/186 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R A F D   ++L ++  S+RAG  +  AV  +  +++ P   EF R++    
Sbjct: 124 LGLKRGRRQAAFADQLDDSLQLMASSLRAGHSLLRAVDAVSTEAAAPTSEEFARIVNETR 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L +++  +   M   +  + +  I +  ++GGNL+E L  +   +R+R  ++ +V+
Sbjct: 184 VGRDLGDALDEVAERMDSDDFRWVAQAIGIHREVGGNLAEVLDTVGHTIRERNAIRRQVK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E K SA ++ +LPF +   +  T+P Y+        G++++      + +G + ++
Sbjct: 244 ALSAEGKLSAVVLMALPFGIVGFLSVTNPAYLAGFTEGLAGYLMIAAVVVLLTVGGLWLK 303

Query: 181 LMINFD 186
             +   
Sbjct: 304 KTVAIR 309


>gi|283852077|ref|ZP_06369351.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
 gi|283572467|gb|EFC20453.1| type II secretion system protein [Desulfovibrio sp. FW1012B]
          Length = 327

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 113/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A F    P AL+++ R+++AG   S  + ++V + ++P+R EF++ +E  +
Sbjct: 141 IAMRKAKRMAAFETQLPEALELVGRALKAGHTFSSGMGMVVSEFAEPIRGEFQKTMEEVN 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ ++ ++  ++  +   +++FF   + +Q++ GGNL+E + N++ ++R+R  +K +++
Sbjct: 201 FGMGVTVALDNLMERVDCPDLNFFVISVKIQNETGGNLAEIVENIAWLIRERIKLKGRIR 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + +AW++  LPF V   V   +PGY+N+L  +  G   L + A  M +G++V+R
Sbjct: 261 VLSAEGRMAAWVLCLLPFFVCGAVQMLNPGYLNLLFTEALGRFFLYLVAGLMTLGVLVIR 320

Query: 181 LMINFDV 187
            M+  DV
Sbjct: 321 KMVRIDV 327


>gi|284048523|ref|YP_003398862.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952744|gb|ADB47547.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 321

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 91/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I +R   F     + L ++  S+RAG      + +I  +   P+ +EF  V+    
Sbjct: 135 LQRRISRRKEAFERQLADCLTLVSNSLRAGFSFLQTMEIISREMQPPMSTEFANVMRNTS 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG ++ +++  M + +  ++ S   T + +Q Q+GGNL+  L  +   + +R  ++ +V 
Sbjct: 195 LGRTMEDALQEMDQRVGNEDFSLVITAVLIQQQVGGNLATILDTIRETISERIRLRREVG 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + K S  ++  +P  +      TSP Y+  L+    G M +G A    +IG +++ 
Sbjct: 255 TLTAQGKFSGLVLTCIPVALGLFFAVTSPEYLKPLLTTSIGKMAIGAAVVMEIIGYLIIS 314

Query: 181 LMINFDV 187
            +++  +
Sbjct: 315 RIVDIKI 321


>gi|307726379|ref|YP_003909592.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307586904|gb|ADN60301.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 327

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 102/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               KR        P A D+I R++RAG   S A+ ++  + ++P   EFR V +  + G
Sbjct: 143 RARSKRLRVLERQLPEAADMISRALRAGHSFSSAIGMLGNEFAEPTGGEFRIVFDEINYG 202

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L+E++  +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  +V+ L
Sbjct: 203 VTLNEALLNLATRVPVSDLRYFVIAVLIQRETGGNLAEILDGIASLVRERLRLFDQVRVL 262

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWIIG LPF  +  +   +P +++VL  DP G  L+      M  G++ MR +
Sbjct: 263 SAEGRLSAWIIGLLPFAAAGAMNLLNPSFLSVLWEDPAGLKLIEAVLVSMAFGVLWMRRI 322

Query: 183 INFDV 187
           +   V
Sbjct: 323 VRIRV 327


>gi|167566942|ref|ZP_02359858.1| Flp pilus assembly protein TadB [Burkholderia oklahomensis EO147]
 gi|167574011|ref|ZP_02366885.1| Flp pilus assembly protein TadB [Burkholderia oklahomensis C6786]
          Length = 325

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 60/177 (33%), Positives = 104/177 (58%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P+A D+I R++RAG   S A++++ G+ ++P+  EFR   +  + G+ L E++ 
Sbjct: 149 KLERQLPDACDMIARALRAGHAFSSAISMVGGEFAEPMGGEFRITFDEINYGVPLQEALL 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +P+ ++ +F   + +Q + GGNL+E L  ++ ++R+R  +  KV+ LS E K SA
Sbjct: 209 NLATRVPVSDLRYFVIAVLIQRETGGNLAELLDGIALLIRERFKLFDKVRVLSAEGKLSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+  LPF  + L+   +P ++ VL  DP G +L+GV    M  GI+ MR +I   V
Sbjct: 269 WILTLLPFGTAALLAIMNPDFIAVLWQDPAGVLLVGVTITSMAFGIVWMRYIIRIRV 325


>gi|83943935|ref|ZP_00956392.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83954508|ref|ZP_00963219.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840792|gb|EAP79963.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845182|gb|EAP83062.1| type II/IV secretion system protein, TadC subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 320

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR     +  P+A++++VRS+R G P + A++++  +  DP+ SEF  + +   
Sbjct: 134 ISSKAKKRMDMIEEQLPDAVELMVRSLRVGHPFTSAISIVSKEIQDPLASEFGVIADETA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 194 YGRDIGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVR 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + ++  P           F+ + ++VMR
Sbjct: 254 AITAEAKWSGKFLSAFPILALIVIKLGDPHYYDEVMTHPLFIPGCIAVVLFLSLNLIVMR 313

Query: 181 LMINFDV 187
            + +  V
Sbjct: 314 KLTDIKV 320


>gi|77462449|ref|YP_351953.1| putative Flp pilus assembly protein TadB [Rhodobacter sphaeroides
           2.4.1]
 gi|126461327|ref|YP_001042441.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638312|ref|YP_002524574.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
 gi|77386867|gb|ABA78052.1| Putative Flp pilus assembly protein TadB [Rhodobacter sphaeroides
           2.4.1]
 gi|126102991|gb|ABN75669.1| type II secretion system protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159093|gb|ACM00073.1| Type II secretion system protein [Rhodobacter sphaeroides KD131]
          Length = 322

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +   
Sbjct: 136 VNGKAKKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVAECIRAFAERMESQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P      +    P Y + +   P       V  AF++  ++ M+
Sbjct: 256 AITAEAKWSGTFLSAFPIVALVAISILKPDYYDGVKETPLFIPAALVVGAFLIANVIFMK 315

Query: 181 LMINFDV 187
           +M+N  V
Sbjct: 316 IMVNIKV 322


>gi|319782177|ref|YP_004141653.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168065|gb|ADV11603.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 322

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 108/185 (58%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +    KR  KF    P+ALD+IVRS+RAG P S A+ ++  +  DP+ +EF  V +    
Sbjct: 137 RRARNKRIRKFAKQLPDALDMIVRSLRAGHPASVAIGLVAREMPDPLGTEFGIVSDEITF 196

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GLS+ +++ ++ + +  + +   S  +S+QS+ GGNL+E LANLS ++R+R+ ++ K++A
Sbjct: 197 GLSIEQAVRKLSQRVGFEGLQLLSVSLSIQSKTGGNLTEILANLSSVMRERQKLRMKIRA 256

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           LS E + SAWII   P  +   +   +P Y   + ++P    +  +   + L+G  +M  
Sbjct: 257 LSAEGRVSAWIISLFPIVMFFTLQILAPTYYGAVWSNPLVFPVFLIFGLWALLGDFIMYR 316

Query: 182 MINFD 186
           M+ FD
Sbjct: 317 MVTFD 321


>gi|254461341|ref|ZP_05074757.1| type II secretion system protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206677930|gb|EDZ42417.1| type II secretion system protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 322

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  KKR +   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +   
Sbjct: 136 ISHKAKKRMSMLEEQLPDAVELMVRSLRVGHPFSSAVQIVAKEVQDPLASEMGVIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   +  Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDVGEALKAMAERLDNQDLRFLAVAVTIQQQSGGNLAEILAGLAQVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   + S P      +    P Y + +++         + AAF+ + ++VMR
Sbjct: 256 AITAEAQWSGKFLSSFPLMALVAIQLGDPNYYDPVLDHEWFIPACFLVAAFLGVNLIVMR 315

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 316 ILVNIKV 322


>gi|313902405|ref|ZP_07835808.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
 gi|313467336|gb|EFR62847.1| Type II secretion system F domain [Thermaerobacter subterraneus DSM
           13965]
          Length = 367

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R   F    P+AL ++  ++++G     A  V+  +   P+  EF  +++   
Sbjct: 181 LARRYQQRLRAFDGQLPDALTLMANALKSGYSFLQAADVVAREMPPPIADEFAWLVKETR 240

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           + + L ++++ ++  +P  ++    T + +Q Q+GGNL+  L   +  +R+R  ++ +++
Sbjct: 241 VNIPLEDALANLLDRVPSADLDLVVTAVLIQKQVGGNLAGVLERTAETIRERVRLQGQIR 300

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S WI+G+LP  +  L+   +P Y+  L+  P G  LLG        G++V+R
Sbjct: 301 TLTAQGRLSGWIVGALPVALLVLLSAMNPAYLQPLLATPLGWTLLGAGVVMEAAGVLVIR 360

Query: 181 LMINFDV 187
            +I  DV
Sbjct: 361 ALIRVDV 367


>gi|126729094|ref|ZP_01744908.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710084|gb|EBA09136.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 321

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 98/184 (53%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             KKR +   +  P+A++++VRS+R G P + A+ ++  +  DP+ +EF  + +    G 
Sbjct: 138 KAKKRLSMIEEQLPDAVELMVRSLRVGHPFTSAITIVSKEIKDPLATEFGIIADESAYGR 197

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            + E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+A++
Sbjct: 198 DIGEALKHMAERLDMQDLRFLAVAVAIQQQAGGNLAEILEGLAKVIRARFRLFRRVKAIT 257

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ S   +   P      +    P Y + +++ P       +    + + ++VMR ++
Sbjct: 258 AEAQWSGKFLSGFPVMALIFIQVAKPDYYDEVLDHPWFIPACFIVGIMLALNMIVMRWLV 317

Query: 184 NFDV 187
           N  V
Sbjct: 318 NIKV 321


>gi|78357407|ref|YP_388856.1| hypothetical protein Dde_2364 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219812|gb|ABB39161.1| membrane protein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 321

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 104/184 (56%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              +R  +F    P+ALD+I R+++AG      + ++  + +DPV  EF+  ++  + G+
Sbjct: 138 RRTRRMNRFHRQLPDALDLIARALKAGHAFPQGMRMVADEFADPVGPEFQITLDEINFGV 197

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S   ++  M R +   ++ FF   +++Q + GGNL+E ++ ++ +LR+R  +  +V+ LS
Sbjct: 198 SPDAALHAMTRRVDCADLRFFVVSVNIQRETGGNLAEIVSGIALLLRERFKLHGRVKVLS 257

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +AWI+ +LPF +  +++  +P +M+ L   P G+MLL  +   M  G + ++ + 
Sbjct: 258 AEGRLTAWILFALPFGIGFIIHLLNPDFMSALYTTPEGNMLLNGSLFLMTAGALALKKLT 317

Query: 184 NFDV 187
              V
Sbjct: 318 TIRV 321


>gi|303241710|ref|ZP_07328207.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590711|gb|EFL60462.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 327

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K  IKKR     D   +A+ +I  S++AG     AV ++  + + P+  EF ++ +  +
Sbjct: 141 IKIKIKKRLRILNDQLNDAIVLISNSLKAGYSFFQAVDIVSKEMTGPMAEEFAQLQKEVN 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +  +++  +V  +   ++    T + +Q Q+GGNLSE L N+S  +R+R  +K +V+
Sbjct: 201 FGTTTEKALENLVTRVTSDDLELVVTAVLIQRQVGGNLSEVLDNISTTIRERIRIKGEVK 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II +LP  +  +++  +  ++ VL  DP G ++LG +    +IGI  + 
Sbjct: 261 TVTAQGRMSGMIIAALPPALGFILFLINKSHVMVLFTDPIGLIILGFSVFMEIIGIYFIS 320

Query: 181 LMINFDV 187
            +++ +V
Sbjct: 321 RIVSIEV 327


>gi|116620535|ref|YP_822691.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223697|gb|ABJ82406.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 323

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR A   + FP +LD + RS+RAG   S ++ ++  + +DP+  EFR +   Q+
Sbjct: 137 VRQKRSKRLATLEEQFPESLDFLARSMRAGHAFSISLEMLGEELADPLGQEFRALFNEQN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  ++      +PL +V FF++ + +Q Q GGNLSE LA L+ ++R+R  +K +V+
Sbjct: 197 LGAPLDTALRNFTTRVPLLDVRFFTSSVLLQKQTGGNLSEILARLAYVIRERFRLKGQVK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S   + +A I+  LP      +   +PGY+  + +D  G  L+G A    ++G   ++
Sbjct: 257 AASAHGRLTATILTLLPVGTMLALLVVAPGYLQGMADDSDGKYLIGGAIVAQVLGNYFIK 316

Query: 181 LMINFDV 187
            +IN  V
Sbjct: 317 RIINIKV 323


>gi|297618077|ref|YP_003703236.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145914|gb|ADI02671.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 329

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++H   +R   F     +AL I+  ++RAG     A+  +  +   P+ +EF   +    
Sbjct: 143 LQHKKGERLKTFNQQLGDALVIMANALRAGFGFQQAMETVRRELPPPISTEFEWTLREIQ 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  ES+  +   +   ++    T + +Q Q+GGNL++ L N+SR +RDR  +K +++
Sbjct: 203 LGSTTEESLLNLCERVKSDDLDMVVTAVLIQRQVGGNLAQILDNISRTIRDRTRIKGEIR 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +  ++   +PGYM   + +P G  LL  AA   L G+ V++
Sbjct: 263 TLTAQGRLSGIIIGLLPIALLFILLILNPGYMTPFLQNPLGLYLLSGAAVSELAGLYVIK 322

Query: 181 LMINFDV 187
            +++ DV
Sbjct: 323 KIVDIDV 329


>gi|260428144|ref|ZP_05782123.1| type II secretion system protein [Citreicella sp. SE45]
 gi|260422636|gb|EEX15887.1| type II secretion system protein [Citreicella sp. SE45]
          Length = 321

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR +   +  P+A++++VRS+R G P S A++V+  +  DP+ +EF  + +   
Sbjct: 135 VNGKARKRLSLIEEQLPDAVELMVRSLRVGHPFSSAISVVSCEIKDPLATEFGIIADEST 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + ES+  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 195 YGRDIGESLKHMAERLDMQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRARFRLFRRVK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   +   P  V  ++  T P Y + +++ P       + A F+ + ++VMR
Sbjct: 255 AITAEAQWSGKFLSGFPVAVLLIIQLTDPHYYDEVLDHPWFIPACFIVAIFLALNLIVMR 314

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 315 MLVNIKV 321


>gi|332560333|ref|ZP_08414655.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
 gi|332278045|gb|EGJ23360.1| Type II secretion system protein [Rhodobacter sphaeroides WS8N]
          Length = 322

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +   
Sbjct: 136 VNGKAKKRMALIEEQLPDAVELMVRSLRVGHPFSSAIQIVAKEVPDPLGTEFGVIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++E I      M  Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVAECIRAFAERMESQDLRFLAVAVTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P      +    P Y + +   P       V  AF++  ++ M+
Sbjct: 256 AITAEAKWSGTFLSAFPIVALVAISILKPDYYDGVKETPLFIPAALVVGAFLIANVIFMK 315

Query: 181 LMINFDV 187
           +M+N  V
Sbjct: 316 IMVNIKV 322


>gi|149178504|ref|ZP_01857092.1| secretion system protein TadB [Planctomyces maris DSM 8797]
 gi|148842619|gb|EDL56994.1| secretion system protein TadB [Planctomyces maris DSM 8797]
          Length = 310

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 96/186 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR     ++ P  +D++ RS  AG  +  A+A++  ++  P+  EFRR      
Sbjct: 124 LHYRRKKRMQTIQEELPEMIDLLARSTHAGASLEQAIAIVGEETKGPLSFEFRRCARQLD 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           + LS+   +  +   + L ++   ++ + +  + GGNL   L  ++ ++RDR N + +++
Sbjct: 184 MNLSVPAVMKSLSSRIQLIDLKILTSTLMLYRKTGGNLPANLERMADVVRDRINYRRQMK 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A +   +ASA ++  +      ++    P +++ L  DP G++LL +A    +IGI+ + 
Sbjct: 244 ASTGAGRASALLMTVVAPVAFVVLLVAFPAHVSNLYTDPIGNILLLIAIVLEVIGILWVS 303

Query: 181 LMINFD 186
            ++  D
Sbjct: 304 TLLRTD 309


>gi|323529157|ref|YP_004231309.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323386159|gb|ADX58249.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 282

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 95/186 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K + KKR        P+AL ++  ++RAG     A+  +V ++  P+  EF  ++    L
Sbjct: 97  KRMHKKRVEAIEKQLPDALLMMSGALRAGASFPTALEAVVHETPPPISQEFDLLMREIRL 156

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L  ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++A
Sbjct: 157 GIDLDIAMRNVEKRIPIPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLTMEGKIKA 216

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + +    ++  LP  +  ++ F  P  M  L   P G   L V     L+G   +  
Sbjct: 217 LTSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTKPVGWATLAVIGVMELLGYFSISK 276

Query: 182 MINFDV 187
           + + DV
Sbjct: 277 ITHIDV 282


>gi|307726637|ref|YP_003909850.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307587162|gb|ADN60559.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 282

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 94/185 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            + KKR        P+AL ++  ++RAG     A+  +V ++  P+  EF  ++    LG
Sbjct: 98  RMRKKRIEVIEQQLPDALLMMSGALRAGASFPTALEAVVHETPPPISQEFDLLMREIRLG 157

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L  ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++AL
Sbjct: 158 IDLDIAMRNVEKRIPVPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLTMEGKIRAL 217

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + +    ++  LP  +  ++ F  P  M  L   P G   L V     L+G   +  +
Sbjct: 218 TSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTQPVGWATLAVIGVMELLGYFSISKI 277

Query: 183 INFDV 187
            N DV
Sbjct: 278 TNIDV 282


>gi|260431088|ref|ZP_05785059.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414916|gb|EEX08175.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 322

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  KKR A   +  P+A++++VRS+R G P   ++ ++  +  DP+ +EF  + +   
Sbjct: 136 VNHKAKKRMALLEEQLPDAVELMVRSLRVGNPFVSSIQIVANEVQDPLGTEFGVIADECA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  + +Q Q GGNL+E LA L++++R R  +  +V 
Sbjct: 196 YGRGVGEALKDMAERLDMQDLRFLAVAVGIQQQSGGNLAEILAGLAKVIRARFRLFRRVN 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y + +++ P            + + ++VMR
Sbjct: 256 AITAEAKWSGKFLSGFPVFCLVFILVKDPNYYDTVLDHPWFIPACFFVGIMLTLNLIVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 ILTNIKV 322


>gi|86137997|ref|ZP_01056573.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
 gi|85825589|gb|EAQ45788.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
          Length = 322

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P +  V ++  +  DP+ +EF  + +   
Sbjct: 136 VNRKAGKRMALIEEQLPDAVELMVRSLRVGHPFNSTVQIVAHEIEDPLATEFGIIADECA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F S  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDIGEALKEMAERLDIQDLRFLSVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   + + P           P Y + +++ P            + + + VMR
Sbjct: 256 AITAEAQWSGKFLSAFPLLALIGTLLKDPNYYDDVMDHPYFIPACFFVGIMLTVNLFVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 VLTNIKV 322


>gi|323702117|ref|ZP_08113785.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
 gi|323532999|gb|EGB22870.1| Type II secretion system F domain [Desulfotomaculum nigrificans DSM
           574]
          Length = 323

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 104/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   +KR AKF     +AL I+  S+R+G     A+ ++  +  +P+  EF R  +   
Sbjct: 137 LRMARQKRLAKFNAQIGDALVIMANSLRSGFSFLQAMDMVRKELPNPISREFGRAFQEMS 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG    E++  M + +   ++    T + +Q Q+GGNL+E L N++  +R+R  +K +++
Sbjct: 197 LGTPTEEALQNMAQRVKSDDLDLVITAVLIQRQVGGNLAEVLDNIADTIRERVRIKGQIR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +++ + + S  +IG LPF ++ L+   SP Y+  L N   G +++  A    +IG++ ++
Sbjct: 257 SITAQGRISGMVIGFLPFALAALMLVISPQYIMTLFNSKIGLIMVASAIFSEVIGVVAIK 316

Query: 181 LMINFDV 187
            +++ +V
Sbjct: 317 KIVDIEV 323


>gi|325964117|ref|YP_004242023.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470204|gb|ADX73889.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 309

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 93/186 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R AKF     + + +++  +R G  V  +V     ++  P   E  R++    
Sbjct: 123 LAILRDRRRAKFEGQLTDTIQMLIGGLRVGHSVLRSVEAAAQEADVPTSEELLRIVNETR 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G     +   +   M  ++  + S  I +  ++GG+L+E L  ++  +R+R  +K +++
Sbjct: 183 IGKDSRLAFEDVAERMDSEDFRWISQAIQINREVGGDLAEVLEQVAGTIRERSEIKGQIR 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +LS E K SA+++ ++P  V+ ++ F + GY+NV +  P G ++L +A     +G   M 
Sbjct: 243 SLSAEGKMSAYVLMAMPVGVAFILAFINSGYLNVFVEKPLGLVMLVMAIVMFTVGGFWMS 302

Query: 181 LMINFD 186
            ++   
Sbjct: 303 RVVKIK 308


>gi|317154601|ref|YP_004122649.1| type II secretion system F domain-containing protein [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944852|gb|ADU63903.1| Type II secretion system F domain protein [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 324

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 115/187 (61%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  +F    P ALD++ R+++AG      + ++  + +DP+  EF + ++  +
Sbjct: 138 LRRLKARRMGRFQAQLPEALDLMSRALKAGHTFGGGMRMVANEFADPIGGEFGKTLDEIN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  +++ +   + ++++ FF   +++Q + GGNL+E +AN++R++R+R  +  KV+
Sbjct: 198 YGMDVDRALANLQLRVDVEDLKFFVVSVNIQRETGGNLAEIIANIARLVRERFALFGKVR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SA ++ +LPF ++ ++YF +P Y+++L  +  G  +   A A M++GI+VMR
Sbjct: 258 VLSAEGRISALLLSALPFFIAGVLYFINPDYISLLWTNELGRSMAWGAVASMIVGIVVMR 317

Query: 181 LMINFDV 187
            M+   V
Sbjct: 318 RMVKIQV 324


>gi|83312844|ref|YP_423108.1| Flp pilus assembly protein TadB [Magnetospirillum magneticum AMB-1]
 gi|82947685|dbj|BAE52549.1| Flp pilus assembly protein TadB [Magnetospirillum magneticum AMB-1]
          Length = 330

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 80/187 (42%), Positives = 122/187 (65%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F   F +ALD++VR +R+GLP+ + +A+I  +  DPV +EFR++ E   
Sbjct: 144 LGMAAGKRLKAFASQFADALDVVVRGIRSGLPLGECIAIIGREMPDPVGAEFRQITEGTR 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L E++ R V  MP+ E+ +F+ V+++Q Q GGNL+E LA LS +LR RK M+ KVQ
Sbjct: 204 IGLTLHEALGRAVERMPMAEMRYFAIVLAIQQQTGGNLAETLAKLSDVLRARKRMRDKVQ 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + EA+ASA IIGSLP  V  ++   +P Y+ +L     G++LL +      +G++VMR
Sbjct: 264 AYAAEARASAAIIGSLPLVVVGMLGLVAPQYIALLFTSDLGNILLAIGVGTEAMGVLVMR 323

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 324 NMINFDI 330


>gi|219850072|ref|YP_002464505.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544331|gb|ACL26069.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 332

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 98/191 (51%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    +R   F +   + + ++  ++R G      + ++  ++ DP  +EFRRV++   
Sbjct: 142 VKVRAAQRVKAFNNQLGDVITMMANALRGGYSFLQTLDMVAREAPDPASTEFRRVVQEVG 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  E++  ++R +P  ++    T +S+Q ++GGNL++ L  +   +R+R  +K ++ 
Sbjct: 202 LGRSTEEALQNLLRRVPSDDLDLLVTAVSIQMEVGGNLAQVLDTIGHTIRERVRIKGEIS 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLL-GVAAAFMLIGI 176
            L+ + + S+WII  LP  ++  +   +P YM  L      P+    +   +   + +G 
Sbjct: 262 TLTAQGRISSWIITGLPIGLAAFITVVNPDYMAPLFTFGLPPQAWCCMPVTSLFMIALGY 321

Query: 177 MVMRLMINFDV 187
             ++ +I+ +V
Sbjct: 322 FAIQKIIDIEV 332


>gi|56697923|ref|YP_168294.1| TadC family type II/IV secretion system protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679660|gb|AAV96326.1| type II/IV secretion system protein, TadC subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 322

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR +   +  P++++++VRS+R G P+  A+ ++  +S DP+ +EF  + +   
Sbjct: 136 VNQKAKKRLSLIEEQLPDSVELMVRSLRVGHPLVSAIQIVAKESEDPIATEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F S  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGREVGEALKEMAERLDMQDLRFLSVAVTIQQQSGGNLAEVLAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EA+ S   + + P      +    P Y + +++         V    + + + VMR
Sbjct: 256 AITAEAQWSGKFLSAFPLGALLFILVKDPNYYDGVMDHELFIPACFVVGVMLTMNLFVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 MLTNIKV 322


>gi|325518834|gb|EGC98408.1| flp type pilus assembly protein [Burkholderia sp. TJI49]
          Length = 325

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/177 (29%), Positives = 101/177 (57%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           K     P+  D+I R++R+G   + A+ ++  +  +P+  EFR   +  + G+SL +++ 
Sbjct: 149 KLQRQLPDVCDMIARALRSGHAFTGALGMVGEEFPEPMGGEFRITFDEINYGVSLHDALM 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +P+Q++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS E + SA
Sbjct: 209 NLATRVPVQDLRYFVIAVLIQRETGGNLAELLDSIAGLIRERFKLFDKVRVLSAEGRLSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           WI+G LPF  + L+   +  +++VL  DP G  + G     M+ G+  MR +I   V
Sbjct: 269 WILGLLPFGTAALMALLNRDFLSVLWEDPAGVRMTGTMLVSMVFGLFWMRRIIRIRV 325


>gi|46580528|ref|YP_011336.1| hypothetical protein DVU2123 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449947|gb|AAS96596.1| membrane protein, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234267|gb|ADP87121.1| Type II secretion system F domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 321

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 108/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R A+F    P+ALD++ R++RAG   +  + ++  +  DP+  EF++V++  + G
Sbjct: 137 RKRARRMARFQRQLPDALDLVGRALRAGHAFNQGMRMVADEFEDPIGPEFQKVLDEINYG 196

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +    ++  +VR +   ++ FF   +++Q + GGNL+E +  ++R++R+R  +  +V+ L
Sbjct: 197 VPADTALINLVRRVDCPDLKFFVVSVNIQRETGGNLAEIVTGIARLIRERFKLAGRVRVL 256

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +AWI+ +LPF +  ++   +P +M+VL   P G++L+  +   M IG + ++ M
Sbjct: 257 SAEGRLTAWILLALPFGIGIIINMLNPDFMSVLYETPEGNLLMTGSLFQMTIGAIALKRM 316

Query: 183 INFDV 187
               V
Sbjct: 317 TTIRV 321


>gi|294012232|ref|YP_003545692.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675562|dbj|BAI97080.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 333

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  K  + FP ALD  VR +RAG P++ A+ ++  +  DP+ SEF  V++   
Sbjct: 147 LTRLAQRRRKKMEEQFPVALDTFVRGLRAGHPIAAALDLLTKEMRDPIGSEFGIVVDEVT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L +++ RM     + E+  F   +SVQS+ GGNL+E L NLS ++R+R ++  KV+
Sbjct: 207 YGSDLRDALQRMAERWDMNEMHMFVISLSVQSETGGNLAEILENLSTVIRERASLFMKVR 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + +A ++ +LP      ++  +P +   +  D    +         LIG   +R
Sbjct: 267 ALSSEGRMTAVMLTALPILAFVGLFLVNPAFYLDVAQDSMFIIGFVGLIVLYLIGFFTIR 326

Query: 181 LMINFDV 187
            M++  V
Sbjct: 327 RMVDLKV 333


>gi|120602155|ref|YP_966555.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
 gi|120562384|gb|ABM28128.1| type II secretion system protein [Desulfovibrio vulgaris DP4]
          Length = 321

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 108/185 (58%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R A+F    P+ALD++ R++RAG   +  + ++  +  DP+  EF++V++  + G
Sbjct: 137 RKRDRRMARFQRQLPDALDLVGRALRAGHAFNQGMRMVADEFEDPIGPEFQKVLDEINYG 196

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +    ++  +VR +   ++ FF   +++Q + GGNL+E +  ++R++R+R  +  +V+ L
Sbjct: 197 VPADTALINLVRRVDCPDLKFFVVSVNIQRETGGNLAEIVTGIARLIRERFKLAGRVRVL 256

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +AWI+ +LPF +  ++   +P +M+VL   P G++L+  +   M IG + ++ M
Sbjct: 257 SAEGRLTAWILLALPFGIGIIINMLNPDFMSVLYETPEGNLLMTGSLFQMTIGAIALKRM 316

Query: 183 INFDV 187
               V
Sbjct: 317 TTIRV 321


>gi|46204164|ref|ZP_00050408.2| COG4965: Flp pilus assembly protein TadB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 188

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 91/187 (48%), Positives = 134/187 (71%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+R A F+++ PNA+D+IVR +R+G+P+ D + +I  ++ +P+RSEFR  +E Q 
Sbjct: 2   LSRLQKRRVAAFVEELPNAMDVIVRGLRSGIPLGDCLRMISREAKEPLRSEFRIAMEAQA 61

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL++ ++I RM   +P+ EV+FF+ VI +Q + GGNLSEAL NLSR+LR+RK M  K+Q
Sbjct: 62  LGLAMPDAILRMCERVPVTEVNFFAVVIGIQQKSGGNLSEALGNLSRVLRERKKMAGKIQ 121

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+SMEAKASA IIG+LPF V+   Y +SP Y  +L     G + L ++  +M +GI VM+
Sbjct: 122 AMSMEAKASAVIIGALPFFVALATYLSSPDYTALLWTTAVGKIALVLSGLWMALGIFVMK 181

Query: 181 LMINFDV 187
            MI+FDV
Sbjct: 182 KMISFDV 188


>gi|292491526|ref|YP_003526965.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580121|gb|ADE14578.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 323

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR  KF +  P ALDI+ R+++AG P  + + V   +  DP+  EFR      +
Sbjct: 137 IRIERDKRIGKFEEQLPEALDIMSRAMKAGYPFVETLHVASEEMRDPLAKEFRTTFADIN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+++  +   +++ +P   +    T + VQ   GGNL+E L  ++ ++R R   + KV+
Sbjct: 197 YGMNIKTAFLSLLQRVPSMSLMAVVTGVLVQRDTGGNLAEILEKIAAVVRGRFRFQRKVR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + E + SAWI+  +PF +S  ++  +P Y+ +L+ +P G  L+ +A   +++G+  MR
Sbjct: 257 TFTAEGRLSAWILTLVPFVLSAALHVINPEYLPMLVKEPLGRTLILLAFINIMVGVFWMR 316

Query: 181 LMINFDV 187
            +I  DV
Sbjct: 317 RIIRIDV 323


>gi|59713407|ref|YP_206182.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
 gi|59481655|gb|AAW87294.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
          Length = 307

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 88/182 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L K+   +F + FP+AL+++  +V AG  +  AV  +       V  EF+R+ E   LG
Sbjct: 122 WLRKREKNRFEESFPDALNMMSSAVSAGEGIMQAVVFVGRSLDGKVGKEFKRMGEQLQLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    Q GG L E +  L+R++   + ++ K  AL
Sbjct: 182 ESPDTVFRKSCERFPYPSFQFFIITLRTSMQRGGQLKEVMKRLNRLMFGARAIEKKKLAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA I+ ++PF    ++ + SP     ++ +P G  +L        IGI+++ L+
Sbjct: 242 TSEARASAKIVAAIPFIFLFMLQYLSPENYEFVMFNPAGRPILYYVLISESIGILIIWLL 301

Query: 183 IN 184
           + 
Sbjct: 302 MR 303


>gi|197118216|ref|YP_002138643.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197087576|gb|ACH38847.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 316

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 105/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR   F +  P+A+ ++ RS+RAG  ++ AV +I  +  +P+   F+   E Q 
Sbjct: 130 LNYHRKKRRRLFAEQLPDAMVMMARSLRAGHSLAAAVELIGLELPEPIGGLFKLAYEQQK 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ +++S+  +   +  Q+ +FF TV  + S+ GGNLSE L  L+  LR R  ++ +V+
Sbjct: 190 LGVRIADSLISLRERVESQDFNFFLTVTRINSESGGNLSEILDKLAETLRSRLQIRRQVE 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ E + S +++ +LP  +   +Y   PGY++V        ++LG A    ++G  ++R
Sbjct: 250 VITAEGRISGYVLVALPVVMFAGLYLLRPGYLDVFFTQRLCQLILGAAVLGQVVGFFIIR 309

Query: 181 LMINFDV 187
            ++N  +
Sbjct: 310 KIVNISI 316


>gi|320101694|ref|YP_004177285.1| type II secretion system F domain-containing protein [Isosphaera
           pallida ATCC 43644]
 gi|319748976|gb|ADV60736.1| Type II secretion system F domain protein [Isosphaera pallida ATCC
           43644]
          Length = 331

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 104/188 (55%), Gaps = 1/188 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + ++ KKR   F    P AL++  R++RAG  +   + ++  + + P+  EF RV E Q+
Sbjct: 144 LNYMKKKRINDFTAAMPEALELTGRALRAGHGLGSGLKMVADEMTGPIAEEFGRVFEEQN 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++  M   +P  +V FF T + +Q Q GG+L E L  +S ++R R  +K +V 
Sbjct: 204 LGIPMEEALRAMANRIPTMDVRFFVTAVVIQRQTGGDLGEVLDKISHLIRQRFEIKGQVA 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP-RGHMLLGVAAAFMLIGIMVM 179
           AL+ E + S  ++ ++P  +   ++ T+  Y+  L  DP  G  +L  AA   ++G + +
Sbjct: 264 ALTGEGRLSGAVLLAMPPLLLLYLFMTNRPYVMPLFTDPELGQPMLIGAAVLQILGALAI 323

Query: 180 RLMINFDV 187
           R +++  V
Sbjct: 324 RKIVDIKV 331


>gi|127511577|ref|YP_001092774.1| type II secretion system protein [Shewanella loihica PV-4]
 gi|126636872|gb|ABO22515.1| type II secretion system protein [Shewanella loihica PV-4]
          Length = 283

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 100/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L K+R  KF+   P+AL++I  S+++G  VS+A+  +  +   P++ EF+  +  Q L
Sbjct: 98  QFLHKRRRRKFVHQLPDALNMIASSMQSGANVSNAIEFMAEEMEAPIKQEFQLFLREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  M + +P +E    +  + +  ++GGNL+E L  LS  LR +  M+ K+ A
Sbjct: 158 GVEFNTALDNMFKRIPEEEFQLVTAGMQISREVGGNLAEVLQRLSATLRKKIEMEGKIDA 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +  ++Y   P  M  ++ +P G  L+ +    +  G + +R 
Sbjct: 218 LTSQGKMQGIVMTLLPVFIGVVLYHMEPSAMGRILTEPMGWALIALVIIMLTSGYLSIRK 277

Query: 182 MINFDV 187
           ++  DV
Sbjct: 278 IVAIDV 283


>gi|119717341|ref|YP_924306.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538002|gb|ABL82619.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 326

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R   F    P  L ++  S+ AGL ++ +   +  + +DPV +EFRR +    
Sbjct: 140 LGVRRGRRRKAFSAAVPETLQLMSGSLSAGLSLAQSAETVTREGADPVAAEFRRALVETR 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L +++  +       ++++    I +Q Q+GGNL+E L  ++  +R+R+ ++ +V 
Sbjct: 200 LGVPLEDALEGVADRFDSADLAWAVMAIRIQRQVGGNLAELLDTVAETMREREYVRRQVA 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAW++GSLP    T +   +  Y+  L  DPRG +LL  AA ++ +G   M 
Sbjct: 260 ALSAEGRLSAWVLGSLPVAFLTYLLLVNREYVMPLFEDPRGIVLLAGAALWLAVGAFWMS 319

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 320 RLVRVEV 326


>gi|218887823|ref|YP_002437144.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758777|gb|ACL09676.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 321

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++     R  +F    P+ALD+I R+++AG   +  + ++  + +DP+  EF++ ++  +
Sbjct: 135 VQRKRNARMGRFQRQLPDALDLIARALKAGHAFNQGMRMVADEFADPIGPEFQKTLDEIN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+    ++  + R +   ++ FF   +++Q + GGNL+E + N++R++R+R  +  +V+
Sbjct: 195 FGIPADAALYNLTRRVDCPDLKFFVVSVNIQRETGGNLAEIVTNIARLIRERFKLAGRVR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + +AWI+  LPF +  ++   +P +M+ L   P G+MLL  +   M IG + ++
Sbjct: 255 VLSAEGRLTAWILFVLPFGIGFIINLLNPDFMSALYATPEGNMLLTASLFQMAIGGIALK 314

Query: 181 LMINFDV 187
            +    V
Sbjct: 315 RLTTIRV 321


>gi|254441335|ref|ZP_05054828.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251413|gb|EDY75728.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 322

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 101/184 (54%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             KKR +   +  P+A++++VRS+R G P S AVA++  +  DP+ +E   + +    G 
Sbjct: 139 KAKKRISMIEEQLPDAVELMVRSLRVGHPFSSAVAIVAKEVPDPLGTEMGVISDEAAYGR 198

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            + ES+ +M   M +Q++ F +  +++Q+  GGNL+E L  LS+++R R  +  +V+A++
Sbjct: 199 DMGESLKQMADRMDMQDMRFLAVAVTIQATAGGNLAEILHGLSQVIRARFKLFRRVKAIT 258

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EAK S   +   P     ++    P Y + +           V AAF+++ ++VMR ++
Sbjct: 259 AEAKWSGMFLSVFPLGALVMINVLQPTYYDAVKETSVFIPACLVVAAFLVVNVIVMRRLV 318

Query: 184 NFDV 187
           N  V
Sbjct: 319 NIQV 322


>gi|320161468|ref|YP_004174692.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995321|dbj|BAJ64092.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 323

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/193 (27%), Positives = 102/193 (52%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    KR  KF +  P+ L+++V  +RAG     A+  +  +   P+  EFRRV++   
Sbjct: 131 VKSQQAKRLVKFNEQLPDMLNLMVNGLRAGYSTMQAMEAVSKELPPPICDEFRRVVQEMQ 190

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + +++  ++R +P  ++    T I+VQ ++GGNL+E L  +S  +R+R  +K +++
Sbjct: 191 LGVPMQQALDNLLRRIPSDDLDLVVTAINVQREVGGNLAEILDTISFTIRERVRIKGEIR 250

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLI------NDPRGHMLLGVAAAFMLI 174
            L+ +   S   +  +P  V  ++Y  +  YM          N P G++ L  AA  ++ 
Sbjct: 251 VLTTQVMYSGRFLAMMPIFVMGVLYLLNRPYMMEFFKPENNANLPCGYIALVCAAILIIS 310

Query: 175 GIMVMRLMINFDV 187
           G +VM  + + +V
Sbjct: 311 GYVVMNKIGDIEV 323


>gi|89068022|ref|ZP_01155439.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046261|gb|EAR52318.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 322

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR +   +  P+A++++VRS+R G P S A+ ++  + +DP+ +E   + +   
Sbjct: 136 VNSKAKKRMSMIEEQLPDAVELMVRSLRVGHPFSSAINIVAKEVADPLGTEMGVIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + ES+  M   M +Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDMGESLKAMAERMDMQDLRFLAVAVTIQQTSGGNLAEILDGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y + ++          V  AF+++ + VMR
Sbjct: 256 AITAEAKWSGMFLSGFPLLALVAINLLQPNYYDDVMETAVFIPACLVVGAFLVVNVFVMR 315

Query: 181 LMINFDV 187
            + N  V
Sbjct: 316 HLTNIKV 322


>gi|187921508|ref|YP_001890540.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187719946|gb|ACD21169.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 282

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + KKR        P+AL ++  ++RAG     A+  +V +++ P+  EF  ++    
Sbjct: 96  LARMRKKRIGTLEKQLPDALLMMSGALRAGASFPSALEAVVHETTPPISQEFDLLMREIR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ +  ++  + + +P+ +    +  +++  ++GGNL+EAL +++R LR++  M+ K++
Sbjct: 156 LGIDMDIAMRNVEKRIPIPDFLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIK 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F  P  M  L  +P G   L V      +G + + 
Sbjct: 216 ALTSQGRMQGIVMTCLPLFLMLVLRFMEPKAMAPLFTEPVGWATLAVIGVMEFLGYVSIS 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 KITNIDV 282


>gi|254486637|ref|ZP_05099842.1| type II secretion system protein [Roseobacter sp. GAI101]
 gi|214043506|gb|EEB84144.1| type II secretion system protein [Roseobacter sp. GAI101]
          Length = 317

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 71/187 (37%), Positives = 114/187 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +  A F  D P ALDI  R +RAG PV+D++A++V  +  P+  EF R  +   
Sbjct: 131 LSIAQSRYKATFAADLPEALDIFARGLRAGRPVTDSMAIVVDNAKGPILREFTRCHDEVR 190

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G +L E++ R+   +PL EV+FF+   ++Q++ GGNL E + NL+  LR+R+ ++ K +
Sbjct: 191 MGNTLPETLERLSARLPLPEVTFFAVATALQAETGGNLIETMENLATQLRERRKLRKKAR 250

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA+ASA I+ +LPF V+ L+   +  Y+  L +DPRG  +   AA+ + +GI VM 
Sbjct: 251 ALSSEARASAVILAALPFAVAVLIAVLNGDYLEPLYSDPRGRFMSVTAASSIGLGIFVMV 310

Query: 181 LMINFDV 187
            M   +V
Sbjct: 311 RMGKLNV 317


>gi|163751751|ref|ZP_02158969.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
 gi|161328403|gb|EDP99562.1| hypothetical Flp pilus assembly protein TadB [Shewanella benthica
           KT99]
          Length = 325

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 95/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR       FP+ LD+I R+++AG   +DA+ +   +   P+  EF+ +    +
Sbjct: 139 LNRDTNKRMDTIEASFPDGLDVIRRALQAGYSFTDAIKLATEELEGPLAKEFKLMFVNIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               +  ++   ++ +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+
Sbjct: 199 YTKDIKLALLGFIQRVPSVSALAFASAVMVQRETGGNLAENIENLTRVIRQRFKFRRRVK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+  LPF +  ++Y  +P Y+  L     G  LL      M+IG   + 
Sbjct: 259 TLSAEGRLSAWILILLPFALFAVIYLQTPAYVGELTGTEAGQKLLMWGGVGMIIGGWWIS 318

Query: 181 LMINFDV 187
            +I  DV
Sbjct: 319 RIIKIDV 325


>gi|121607250|ref|YP_995057.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121551890|gb|ABM56039.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 290

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 60/186 (32%), Positives = 106/186 (56%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + + K+R  KF +  P+AL ++   +RAGL +S A+A +V +S  P+  EF  ++  Q L
Sbjct: 105 RQMRKRRLRKFEEQLPDALMMLSGGLRAGLGLSSAMAQLVAESGPPLSQEFSLMLREQRL 164

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G++L +++S +   MP Q     ++ + + ++ GG L+E L   S  +R R  M+AK+ A
Sbjct: 165 GVTLEQALSNLNHRMPTQTTVLITSAMRIANETGGGLAETLERTSATIRSRLRMQAKIGA 224

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K  AW++G+LP  +  ++    P  M++L +   G   L V A F  +G+ V+R 
Sbjct: 225 LTAQGKLQAWVVGALPIALMLILNEMEPQAMSMLWHTRVGWATLAVIALFEFLGVYVIRK 284

Query: 182 MINFDV 187
           +I  DV
Sbjct: 285 IIAIDV 290


>gi|197117443|ref|YP_002137870.1| Flp pilus assembly protein [Geobacter bemidjiensis Bem]
 gi|197086803|gb|ACH38074.1| Flp pilus assembly protein, putative [Geobacter bemidjiensis Bem]
          Length = 320

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++R+ KF + FP+AL I  RS+RAG     A+ ++  +   PV   F+   E Q 
Sbjct: 134 LRVKTERRSIKFTEQFPDALSIAARSLRAGHSFPTAIQLVGQEVPSPVGPLFKTAYEQQQ 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL + +++ RM   +   ++ FF+T++++ S +GGNLSE L  L+  +R+R  ++ +VQ
Sbjct: 194 LGLRMVDALMRMNERIDSLDLRFFTTLVAINSDIGGNLSELLDKLAMTIRERLKIRRQVQ 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + + + S +++ +LP     +    +P Y   LI +P G  +L  AAA  +IG +V+R
Sbjct: 254 VYTAQGRLSGYVLAALPIATFGIFSVLNPNYERALIREPLGLYVLAGAAAMQIIGFLVIR 313

Query: 181 LMINFDV 187
            ++   +
Sbjct: 314 KIVRIRI 320


>gi|253701803|ref|YP_003022992.1| type II secretion system protein [Geobacter sp. M21]
 gi|251776653|gb|ACT19234.1| type II secretion system protein [Geobacter sp. M21]
          Length = 320

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++RT +F + FP+AL I  RS+RAG     A+ ++  ++  PV   FR   E Q 
Sbjct: 134 LRVKTERRTTRFTEQFPDALSIAARSLRAGHSFPTAIQLVGQEAPSPVGPLFRTAYEQQQ 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL + +++ RM   +   ++ FF+T++++ S +GGNLSE L  L+  +R+R  ++ +VQ
Sbjct: 194 LGLRMVDALMRMNERIDSLDLRFFTTLVAINSDIGGNLSELLDKLAMTIRERLKIRRQVQ 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + + + S +++ +LP     +     P Y   LIN+P G  +L  AAA  ++G +V+R
Sbjct: 254 VYTAQGRLSGYVLAALPIATFGIFSMLHPNYERALINEPLGLYVLIGAAAMQIVGFLVIR 313

Query: 181 LMINFDV 187
            ++   +
Sbjct: 314 KIVRIRI 320


>gi|255020084|ref|ZP_05292155.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970446|gb|EET27937.1| type II secretion system protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 284

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 90/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +L K+R  +  D  P+ L ++  ++R G  +   +  +    S P+  E   V+  Q 
Sbjct: 98  LLYLKKRRFLRLHDQLPDTLLMMASALRGGANLGQTLEGLAKDMSPPMNQELSLVVREQR 157

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+   E++S +   +  Q+     + + +  ++GGNL++ L  L   +R R  M+ K++
Sbjct: 158 LGVPFEEAVSHLAERVRSQDFDLVVSALRINREVGGNLADTLQRLGETVRRRLMMEQKIR 217

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + K    ++ +LP  +   +    P     L +  RG  +L +A    ++G   +R
Sbjct: 218 ALTSQGKLQGIVMTALPVLIILALLRIEPAATGALFDTYRGWAVLAIAIVLEILGYWGIR 277

Query: 181 LMINFDV 187
            +++ +V
Sbjct: 278 KIVSIEV 284


>gi|197337544|ref|YP_002157816.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
 gi|197314796|gb|ACH64245.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
          Length = 307

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 88/182 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L K+   +F + FP+AL+++  +V AG  +  AV  +       V  EF+R+ E   LG
Sbjct: 122 WLRKREKNRFEESFPDALNMMSSAVSAGEGIMQAVVFVGRSLDGKVGKEFKRMGEQLQLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    Q GG L E +  L+R++   + ++ K  AL
Sbjct: 182 ESPDTVFRKSCERFPYPSFQFFIITLRTSMQRGGQLKEVMKRLNRLMFGARAIEKKKLAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA I+ ++PF    ++ + SP     ++ +P G  +L        IGI+++ L+
Sbjct: 242 TSEARASAKIVAAIPFIFLFMLQYLSPENYEFVMFNPAGRPILYYVLISESIGILIIWLL 301

Query: 183 IN 184
           + 
Sbjct: 302 MR 303


>gi|295700366|ref|YP_003608259.1| type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
 gi|295439579|gb|ADG18748.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1002]
          Length = 325

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/177 (31%), Positives = 108/177 (61%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +     P+  D++ R++R+G   + A+ ++  + ++P+  EFR V +  + G+S+SE+++
Sbjct: 149 QLERQLPDVCDMLSRALRSGHAFTGAIDMVGAEFTEPMSGEFRIVFDEINYGVSISEALT 208

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +P++++ +F   + +Q + GGNL+E L  ++ ++RDR  +  KV+ LS E + SA
Sbjct: 209 NLATRVPIRDLRYFVIAVVIQRETGGNLAEVLDGITALIRDRFKLFDKVRVLSAEGRMSA 268

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           W++G LPF V   +   +PG++NVL  DP G  ++  A+  ML GI+ MR ++   V
Sbjct: 269 WVLGLLPFGVGGAMMAINPGFLNVLWRDPAGVRMIAAASVAMLFGILWMRHIVKIRV 325


>gi|258405284|ref|YP_003198026.1| Type II secretion system F domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797511|gb|ACV68448.1| Type II secretion system F domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 323

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 99/176 (56%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F+   P  LD++ RS++AG   +  + +   +  DP+  EF   ++  + G+ + +++ +
Sbjct: 148 FMAQLPEGLDLLARSLKAGHAFTTGMKLAAEEFGDPLGPEFDVALDEINFGVPVPDALRK 207

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           M   +   +++FF   + +Q + GGNL+E + +++ ++R+R     KV+AL+ E   S W
Sbjct: 208 MTYRVDCPDLNFFVVAVIMQRETGGNLAEIIESIATLIRERFKFFGKVKALAAEGVLSMW 267

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           ++  LPF +  ++ F +P Y+ +L  +  GH+++  A   M+IG   MR ++  DV
Sbjct: 268 VLIGLPFAIVGILTFMNPEYITLLFEETMGHIMIAGALIMMIIGYFFMRNIVKIDV 323


>gi|116626773|ref|YP_828929.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229935|gb|ABJ88644.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 325

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 58/185 (31%), Positives = 103/185 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            +  +R  KF +  P+A+D+  R++RAG  +   +  I  ++SDPV+ EF++++E   LG
Sbjct: 141 RVRGRRLHKFEEMLPDAIDLFTRTMRAGHNIHSGLETIATETSDPVKMEFKKLMEELALG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             +  ++  + + +PL ++ FF T + +Q Q G N+   L NLS ++R+R NM AK++A 
Sbjct: 201 SQVEPALHGLGKRVPLIDLKFFITSLILQRQTGANMVSVLENLSTLVRERLNMAAKMKAH 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + + SA ++  LP  V    +   P Y+ +L  DP G      A     +GI+V+R +
Sbjct: 261 TAQQRFSAGLLCCLPLVVGIGFWILKPEYVRLLWTDPVGSKFFTYAIISEFVGILVIRKI 320

Query: 183 INFDV 187
            N  V
Sbjct: 321 ANIKV 325


>gi|156741662|ref|YP_001431791.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232990|gb|ABU57773.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 327

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 101/191 (52%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  K+R  KF     + ++++  S+R+G  +  ++ ++  ++ +P  SE+RRV++   
Sbjct: 137 VGYAAKQRVTKFNAQLGDTINMLANSLRSGYSLLQSMELVSREAPEPTASEYRRVVQEVG 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL   +++  +++ +P +++    T + +Q + GGNL++ L  +   +R+R  +K ++ 
Sbjct: 197 LGLRTEDALDNLLKRVPSEDLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIA 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL--INDPRGHMLL--GVAAAFMLIGI 176
            L+ + + SA++I  LP  ++  +   +P YM+ +     P  H           ++IG 
Sbjct: 257 VLTAQGRISAYVITGLPIGLAIFITVINPNYMSPMFSFGMPPEHWCCLPVAGIVMIVIGF 316

Query: 177 MVMRLMINFDV 187
             +  +++ +V
Sbjct: 317 FAIMKIVDIEV 327


>gi|86360588|ref|YP_472476.1| putative tadB pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284690|gb|ABC93749.1| putative tadB pilus assembly protein [Rhizobium etli CFN 42]
          Length = 317

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 103/184 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  KF    P ALD+  RS+ AG P+  A+A++  +  DP+ +EF  + +    G
Sbjct: 133 RARARRMKKFELKLPEALDVANRSLAAGHPLPAAIALVAREMPDPIGTEFGLLSDELTYG 192

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LR R  +KAKV+A+
Sbjct: 193 VTLDDALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRGRTMLKAKVRAI 252

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +A  +   PF +  ++   SP Y + L +   G  ++ V    M IG +++  M
Sbjct: 253 SSEGRITAIFMSVYPFLLYAMIKALSPTYFDPLWDSGYGTAVVSVLLVVMAIGNVILYKM 312

Query: 183 INFD 186
           +NF+
Sbjct: 313 VNFE 316


>gi|163745842|ref|ZP_02153201.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161380587|gb|EDQ04997.1| type II secretion system protein, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 320

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H   KR +   +  P+A++++VRS+R G P S+A++++  +  DP+ SEF  + +   
Sbjct: 134 VSHKAGKRMSMIEEQLPDAVELMVRSLRVGHPFSNAISIVSKEIQDPLASEFGVIADEAA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 194 YGRDLGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P     ++    P Y + + + P       +   F+++ + VMR
Sbjct: 254 AITAEAKWSGKFLSGFPLAALVVINLGDPHYYDEVRDHPYFIPACFIVGMFLVLNLFVMR 313

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 314 ILTNIKV 320


>gi|254510017|ref|ZP_05122084.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221533728|gb|EEE36716.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 322

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  KKR A   +  P+A++++VRS+R G P   ++ ++  +  DP+ +EF  + +   
Sbjct: 136 VNNKAKKRMALIEEQLPDAVELMVRSLRVGNPFVSSIQIVANEIEDPLATEFGIISDESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +S+Q Q GGNL++ LA L++++R R  +  +V 
Sbjct: 196 YGRDVGEALKDMAERLDMQDLRFLAVAVSIQQQSGGNLADILAGLAKVIRARFRLFRRVN 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y + ++++P            + + ++VMR
Sbjct: 256 AITAEAKWSGKFLSGFPVACLVFILVNDPNYYDTVLDEPYFIPACFFVGFMLTLNLIVMR 315

Query: 181 LMINFDV 187
           ++ N  V
Sbjct: 316 ILTNIKV 322


>gi|78486065|ref|YP_391990.1| type II secretion system protein [Thiomicrospira crunogena XCL-2]
 gi|78364351|gb|ABB42316.1| Flp (type IV) pilus assembly protein, TadC homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 315

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 94/184 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              K+R  +    FP  LD IVR++++G  +  A+++I  +   P+  E + V     LG
Sbjct: 131 FKKKQRQNRLRQQFPEMLDAIVRALQSGYGIDGALSMIAEEFRAPLGKEVKEVNRQLTLG 190

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+ + +      + + E  FF   + +Q + GG L+  L  LSR++R R+  +AK++ L
Sbjct: 191 ISMRDILRDFQTRIEIPEAQFFVVTLIIQRETGGQLAPILEELSRLMRRREMFQAKLKTL 250

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E++ +A  +G  P       YF  P  M   +NDP G  +L ++   M+ G ++++ M
Sbjct: 251 TAESRFTAIFLGLAPLGYLGYKYFFDPDSMAFFLNDPTGQDILIISLVLMISGAIILKSM 310

Query: 183 INFD 186
           +   
Sbjct: 311 LRIK 314


>gi|126737250|ref|ZP_01752985.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721835|gb|EBA18538.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R AK  +  P+A++++VRS+R G P +  V ++  +  DP+ +EF  + +   
Sbjct: 136 VNKKAATRMAKIEEQLPDAVELMVRSLRVGHPFTSTVQIVSDEIEDPLATEFGIIADESA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F S  +++Q Q GGNL+E LA L+ ++R R  +  KV+
Sbjct: 196 YGRDIGEALKEMAERLNIQDLRFLSVAVTIQQQSGGNLAEVLAGLAGVIRARFRLFRKVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P      +    P Y + +++ P            + + ++VMR
Sbjct: 256 AITAEAKWSGKFLSAFPLLALIAILVKDPNYYDSVMDHPYFIPACFAVGIMLAVNLLVMR 315

Query: 181 LMINFDV 187
           ++ +  V
Sbjct: 316 ILTDIKV 322


>gi|148655424|ref|YP_001275629.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567534|gb|ABQ89679.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 327

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 100/191 (52%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  K+R  KF     + ++++  S+R+G  +  ++ ++  ++ +P  SE+RRV++   
Sbjct: 137 VGYAAKQRVTKFNAQLGDTINMLANSLRSGYSLLQSMELVSREAPEPTASEYRRVVQEVG 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL   +++  +++ +P +++    T + +Q + GGNL++ L  +   +R+R  +K ++ 
Sbjct: 197 LGLRTEDALDNLLKRVPSEDLDLLITAVKIQMESGGNLAQILDTIGHTIRERIRIKGEIA 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL--INDPRGHMLL--GVAAAFMLIGI 176
            L+ + + SA++I  LP  ++  +   +P YM  +     P  H           ++IG 
Sbjct: 257 VLTAQGRISAYVITGLPIGLAIFITVINPNYMAPMFSFGMPPEHWCCLPVAGIVMIVIGF 316

Query: 177 MVMRLMINFDV 187
             +  +++ +V
Sbjct: 317 FAIMKIVDIEV 327


>gi|302542848|ref|ZP_07295190.1| putative integral membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302460466|gb|EFL23559.1| putative integral membrane protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 312

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 87/187 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  +F++  P    I+  + +AGL +  A+++   +   P   E  +V     
Sbjct: 126 LNWQRQKRIERFINQLPELSRILANATQAGLALRTALSMAADEMEAPAGEELSKVSAKLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 186 VGHSVDDALGELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTHTLEERKETRREVR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+++  +      L+   SPG ++ +     G   +  A A   IG  ++R
Sbjct: 246 TQLSQVTVTAYVVPLMGIGTLLLMNRISPGSLDRMTASIWGQAAVIAAFALYGIGFFLIR 305

Query: 181 LMINFDV 187
            M   DV
Sbjct: 306 RMSKIDV 312


>gi|84516637|ref|ZP_01003996.1| putative Flp pilus assembly protein TadB [Loktanella vestfoldensis
           SKA53]
 gi|84509673|gb|EAQ06131.1| putative Flp pilus assembly protein TadB [Loktanella vestfoldensis
           SKA53]
          Length = 320

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R     +  P+A+D++VRS+R G P S A+ +   +  DP+ +E   + +   
Sbjct: 134 ISRKATQRINLISEQLPDAVDLMVRSLRVGHPFSSAINIAAKEVPDPLGTEIGIIADETA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   +  Q++ F +  +++Q   GGNL+E L  LS+++R R  +  +V+
Sbjct: 194 YGRDMGETLKAMAERLDNQDLRFLAVAVTIQQSSGGNLAEILDGLSKVIRARFRLFRRVK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S  ++ + P      +    P Y + ++  P       V AAF+++ ++VMR
Sbjct: 254 AITAEAKWSGNLLSAFPILALIGINLVQPNYFDDVMESPMFIPACFVVAAFLVLNLIVMR 313

Query: 181 LMINFDV 187
            + N  V
Sbjct: 314 ALTNIKV 320


>gi|309780756|ref|ZP_07675497.1| TadB protein [Ralstonia sp. 5_7_47FAA]
 gi|308920438|gb|EFP66094.1| TadB protein [Ralstonia sp. 5_7_47FAA]
          Length = 325

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 93/185 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P A D+I R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 HRRTRRLLKLEAQLPEATDLISRALRAGHSLPAALEMAGTELPAPIGAELAIVFSQINFG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+S++ + +   +P+ ++ +    I +Q + GGNL+E L N+ +++R R  +  KV+ L
Sbjct: 201 VSMSDAFAGLTDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  +   +Y  +P  M+ L     G  LL  A     +G++ +R +
Sbjct: 261 SAEGRLGGWILTLLPPVMGLAIYLLNPELMSTLWTTDAGIRLLWFAITMTCLGMLWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|260463898|ref|ZP_05812094.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030273|gb|EEW31553.1| type II secretion system protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 321

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 106/185 (57%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + + K+R  +F    P AL++I R ++AG PV  A+A++  +  DP+ +EF  + +    
Sbjct: 136 RFMRKRRLKRFGMQLPEALELITRGLKAGHPVPVAIAMVSREMPDPIGTEFGVIADEVTY 195

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L  +++ +   +  +++  F T +S+QS  GGNL E L  L+  +R+R  ++ KV+A
Sbjct: 196 GSDLVSALNSLFDRVGHEDLPLFMTAVSIQSSSGGNLREILDGLALTIRERGKLRRKVRA 255

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           +S E + SA+I+ ++P  +   +    PG+   + ++P+   L+G +  ++++G ++M  
Sbjct: 256 ISTEGRLSAYILTAIPALLFAGIMAMMPGFYRDVWDEPKTWYLIGGSVTWLMLGNLMMFK 315

Query: 182 MINFD 186
           M NF 
Sbjct: 316 MSNFR 320


>gi|241662161|ref|YP_002980521.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240864188|gb|ACS61849.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 325

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 93/185 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +R  K     P A D+I R++RAG  +  A+ +   +   P+ +E   V    + G
Sbjct: 141 HRRTRRLLKLEAQLPEATDLISRALRAGHSLPAALEMAGTELPAPIGAELAIVFSQINFG 200

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S+S++ + +   +P+ ++ +    I +Q + GGNL+E L N+ +++R R  +  KV+ L
Sbjct: 201 VSMSDAFAGLTDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVL 260

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E +   WI+  LP  +   +Y  +P  M+ L     G  LL  A     +G++ +R +
Sbjct: 261 SAEGRLGGWILTLLPPVMGLAIYLLNPELMSTLWTTDAGIRLLWFAITMTCLGMLWIRQI 320

Query: 183 INFDV 187
           +   +
Sbjct: 321 VRIHI 325


>gi|296131924|ref|YP_003639171.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296030502|gb|ADG81270.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 313

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 86/187 (45%), Gaps = 1/187 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   +K         P+   ++  SV+AGL +   + ++  +   P ++ F  +     
Sbjct: 128 LKVKQQKLVDALNRQLPDICRLLSSSVKAGLNIQQGIELVAREQKPPAQTVFTELAHQLQ 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +L  + S ++  +P +E+    + I VQ + GGN++  L  +S+ L +R  +  +++
Sbjct: 188 LGNTLENAFSHIMEELPSKELRLMGSTIIVQRKAGGNMARVLEEMSQTLENRDRVNQELK 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + E K  A I+  +P     ++  + PG+   L   P G +L  +      +G +++ 
Sbjct: 248 GKTAETKFVAMILPFMPIVAGLVLNISFPGFFRPLF-TPLGLILAALVIGIETVGFILIA 306

Query: 181 LMINFDV 187
            + +  V
Sbjct: 307 KITDIRV 313


>gi|294012436|ref|YP_003545896.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292675766|dbj|BAI97284.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 332

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 69/195 (35%), Positives = 112/195 (57%), Gaps = 8/195 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LIK R  KF   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   
Sbjct: 138 VSRLIKGRVLKFNAKFPDALELLTRGLRSGLPIAETLNVVSNEVPGPVGEEFKLITERIK 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ +++      +   E  FF   +++Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 198 IGKTMDQALQETADRLGTPEFQFFVISLAIQRETGGNLAETLSNLATVLRQRAQMKLKIR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRGHMLL-------GVAAAFM 172
           A+S E+KASA+IIG LPF V  L+ + +  YM+     DP G   L            +M
Sbjct: 258 AMSSESKASAYIIGVLPFTVFGLICYINYDYMSPFFTPDPAGLFGLSTMQVIGIGGMCWM 317

Query: 173 LIGIMVMRLMINFDV 187
            IG  +M  MINF++
Sbjct: 318 SIGAFIMAQMINFEI 332


>gi|163733538|ref|ZP_02140981.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393326|gb|EDQ17652.1| type II secretion system protein, putative [Roseobacter litoralis
           Och 149]
          Length = 320

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +   
Sbjct: 134 VSSKANKRLAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVSKEVQDPLASEMGVIADESA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + +++  M   + +Q++ F +  +++Q   GGNL+E LA L++++R R  +  +V+
Sbjct: 194 YGRDVGDALKEMAERLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + + +         +   F+ + + VMR
Sbjct: 254 AITAEAKWSGKFLSAFPVVALIVINVGDPNYYDAVRDHAYFIPACFLVGVFLALNLFVMR 313

Query: 181 LMINFDV 187
           ++ +  V
Sbjct: 314 ILTDIKV 320


>gi|319943384|ref|ZP_08017666.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
 gi|319743199|gb|EFV95604.1| type II secretion system protein F domain protein [Lautropia
           mirabilis ATCC 51599]
          Length = 291

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL  +R   F    P+A+ +I  +VRAG  ++ A+  +  +   P   EF  ++    
Sbjct: 105 IRHLGAQRRKLFARQLPDAMMLIAGAVRAGASMTLALRQMASELPAPGGQEFELMLRELR 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG++L +++  + R M   ++  F   + + ++ GGNL+E L  L+  +R +  ++ K+ 
Sbjct: 165 LGVTLDDALLNLERRMGCDDLRLFGAAVRIANESGGNLAETLERLADTIRKKMALEDKIM 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +   W++  LP  V   ++   P  M  L++  +G ++  V A   ++G++ +R
Sbjct: 225 ALTAQGRMQGWVMVLLPLGVGAALFAIEPTAMAPLLHSWQGWIVCSVVAVLEIVGLLFIR 284

Query: 181 LMINFDV 187
            ++  D+
Sbjct: 285 RIMAIDI 291


>gi|239979682|ref|ZP_04702206.1| hypothetical protein SalbJ_09607 [Streptomyces albus J1074]
 gi|291451547|ref|ZP_06590937.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291354496|gb|EFE81398.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 311

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +   
Sbjct: 125 LNWQRQKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELCRVADQLA 184

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+  ++  +   +P +E+    T + + +Q GG +  +L NL+  L +RK  + +V+
Sbjct: 185 LGRSVDAALGELAERLPSRELVVLVTTLVLSNQAGGTVVSSLRNLTATLEERKETRREVR 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A  + +L      L+   + G +  +     G +L+ +A     +G +V+R
Sbjct: 245 TMLSEVHATALTVPALGLGSLLLINSQNEGALARVTGSALGQILILIALGLYAVGFLVIR 304

Query: 181 LMINFDV 187
            +   +V
Sbjct: 305 RLGKIEV 311


>gi|85859133|ref|YP_461335.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722224|gb|ABC77167.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 327

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 100/186 (53%), Gaps = 1/186 (0%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
                R  KF    P+ALD++ R+++AG      + ++  +  DP+  EF +V+E  + G
Sbjct: 142 MKKNSRMKKFDAQLPDALDLMARALKAGHAFPGGIQMVAKEFDDPIGIEFAKVVEETNFG 201

Query: 63  LSLSESISRMVRYMPLQ-EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           + + E++  +        ++ FF+  + +Q + GGNL+E L +++RI+R+R  +   ++ 
Sbjct: 202 VGVEEALRNLANRFDSSSDLKFFAIAVMIQRESGGNLAEILESIARIIRERFKLMGTIRT 261

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           LS E + SA I+ ++PF V+  +   +P Y+ VL  DP G  L   +   M +GI +M+ 
Sbjct: 262 LSAEGRLSAIILVAIPFFVAFALSIMNPQYITVLATDPIGKALAFTSLVMMAVGIYIMKK 321

Query: 182 MINFDV 187
            I   V
Sbjct: 322 TIQIKV 327


>gi|108759913|ref|YP_632817.1| type II secretion system protein F domain [Myxococcus xanthus DK
           1622]
 gi|108463793|gb|ABF88978.1| type II secretion system protein F domain protein [Myxococcus
           xanthus DK 1622]
          Length = 281

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +KH  K+R  KF     +AL  +  + +AGL    A+  +  ++  P+  EF   ++   
Sbjct: 95  VKHYRKRRIKKFNVQLVDALQAMANAFKAGLTFPQAIEHVAREAMPPLSQEFGLFVKEVK 154

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  M R +   ++       ++  QLGGN++E    +S ++R+R  ++ K+ 
Sbjct: 155 LGVPLEEALINMGRRVGSDDLELVVVSTNIARQLGGNMAEMFETISTVIRERFRLEGKID 214

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + K   WI+ ++P  +  ++ +  P  M  +++   G +L+ + A   ++GI+++R
Sbjct: 215 ALTSQGKLQGWIVAAMPGVLGMVLNYMRPDLMEPMMDHIFGWILVIIIAIMEVMGILIIR 274

Query: 181 LMINFDV 187
            ++N D+
Sbjct: 275 RIVNIDI 281


>gi|327189774|gb|EGE56918.1| putative tadB pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 317

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 103/184 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R   F    P ALD+  RS+ AG P+  A+A++  +  DP+ +EF  + +    G
Sbjct: 133 RARARRMKAFELKLPEALDVATRSLAAGHPLPAAIALVGREMPDPIGTEFGLLTDELTYG 192

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  ++AKV+A+
Sbjct: 193 VTLDDALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRTMLRAKVRAI 252

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +A  +   PF +  ++   SP Y + + +   G  L+    A M IG +++  M
Sbjct: 253 SSEGRITAIFMSIYPFLLYAMIRALSPTYFDPVWDSGHGTTLVCALLAVMAIGNVILYKM 312

Query: 183 INFD 186
           +NF+
Sbjct: 313 VNFE 316


>gi|51245381|ref|YP_065265.1| TadB [Desulfotalea psychrophila LSv54]
 gi|50876418|emb|CAG36258.1| related to TadB [Desulfotalea psychrophila LSv54]
          Length = 317

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/184 (29%), Positives = 100/184 (54%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             ++R   F + FP+ALD++  +++AG  +  ++ ++  +   P+  EF  V+E  + G 
Sbjct: 134 KRRQRRINFEEHFPDALDLMGYAMKAGHSIMASLKMVSEEMPAPINEEFAIVVEEINFGK 193

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S+  ++    + +   E+ +F T + VQ + GGNL E L  +S I+R +   + +V+ALS
Sbjct: 194 SIDSTLRNFAKRVDSTELRYFVTSVIVQRETGGNLVEILEKISAIIRKKFRFRERVRALS 253

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E K SA I+ +LPFC++  V   +  Y+ +LI DP G  L+  A   M  G  ++   +
Sbjct: 254 AEGKLSAIILVALPFCIALAVSVLNKEYVAILITDPIGPYLITGAVIMMSFGSFIIYKFV 313

Query: 184 NFDV 187
             D+
Sbjct: 314 QLDM 317


>gi|254487450|ref|ZP_05100655.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214044319|gb|EEB84957.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 320

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR +   +  P+A++++VRS+R G P ++A+A++  +  DP+ SEF  + +   
Sbjct: 134 ISSKAKKRMSMIEEQLPDAVELMVRSLRVGHPFTNAIAIVSKEIQDPLASEFGIISDEAA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V 
Sbjct: 194 YGRDIGEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFKLFRRVN 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + ++              F+   ++VMR
Sbjct: 254 AITAEAKWSGKFLSAFPIVALIVIKLGDPHYYDEVMTHELFIPGCIAVILFLSANLLVMR 313

Query: 181 LMINFDV 187
            + +  V
Sbjct: 314 KLTDIKV 320


>gi|218663020|ref|ZP_03518950.1| putative tadB pilus assembly protein [Rhizobium etli IE4771]
          Length = 317

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/184 (29%), Positives = 103/184 (55%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  KF    P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G
Sbjct: 133 RARARRMKKFELKLPEALDVANRSLAAGHPLPAAISLVGREMPDPIGTEFGLLSDELTYG 192

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L +++  +   + ++++   +  +SVQ+  GGNL E L NLS+ LRDR  ++AKV+A+
Sbjct: 193 VTLDDALVNLADRVGVEDLDLLAISLSVQAGTGGNLVEILQNLSKTLRDRTMLRAKVRAI 252

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +A  +   PF +  ++   SP Y + + +   G  ++    A M +G +++  M
Sbjct: 253 SSEGRITAIFMSVYPFLLYAMIKALSPTYFDPVWDSGHGTTVVCALLAVMAVGNVILYKM 312

Query: 183 INFD 186
           +NF+
Sbjct: 313 VNFE 316


>gi|283769335|ref|ZP_06342234.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
 gi|283103992|gb|EFC05376.1| type II secretion system F domain protein [Bulleidia extructa
           W1219]
          Length = 294

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/183 (26%), Positives = 93/183 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             KKR A F    P AL II   +R+G     A+A +     +P+  E +RVI   + G 
Sbjct: 111 AKKKRLALFNKQLPEALVIIGNCLRSGFTFRHALARVSEDLPNPISEELKRVIREVNYGR 170

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L ES+  +       E+   ++ +++Q + GGNL+E +  ++  + DR N++ +++ L+
Sbjct: 171 KLEESLGELASRTNSAELEMINSAVTIQQRSGGNLAEIVEKVTETINDRINIRNQIRVLT 230

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + + S  +IG LP  +  ++ + SP YMN       G ++L V+      G ++++ ++
Sbjct: 231 TQGRYSGMLIGLLPVFLLIILTWISPNYMNSFFKTSIGKVMLVVSVILETTGFLLIQKIV 290

Query: 184 NFD 186
           N  
Sbjct: 291 NIK 293


>gi|149915638|ref|ZP_01904164.1| type II secretion system protein, putative [Roseobacter sp.
           AzwK-3b]
 gi|149810530|gb|EDM70373.1| type II secretion system protein, putative [Roseobacter sp.
           AzwK-3b]
          Length = 322

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P + A++++  + +DP+ +EF  + +   
Sbjct: 136 ITIKANKRMAMLEEQLPDAIELMVRSLRVGHPFTSAISIVASEMADPLATEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDIGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILDGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y +  +  P       +   F++  + VMR
Sbjct: 256 AITAEAKWSGKFLSGFPVLALIGIQIIDPNYYDKAMLHPYFIPACLIVGTFLVANLFVMR 315

Query: 181 LMINFDV 187
            ++N  V
Sbjct: 316 ALVNIKV 322


>gi|86159246|ref|YP_466031.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775757|gb|ABC82594.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 320

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/184 (33%), Positives = 102/184 (55%), Gaps = 1/184 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              KR+AK  +  P ALD++ RS+RAG  V+ A  V+  +  +P+  EF R  E Q LGL
Sbjct: 136 ARAKRSAKLSEQLPEALDMMARSLRAGHAVTSAFQVVASEMPEPICVEFARAYEEQRLGL 195

Query: 64  SLSESISRMVRYMP-LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +L  ++ +M    P   ++  F+    +Q + GGNL+E L  +   +R R     K++AL
Sbjct: 196 TLERAVVQMSERCPGNGDMKIFAVSAVIQRETGGNLAEILDQIGETIRQRYRFYGKLRAL 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +ASA I+G+LPF V+  +   +P Y+ VL    RG M++  A+   ++G++ +  +
Sbjct: 256 TGEGRASAVILGALPFAVAVALSILNPEYLMVLPGTARGQMIILGASVSWVVGLLWLYRL 315

Query: 183 INFD 186
              D
Sbjct: 316 TQVD 319


>gi|319951072|ref|ZP_08024925.1| type II secretion system integral membrane subunit [Dietzia
           cinnamea P4]
 gi|319435232|gb|EFV90499.1| type II secretion system integral membrane subunit [Dietzia
           cinnamea P4]
          Length = 314

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 92/173 (53%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           D   ++L ++  S+RAG  +  A+A +  ++  P   EF R+I    +G  L+ ++    
Sbjct: 141 DQLDDSLQLMASSLRAGHSLLQALASVAREAEQPTSEEFARIINETRVGRELAPALEETA 200

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             M  Q+  + +  I++  ++GGNL+E L  +   +R+R  ++ +VQAL+ E K SA+++
Sbjct: 201 NRMGSQDFVWVTQAIAINREVGGNLAEVLDGVGHTIRERNQIRRQVQALAAEGKLSAYVL 260

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            +LPF +   ++ ++P Y+ VL   P G  ++      + IG + +  ++   
Sbjct: 261 MALPFGIGGFLFVSNPSYIGVLTQSPLGWGMIAAGVVMLTIGGIWLSKVVRIR 313


>gi|323341959|ref|ZP_08082192.1| flp pilus assembly protein [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464384|gb|EFY09577.1| flp pilus assembly protein [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 311

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K+R  KF     +AL I+  S+RAG     A+A I     DP+  EF +V     
Sbjct: 125 IKIKRKQRIGKFSQQLGDALLILSNSLRAGFTFEQALASIAKDLPDPIGPEFLKVCREVE 184

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG ++ +S++ +   M  +E+   +T +S+Q Q+GGNL++ L N+   +R+R  ++  ++
Sbjct: 185 LGENIEKSLAAVSTRMESEEMKLMNTAVSIQRQVGGNLADVLDNIGEAIRERITIQKNIK 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ +   SA +I  LP  V  L+   +  YM  +   P G+ LLGV+A   ++G  +++
Sbjct: 245 ALTAQGDVSAKVIAGLPVVVLVLISMVNKEYMEPVFTTPFGYALLGVSATLEIMGYAMIK 304

Query: 181 LMINFDV 187
            + N ++
Sbjct: 305 KITNIEM 311


>gi|309792340|ref|ZP_07686810.1| type II secretion system protein [Oscillochloris trichoides DG6]
 gi|308225655|gb|EFO79413.1| type II secretion system protein [Oscillochloris trichoides DG6]
          Length = 325

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 98/191 (51%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR   F D   + + ++  ++R G      + ++   +  P+  EFRRV++   
Sbjct: 135 LNMRAKKRIKSFNDQLGDTITMMANALRGGFSFLQTLDMVARDAPAPMSGEFRRVVQEVG 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  E++  ++R MP +++    T +++Q ++GGNL++ L  +   +R+R  +K ++Q
Sbjct: 195 LGRTTEEALQSLLRRMPSEDLDLLITAVNIQMEVGGNLAQILDTIGHTIRERVRIKGEIQ 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLL-GVAAAFMLIGI 176
            L+ + + S W+I  LP  ++  +   +P YM  + +    P+    L   + A + IG 
Sbjct: 255 TLTAQGRISGWVITGLPIGLAIFITMINPEYMMPIFSFGMPPKHWCCLPVTSLAMIAIGY 314

Query: 177 MVMRLMINFDV 187
             +  +++ +V
Sbjct: 315 FAIMKIMDIEV 325


>gi|147677787|ref|YP_001212002.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
 gi|146273884|dbj|BAF59633.1| flp pilus assembly protein TadC [Pelotomaculum thermopropionicum
           SI]
          Length = 323

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KR  KF     +AL I+  S+R+G     A+ ++  +   P+  EF   ++  +
Sbjct: 137 LRLAKTKRLVKFNGQIGDALIIMANSLRSGFSFLQAMDMVRKEMPGPIAKEFGAALQEMN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G    E++  MV  +  +++    T + +Q Q+GGNL+E L  ++  +R+R  +K +++
Sbjct: 197 WGTPTEEALLNMVSRVNSEDLELVVTAVLIQRQVGGNLAEVLDKIAFTIRERVRIKREIK 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  IIG LP  +S  ++  +  YM VL     G  ++  A  F ++G+ +++
Sbjct: 257 TLTAQGRISGLIIGLLPIFLSIAIFLLNHAYMKVLFTSKAGLTMVSCAVLFQVLGLALIK 316

Query: 181 LMINFDV 187
            +I   V
Sbjct: 317 KIIKIPV 323


>gi|260574612|ref|ZP_05842615.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023029|gb|EEW26322.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 322

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR A   +  P+A++++VRS+R G P + A+A++  + +DP+ +EF  + +   
Sbjct: 136 VNGKAKKRIALMEEQLPDAVELMVRSLRVGHPFASAIAIVSKEVADPLGTEFGIIGDEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++ES+      M  Q++ F S  +++Q Q GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRDVTESLKAFAERMDNQDLRFLSVAVTIQQQSGGNLAEILEGLAKVIRARFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + +           V   F+ I ++ M+
Sbjct: 256 AITAEAKWSGMFLSAFPIGALVMILMLKPDYFDKVKETSAFVPAALVVGVFLTINVIFMK 315

Query: 181 LMINFDV 187
           +M+N  V
Sbjct: 316 MMVNIKV 322


>gi|110679392|ref|YP_682399.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455508|gb|ABG31713.1| type II secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 320

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P S AV ++  +  DP+ SE   + +   
Sbjct: 134 VSSKANKRLAMIEEQLPDAVELMVRSLRVGHPFSSAVQIVSKEVQDPLASEMGVIADESA 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + +++  M   + +Q++ F +  +++Q   GGNL+E LA L++++R R  +  +V+
Sbjct: 194 YGRDVGDALKEMAERLDMQDLRFLAVAVNIQQTSGGNLAEILAGLAKVIRARFRLFRRVK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P     ++    P Y + + +         +   F+ + + VMR
Sbjct: 254 AITAEAKWSGKFLSAFPVVALIVINVGDPNYYDAVRDHAYFIPACFLVGIFLALNLFVMR 313

Query: 181 LMINFDV 187
           ++ +  V
Sbjct: 314 VLTDIKV 320


>gi|302558696|ref|ZP_07311038.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302476314|gb|EFL39407.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 314

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  +F++  P    I+  + +AGL +  AV +   +   P   E  +V     
Sbjct: 128 LNWQRQKRIERFINQLPELARILANATQAGLALRTAVGMAAEEMEAPAGEELAKVANQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 188 VGASMDDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G ++ +   P G   + +A     +G +++R
Sbjct: 248 TQLSQVSMTSYAVPVLGVGSLFLMNGVKDGALDRMTGSPAGQAAVIIAFGLYAVGFVLIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLSRIDV 314


>gi|300704934|ref|YP_003746537.1| tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072598|emb|CBJ43948.1| Tad secretion system, pilus assembly protein [Ralstonia
           solanacearum CFBP2957]
          Length = 325

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 94/175 (53%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRM 72
               P A D+I R++RAG  +  A+ +   +   PV  E   V    + G+S++++++ +
Sbjct: 151 EAQLPEATDLISRALRAGHSLPSALEMAGDELPQPVGPELAIVFGQINYGVSMNDALAGL 210

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
           +  +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI
Sbjct: 211 IDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWI 270

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           + +LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 271 LTALPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|126733577|ref|ZP_01749324.1| Putative Flp pilus assembly protein TadB [Roseobacter sp. CCS2]
 gi|126716443|gb|EBA13307.1| Putative Flp pilus assembly protein TadB [Roseobacter sp. CCS2]
          Length = 321

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR     +  P A++++VRS+R G P S A+A++  +  DP+ +E   + +   
Sbjct: 135 VNGKAKKRMNMLAEQLPEAVELMVRSLRVGHPFSSAIAIVAREVPDPLGTEIGMISDEAA 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   +  Q++ F +  +++Q   GGNL+E L  L++++R R  +  +V 
Sbjct: 195 YGRDMGETLKSMAERLDNQDMRFLAVAVTIQQTSGGNLAEILDGLAKVIRARFRLFRRVA 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S  ++ + P      +    P Y + ++  P     + +  AF+++ ++VMR
Sbjct: 255 AITAEAKWSGNLLSAFPIFALMGINLVKPDYYDDVMESPLFIPAVLIVVAFLVVNLLVMR 314

Query: 181 LMINFDV 187
            +++  V
Sbjct: 315 ALVDIKV 321


>gi|297157607|gb|ADI07319.1| putative integral membrane protein [Streptomyces bingchenggensis
           BCW-1]
          Length = 312

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF+   P    I+  + +AGL +  A+ +   +   P   E  +V +   
Sbjct: 126 LNWQRQKRIEKFISQLPELSRILANATQAGLALRTALGMAADEMEAPAGEELAKVADKLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V+
Sbjct: 186 VGHSIDDALGELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTQTLEERKETRREVR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+++  +      L+   + G ++ + +   G   + VA A   +G  ++R
Sbjct: 246 TQLSQVTVTAYVVPLMGIGTLLLMNRIATGSLDRMTSSFWGQAAVVVAFALYGVGFFLIR 305

Query: 181 LMINFDV 187
            M   DV
Sbjct: 306 RMSKIDV 312


>gi|114797844|ref|YP_759873.1| putative Flp pilus assembly protein TadB [Hyphomonas neptunium ATCC
           15444]
 gi|114738018|gb|ABI76143.1| putative Flp pilus assembly protein TadB [Hyphomonas neptunium ATCC
           15444]
          Length = 316

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/187 (33%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL   R  K     P+AL I+ RS+ AG PV+ AV+++  +  DP+ +EF    +   
Sbjct: 130 IRHLAGARAKKLAAQLPDALQIVCRSLEAGHPVATAVSLVAREMPDPIGTEFGMTADEVS 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL+ ++ RM       +V  F+  + +Q + GGNL+E L + +  +R+R+ M+ KV+
Sbjct: 190 YGMSLTNAVQRMAERAGDPDVELFAATVRLQEKTGGNLTELLKSNTNTIRERQTMRLKVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S E + SA I+ S PF V T ++   P +   +I++P           +M IG +VM 
Sbjct: 250 AASSEGRVSAMILTSAPFIVMTAIHLLRPEFYGSVIHEPLIQYSFAGLLVWMGIGNLVMN 309

Query: 181 LMINFDV 187
            MINF +
Sbjct: 310 RMINFKM 316


>gi|290957845|ref|YP_003489027.1| type II secretion system F protein [Streptomyces scabiei 87.22]
 gi|260647371|emb|CBG70476.1| putative type II secretion system F protein [Streptomyces scabiei
           87.22]
          Length = 341

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 91/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   F++  P+   ++  +  AGL +  A+A+   +   P   E  RV +   
Sbjct: 155 LNWQRQKRIEAFINQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLA 214

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ +++  +   +P +E+    T + + ++ GG +  +L NL++ L DRK  + +V+
Sbjct: 215 LGRSVDDALGELAERLPSRELIVLVTTLVLSNKAGGTVVSSLRNLTQTLEDRKETRREVR 274

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ +  L      L+  ++ G +  +   P G +L+ ++     +G  V+R
Sbjct: 275 TMLSEVNATAFTVPLLGLGSLLLINSSNDGALARVTGSPLGQLLVLISIGLYTVGFFVIR 334

Query: 181 LMINFDV 187
            +   +V
Sbjct: 335 RLGKIEV 341


>gi|254420696|ref|ZP_05034420.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186873|gb|EDX81849.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 88/187 (47%), Positives = 127/187 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K R  KF  +FPNA+D+IVR +++GLPV +   +I  +S  P+   F++++E   
Sbjct: 140 VGFLAKARMKKFSLEFPNAVDVIVRGIKSGLPVHECFKIIARESPAPLGPAFKKLVEALG 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++L +++ +M   MP  E+ FF+ VI++Q + GGNL+EAL+NLS +LR R+ M+ KV+
Sbjct: 200 VGMTLEQALDKMFEQMPTPELRFFTIVIAIQQKTGGNLAEALSNLSTVLRARRMMREKVK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA II SLP  V T+V FTSPGYM  L  D RG+ LL +A A M  GI VM+
Sbjct: 260 ALSSEALASAGIIASLPPAVMTMVMFTSPGYMMALFTDIRGNALLLLAGALMGTGIFVMK 319

Query: 181 LMINFDV 187
            MI+F +
Sbjct: 320 RMISFKI 326


>gi|87308907|ref|ZP_01091045.1| putative membrane protein [Blastopirellula marina DSM 3645]
 gi|87288250|gb|EAQ80146.1| putative membrane protein [Blastopirellula marina DSM 3645]
          Length = 310

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/182 (29%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            +  +R   F D FP+AL++I R+VRAG     A+ ++   S DP+  EFRR  +   +G
Sbjct: 126 WIKNRRLRAFQDQFPSALELIARAVRAGESFEQAIQLVGESSEDPIGVEFRRCAKQLDVG 185

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LS  +++  M   + L +V  F+T ISV  + GG L E L  L+ ++RDR     +++++
Sbjct: 186 LSAPKAMEGMADRVELMDVKIFATTISVHRESGGALPETLDRLAAVIRDRMAYHRQLRSI 245

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           +   + SA II  L   +        P Y +     P G  LL  A     +G+  +  +
Sbjct: 246 TSSGRMSATIIALLAPLLLVFFLLFQPEYFSEFFAHPWGRYLLLFALVSEALGLYFVYRL 305

Query: 183 IN 184
           + 
Sbjct: 306 VR 307


>gi|294102186|ref|YP_003554044.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617166|gb|ADE57320.1| Type II secretion system F domain protein [Aminobacterium
           colombiense DSM 12261]
          Length = 309

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 103/183 (56%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +   ++R  +F    P  LD++   +RAG     ++     Q   P+    ++V+    L
Sbjct: 124 RVRKQRRLQRFERQIPPMLDMVSSGLRAGFSFLQSLQNAGAQIEAPLGDTLQQVVAEISL 183

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GL L + ++R V  +   ++    T I +Q ++GGNL++ L N++R++RDR+++ A+++A
Sbjct: 184 GLDLEDVLNRWVERVGSLDLELAVTSILIQREIGGNLAKILENIARVMRDRQDVAAQMKA 243

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + +    I+  LP  ++ ++   SPGY++ L +  +G ++LG A  F  IGI+V++ 
Sbjct: 244 LTSQGRLEGLIVSLLPVAMAVIINLLSPGYLSPLFSTQKGQVMLGTAIFFAFIGILVIQR 303

Query: 182 MIN 184
           ++ 
Sbjct: 304 IVR 306


>gi|170725111|ref|YP_001759137.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810458|gb|ACA85042.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 283

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 97/186 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K L K+R  KF+   P+AL++I  S+++G  VS A+  +  +   P++ EF+     Q L
Sbjct: 98  KFLHKRRRRKFVHQLPDALNMIASSMQSGANVSTAIEFMSEEMQAPIKQEFQLFQREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  M + +P  E    +  + +  ++GGNL+E L  LS  LR +  M+ K+ A
Sbjct: 158 GVEFNTALDNMYKRIPEDEFQLVTAGMQISREVGGNLAEVLFRLSSTLRRKIEMEGKIDA 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +  ++Y   P  M  ++ +P G  L+ +    +  G + +R 
Sbjct: 218 LTSQGKMQGIVMTMLPLFIGFVLYHMEPKSMGRILTEPMGWALMALIFIMLTSGYLSIRK 277

Query: 182 MINFDV 187
           ++  DV
Sbjct: 278 IVAIDV 283


>gi|134291850|ref|YP_001115619.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134135039|gb|ABO59364.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 325

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 102/182 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  K     P+  D+I R++R+G   + A+ ++  +  +P+  EFR   +  +
Sbjct: 139 VTRHRRRRMLKLERQLPDVCDMIARALRSGHSFTSALGMVGEEFPEPMSGEFRITFDEIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+SL +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+
Sbjct: 199 YGVSLHDALVNLATRVPANDLRYFVIAVLIQRETGGNLAELLDSIAALVRERFKLFDKVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     M  G++ +R
Sbjct: 259 VLSAEGRLSAWILGLLPFGTAGMMAVLNREFLSVLWQDPAGVKMVGAMLTSMAFGLLWIR 318

Query: 181 LM 182
            +
Sbjct: 319 RI 320


>gi|307332438|ref|ZP_07611502.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306881907|gb|EFN13029.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 312

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 87/187 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  +F++  P    I+  + +AGL +  A+ +   +   P   E  +V     
Sbjct: 126 LGWQRQKRIERFINQLPELSRILANATQAGLALRTALGMAADEMEAPAGEELAKVAAKLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V+
Sbjct: 186 VGHSIDDALEELAERLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTQTLEERKETRREVR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+++  L      L+   + G ++ + +   G   + VA     IG  ++R
Sbjct: 246 TQLSQVTVTAYVVPLLGIGTLLLMNRIAAGSLDRMTSSFWGQAAVVVAFCLYGIGFFLIR 305

Query: 181 LMINFDV 187
            M   DV
Sbjct: 306 RMSKIDV 312


>gi|167836685|ref|ZP_02463568.1| pilus assembly protein, putative [Burkholderia thailandensis
           MSMB43]
          Length = 328

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 64/185 (34%), Positives = 114/185 (61%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+A+D++VR+VRAG+PV  A+     +S +PVRS F  + +   +
Sbjct: 141 RMLIVRFRLRFLAVFPDAIDLMVRAVRAGIPVVHAIVTAGVESQEPVRSTFHTIGDGLRV 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L E + +    + + + SFF+  + +Q + GG+L+E L NLS I+R R++++ K +A
Sbjct: 201 GADLKEVLEQACERLQIADFSFFAVCLMLQRETGGSLTETLENLSGIIRARRDVRLKTKA 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E K SA II ++PF +   +Y  +  Y+ +L +   GH +L +AA  + +G++++R 
Sbjct: 261 LTAEGKISAKIIAAVPFAIMGFLYLVNRPYIELLFDTGMGHTMLMLAAVLLTVGLLLIRK 320

Query: 182 MINFD 186
           + N D
Sbjct: 321 IANLD 325


>gi|87199541|ref|YP_496798.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135222|gb|ABD25964.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 328

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 107/187 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  +    F  A+DI  R++RAG PV+ A++++  + +DP+ +EF  V +   
Sbjct: 142 LNRSAEKRRKRMEQQFAPAVDIFTRALRAGHPVASAISLLSTEMADPIGTEFGLVADEIA 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +L++S+  +     L+++  F+  +SVQS+ GGNL+E L NL+ ++RDR ++  KV+
Sbjct: 202 YGANLNDSLVALAERWELEDLHMFAVCLSVQSETGGNLAEILGNLASVIRDRASLYQKVR 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E +ASAW++  LP     +++  +P +   +  DP             LIG++ +R
Sbjct: 262 ALSSEGRASAWMLSVLPALTMLVLFMINPSFYLEVSGDPLFATSFAGMIGLYLIGVLWLR 321

Query: 181 LMINFDV 187
            M++  V
Sbjct: 322 SMVDLKV 328


>gi|119962927|ref|YP_948622.1| type II secretion system protein F [Arthrobacter aurescens TC1]
 gi|119949786|gb|ABM08697.1| putative bacterial type II secretion system protein F domain
           [Arthrobacter aurescens TC1]
          Length = 316

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 95/186 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +  +R A+F     + L ++  S+RAG  +  AV  +  ++  P + EF R++    
Sbjct: 130 LSVMTSRRRAQFEAQLGDTLQMLSGSMRAGHSLLRAVDAVALEAQSPTKEEFARIVGEVR 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L +++      +  ++  + +  I +  ++GG+L+E L +++  +R+R  +K +V+
Sbjct: 190 LGRDLRDALLDAANRLHSEDFLWATQAIEIHREVGGDLAEVLDHVAETIRERSQIKGQVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA+++ +LP  +   +   +  Y+  L   P G ++L VA   + +G   + 
Sbjct: 250 ALSAEGRLSAYVLIALPTGMFLYLSLANGTYIQPLFTHPVGWIMLVVAVVLLALGSFWLS 309

Query: 181 LMINFD 186
            ++   
Sbjct: 310 RVVKIK 315


>gi|269836552|ref|YP_003318780.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785815|gb|ACZ37958.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 326

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 104/187 (55%), Gaps = 1/187 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++RT  F++   + + ++  S+RAG  +   + ++  ++  P+  EFRRV+    
Sbjct: 141 ISVRARRRTNAFVNQLGDTITLMANSLRAGYSLLQTMELVARETPPPMSEEFRRVVREVG 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+   E++S ++R +P +++    T I+VQ ++GGNL++ L  +   +R+R  +K +++
Sbjct: 201 LGIPTQEAMSHLLRRVPSEDLDLLITAINVQHEVGGNLAQILDVIGETIRERVRIKGEIR 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ +   S +II +LP  ++ L+   +PGY+  ++  P    +       + +G + MR
Sbjct: 261 VLTAQQSISGYIISALPVGLALLLMVINPGYVMGMMRWPW-ICMPIGGVVLIFLGFIAMR 319

Query: 181 LMINFDV 187
            ++N +V
Sbjct: 320 KIVNIEV 326


>gi|307293453|ref|ZP_07573299.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881519|gb|EFN12735.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 332

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 68/195 (34%), Positives = 112/195 (57%), Gaps = 8/195 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LI KR  +F   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   
Sbjct: 138 VSRLINKRVQQFTAKFPDALELLTRGLRSGLPIAETLGVVSSEVPGPVGEEFKLITERIK 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ +++      +   E  FF   +++Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 198 IGKTMDQALQETADRLGTAEFQFFVISLAIQRETGGNLAETLSNLATVLRQRSQMKLKIR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRGHMLL-------GVAAAFM 172
           A+S E+KASA+IIG LPF V  L+ + +  YM+     DP G   L            +M
Sbjct: 258 AMSSESKASAYIIGVLPFTVFGLICYINYDYMSPFFTPDPVGLFGLSTMQVVGIGGMCWM 317

Query: 173 LIGIMVMRLMINFDV 187
            IG  +M  MINF++
Sbjct: 318 GIGAFIMAQMINFEI 332


>gi|94497257|ref|ZP_01303829.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
 gi|94423362|gb|EAT08391.1| hypothetical protein SKA58_13683 [Sphingomonas sp. SKA58]
          Length = 332

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 67/195 (34%), Positives = 113/195 (57%), Gaps = 8/195 (4%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  LI KR ++F   FP+AL+++ R +R+GLP+++ + V+  +   PV  EF+ + E   
Sbjct: 138 VGRLITKRVSQFNAKFPDALELLTRGLRSGLPIAETLGVVSNEIPGPVGEEFKLITERIK 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G ++ +++      +   E  FF   +S+Q + GGNL+E L+NL+ +LR R  MK K++
Sbjct: 198 IGRTMEQALQETADRLGTAEFQFFVITLSIQRETGGNLAETLSNLATVLRQRSQMKLKIR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN-DPRG-------HMLLGVAAAFM 172
           A+S E+KASA+IIG LPF V  ++ + +  YM      DP G        ++      +M
Sbjct: 258 AMSSESKASAYIIGVLPFLVFGMICYINFDYMKPFFTPDPVGIFGLSTMQVIGIGGMCWM 317

Query: 173 LIGIMVMRLMINFDV 187
            IG  +M  MINF++
Sbjct: 318 GIGAFIMAQMINFEI 332


>gi|297202076|ref|ZP_06919473.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297148029|gb|EDY58318.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 314

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 84/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  +  AGL +  A+ +   +   P   E   V     
Sbjct: 128 LNWQRQKRIEKFINQLPELARILANATHAGLALRTAIGMAAEELEAPAGEELANVANQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + +++  M + +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 188 VGVPMEDALDEMAKRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   + +A A   +G +++R
Sbjct: 248 TQLSQVNMTSYAVPVLGIGSLFLMNGVKDGALERMTGSPLGQGAVIIAFALYTVGFVLIR 307

Query: 181 LMINFDV 187
            M   DV
Sbjct: 308 RMSRIDV 314


>gi|227819313|ref|YP_002823284.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
 gi|227338312|gb|ACP22531.1| pilus assembly protein TadB [Sinorhizobium fredii NGR234]
          Length = 317

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 104/179 (58%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF +  P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G++L +
Sbjct: 138 RIRKFAEKLPEALDVANRSLAAGHPLPAAISLVAREMPDPIGTEFGLLSDELTYGVTLDD 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  +KAKV+++S E +
Sbjct: 198 ALMNLNDRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRFMLKAKVKSISAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            +A  +   PF +  ++   +P Y + + +   G +++      M IG +++  M+NF+
Sbjct: 258 ITAIFMSLYPFLLFGMIRTLAPTYFDPVWDSGYGTIIVSSLLVVMAIGNVILYKMVNFE 316


>gi|260892928|ref|YP_003239025.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260865069|gb|ACX52175.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 313

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 113/186 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++HL ++R A+F    P+AL ++  ++RAG  +  A+ V+  +   P+  EF R +    
Sbjct: 127 LRHLRRQRLARFQSQLPDALSLMANTMRAGFGMLQAMDVVRREMPPPISQEFGRTLAELG 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++ R+   +P  ++    T + +Q Q+GGNL+E L N++  +R+R  +K +++
Sbjct: 187 LGMGVEEALERLSHRVPSDDLDLAVTAVIIQRQVGGNLAEILDNIATTIRERVRLKGEIR 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + + SA IIG LP  ++ ++   +P Y+  LI +P G ++LG+ AA  ++G++++R
Sbjct: 247 ALTAQGRISALIIGLLPLALALILSLINPSYLLTLIYEPLGRIMLGLGAAGEIVGVLLLR 306

Query: 181 LMINFD 186
            +   +
Sbjct: 307 KITEVE 312


>gi|83950070|ref|ZP_00958803.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837969|gb|EAP77265.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius nubinhibens ISM]
          Length = 322

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKRTA+  +  P+A++++VRS+R G P S A++++  + SDP+ +EF  + +   
Sbjct: 136 ISSKAKKRTARLEEQLPDAIELMVRSLRVGHPFSAAISIVANEVSDPLATEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L E++  M   + +Q++ F +  +++Q Q GGNL+E L  LS+++R R  +  +V+
Sbjct: 196 YGRELGEALKDMAERLDMQDLRFLAVAVTIQQQSGGNLAEILDGLSKVIRSRFKLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y +  +              F+++ ++VMR
Sbjct: 256 AITAEAKWSGNFLSGFPLMALIGIQLIDPNYYDEAMEHAFFIPAAITVGVFLVLNLIVMR 315

Query: 181 LMINFDV 187
            ++N  V
Sbjct: 316 GLVNIKV 322


>gi|302381752|ref|YP_003817575.1| type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192380|gb|ADK99951.1| Type II secretion system F domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 326

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 82/186 (44%), Positives = 126/186 (67%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K+R  KF  +F NA+D+IVR +++GLPV D   +I  +S  PV  EF+ ++E   
Sbjct: 140 VGFIGKRRLKKFSLEFANAVDVIVRGIKSGLPVHDCFKIIARESPAPVGPEFQTLVEGLG 199

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L +++ +M   +P  E+ FF+ VI++Q + GGNL EAL+NL+ +LR R+ M  K++
Sbjct: 200 VGLTLGQALEKMYERIPTPELRFFTIVIAIQQKTGGNLGEALSNLTTVLRARRMMGEKIK 259

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA IIGSLP  V TLV  T+P YM ++  D RG ++L  +A +M +GI++M+
Sbjct: 260 ALSSEATASAGIIGSLPPVVMTLVGLTTPAYMGLMFTDFRGQVMLLGSAIWMGMGILMMK 319

Query: 181 LMINFD 186
            MI+F 
Sbjct: 320 KMISFK 325


>gi|84385680|ref|ZP_00988711.1| hypothetical Flp pilus assembly protein TadB [Vibrio splendidus
           12B01]
 gi|84379660|gb|EAP96512.1| hypothetical Flp pilus assembly protein TadB [Vibrio splendidus
           12B01]
          Length = 300

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/183 (26%), Positives = 95/183 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R  +F + FP+AL+I++ +V AG  +  A++ +     +P+  EF+ + +   L
Sbjct: 114 RFLVTRRRREFENTFPDALNILMSAVTAGDSLMQAISYVGDVMHNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   +A L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTIRANIARGGQLKGVMARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +  ++ DP G ++L       L G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFMLILNYVNPDNVEFVLYDPEGRLVLFYVLGSELFGLFLVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVR 296


>gi|170724974|ref|YP_001759000.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
 gi|169810321|gb|ACA84905.1| type II secretion system protein [Shewanella woodyi ATCC 51908]
          Length = 302

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/183 (28%), Positives = 91/183 (49%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            +L++KR   F + FP+AL+I++ +V +G  +  A+A +     + +  EFR + E   L
Sbjct: 117 NYLMRKRKNAFDETFPDALNIMMSAVSSGESIMQAIAYVGQSLDNQIGLEFRDMGERLKL 176

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    +   R  +  P     FF   I      GG L   +A L R+L D + +  K  A
Sbjct: 177 GEPPEQVFKRACKRFPYPTFLFFIVTIRANMSRGGQLKSVMARLIRVLMDARTLDKKKAA 236

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ SLPF    L+ + SP  ++ ++ DP G  +L        +G+ ++ L
Sbjct: 237 MTSEARLSAKIVASLPFFFMILLSYLSPQNLDFVLTDPSGRYILYYVVGSEALGMFIIWL 296

Query: 182 MIN 184
           +I 
Sbjct: 297 LIR 299


>gi|229588192|ref|YP_002870311.1| hypothetical protein PFLU0644 [Pseudomonas fluorescens SBW25]
 gi|229360058|emb|CAY46912.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 294

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 97/184 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  + ++  P  LD  VRS+++G  ++DAV   V    +P+R    RV     
Sbjct: 109 IAWRYQQRVQRMVEQLPQLLDHSVRSLKSGRTLADAVLGGVESIENPLRDAMGRVQRNVR 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+SL +S+S    +    E   F+  + V  + GGN SE L NL +++R+R+    +++
Sbjct: 169 MGVSLPDSVSDFAEFYEQDEFRLFALGLKVNHRYGGNASELLENLIKMIREREQGARQLK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A+++G LP  +       +PGY+  + +D  G ++L  A A  L G  +M 
Sbjct: 229 AMTGETRMTAYVLGGLPVLIVGYFLVVNPGYLMNMWHDGTGRIMLFGALAMDLGGTFIMW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|163846104|ref|YP_001634148.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523839|ref|YP_002568309.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
 gi|163667393|gb|ABY33759.1| type II secretion system protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447718|gb|ACM51984.1| type II secretion system protein [Chloroflexus sp. Y-400-fl]
          Length = 332

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 96/191 (50%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R   F +   + + ++  ++R G      + ++  ++  P  +EFRRV++   
Sbjct: 142 VNMRAAQRIKAFNNQLGDVITMMANALRGGYSFLQTLDMVSREAPPPAATEFRRVVQEVG 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  E++  ++R MP  ++    T +++Q ++GGNL++ L  +   +R+R  +K ++ 
Sbjct: 202 LGRSTEEALQNLLRRMPSDDLDLLITAVTIQMEVGGNLAQILDTIGHTIRERVRIKGEIS 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN---DPRGHMLL-GVAAAFMLIGI 176
            L+ + + S+WII  LP  ++  +   +P YM  L      P+    +   +   + +G 
Sbjct: 262 TLTAQGRISSWIITGLPIGLAMFITVVNPDYMAPLFTFGFPPQAWCCMPVASLFMIAMGY 321

Query: 177 MVMRLMINFDV 187
             ++ +I+ +V
Sbjct: 322 FAIQKIIDIEV 332


>gi|269105135|ref|ZP_06157829.1| flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|312621085|ref|YP_003993813.1| flp pilus assembly protein tadb [Photobacterium damselae subsp.
           damselae]
 gi|268160585|gb|EEZ39084.1| flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|311872806|emb|CBX86897.1| Flp pilus assembly protein TadB [Photobacterium damselae subsp.
           damselae]
          Length = 306

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 87/184 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K+   KF + FP+AL+I+  ++ +G  +  A+  +       V +EF  + E   
Sbjct: 120 ISWLQKRERKKFEESFPDALNILTSAISSGESIIHAIVFVGKTLDGAVGNEFSLMGERLQ 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S      +     P     FF   +      GG L + ++ L+RI+ D + ++ K  
Sbjct: 180 LGESPDNVFRKSCMRFPYPSFQFFVITLRANMHRGGQLKDVMSRLNRIMFDARAIEKKKY 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ EA+ SA I+ ++PF    ++ + SP     ++ +P G  +L        IGI ++ 
Sbjct: 240 ALTSEARISAKIVAAIPFIFLFMLQYLSPENYEFVMFNPGGRPILYYVIISESIGITIVW 299

Query: 181 LMIN 184
           L++ 
Sbjct: 300 LLMK 303


>gi|255658707|ref|ZP_05404116.1| type II secretion system protein F domain protein [Mitsuokella
           multacida DSM 20544]
 gi|260849094|gb|EEX69101.1| type II secretion system protein F domain protein [Mitsuokella
           multacida DSM 20544]
          Length = 319

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/177 (24%), Positives = 90/177 (50%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            KF +   + L ++  ++RAG     A  +I  +   P+  E + V+   +LG +L  ++
Sbjct: 142 KKFTNQLGDMLTMVANALRAGFSFMQAFELISREMDAPMGREVQLVVNEVNLGNTLESAL 201

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
             M R +   +     T + +Q Q+GG+L+  L  +S  + +R  M+ +V  L+ + + S
Sbjct: 202 DNMQRRVASPDFELVVTAVLIQRQVGGDLASILDTISETIAERVRMRREVMTLTAQGRLS 261

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             ++  LPF ++ ++ F  P Y+  L+ D  G +++G+A    LIGI  ++ + +  
Sbjct: 262 GIVLAILPFAMAGILTFIKPDYLKPLLEDEVGRIIIGIAIVSELIGIFFIKKITDIR 318


>gi|207728102|ref|YP_002256496.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
 gi|206591347|emb|CAQ56959.1| pilus assembly protein tadb [Ralstonia solanacearum MolK2]
          Length = 325

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 94/175 (53%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRM 72
               P A D+I R++RAG  +  A+ +   +   P+  E   V    + G+S++++++ +
Sbjct: 151 EAQLPEATDLISRALRAGHSLPSALEMAGDELPQPIGPELAIVFGQINYGVSMNDALAGL 210

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
           +  +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI
Sbjct: 211 IDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWI 270

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           + +LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 271 LTALPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|157961841|ref|YP_001501875.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
 gi|157846841|gb|ABV87340.1| type II secretion system protein [Shewanella pealeana ATCC 700345]
          Length = 325

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  K  + FP+ALD++ R+++AG   SDA+ ++  +   P+  EF  +    +
Sbjct: 139 LNRDTSKRMDKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMDGPLAKEFSLMFANIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
                  ++   +  +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+
Sbjct: 199 YSKDTKRALLGFIERVPSVSAMAFASAVMVQKETGGNLAENINNLARVIRLRFTFRRRVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+  LPF +  ++Y  +PGY+  L     G+ LL   A  M +G M + 
Sbjct: 259 TLSAEGRLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGNQLLIWGAIGMFVGGMWIS 318

Query: 181 LMINFDV 187
            +I  D+
Sbjct: 319 KLIRIDM 325


>gi|167589558|ref|ZP_02381946.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 235

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 60/183 (32%), Positives = 118/183 (64%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +G 
Sbjct: 50  LIRRFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRVGA 109

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +AL+
Sbjct: 110 DLKDVLTQAADRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRSRRDIRLKSRALT 169

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +  II ++PF +   ++  +  Y+ +L     GH +L +AAA ++IG++V+R + 
Sbjct: 170 AEGRITTNIISAVPFVMIGALFLVNRPYIMLLFTTHAGHTMLTIAAALLVIGLLVIRKIS 229

Query: 184 NFD 186
             +
Sbjct: 230 RLE 232


>gi|197106492|ref|YP_002131869.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
 gi|196479912|gb|ACG79440.1| Flp pilus assembly protein [Phenylobacterium zucineum HLK1]
          Length = 319

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 99/185 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K +  +R A      P AL+IIVRS+ AG PV  A+A++  + SDPV +EF    +    
Sbjct: 134 KFVAGRRAAALGFQLPQALEIIVRSLEAGHPVPTAIALVGREMSDPVGTEFGMAADEIAY 193

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +L ++I RM       +V  F+  + +Q + GGNL+  L   +  +R+R  M+ K++A
Sbjct: 194 GANLEQAIERMAERCQHPDVDLFAATVRLQERTGGNLTGLLKLNASTIRERHKMRLKIKA 253

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            S E +ASA I+ + PF    ++   SP +   +I++P     L     ++ IG +VMR 
Sbjct: 254 ASAEGRASAMILSAAPFIAVGMIMIISPKFYGDVIHEPAVKWGLLGLTVWVGIGNLVMRR 313

Query: 182 MINFD 186
           MI+  
Sbjct: 314 MIDMK 318


>gi|46201039|ref|ZP_00055942.2| COG4965: Flp pilus assembly protein TadB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 331

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 80/187 (42%), Positives = 121/187 (64%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F   F +ALD++VR +R+GLP+ + +A+I  +  DPV +EFR++ E   
Sbjct: 145 LGVAAGKRLKAFTAQFADALDVVVRGIRSGLPLGECIAIIGREMPDPVGAEFRQITEGTR 204

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L E+++R V  MP+ E+ +F+ V+++Q Q GGNL+E LA LS +LR RK M+ KV 
Sbjct: 205 IGLTLHEAMTRAVERMPMAEMRYFAIVLAIQQQTGGNLAETLAKLSEVLRARKRMRDKVL 264

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           + + EA+ASA IIGSLP  V  ++   +P Y+ VL     G++LL +       G+MVMR
Sbjct: 265 SYAAEARASAAIIGSLPLLVVAMLGMLAPQYIGVLFTTEPGNLLLAIGILTEAAGVMVMR 324

Query: 181 LMINFDV 187
            MINFD+
Sbjct: 325 GMINFDI 331


>gi|159901126|ref|YP_001547373.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894165|gb|ABX07245.1| type II secretion system protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 329

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 107/191 (56%), Gaps = 4/191 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +      R   F +   + + ++  S+R+G  +  ++ ++  ++  P+  EFRRV++   
Sbjct: 139 VSFKQGSRLKAFNNQLGDTVGLLANSLRSGYSLLQSMDLVSREAPPPISVEFRRVVQEVG 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLSL + ++ ++R +P  ++    + I++Q+++GGNL+E L  ++  +R+R  +K +++
Sbjct: 199 LGLSLEDGMNNLLRRVPSDDLDLMVSAINIQAEVGGNLAEILDTIAHTIRERVRIKGQIR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIND---PRGHMLLGVAAAFMLI-GI 176
            L+ +A+ S +++  LP  ++ ++   +P YM  L+     P     + V +A M+I G 
Sbjct: 259 VLTSQARYSGYVVTFLPISIAVIITMLNPDYMAPLMTIGMPPDAWCCMPVCSAMMMIGGF 318

Query: 177 MVMRLMINFDV 187
             ++ ++N ++
Sbjct: 319 FAIKSIVNIEI 329


>gi|239929199|ref|ZP_04686152.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 314

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 84/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V     
Sbjct: 128 LNWQRQKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELSKVANQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 188 VGASMDDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   + +A     +G +++R
Sbjct: 248 TQLSQVSMTSYAVPVLGVGSLFLMNGVKDGALERMTGSPVGQAAVIIAFGLYAVGFVLIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLSRIDV 314


>gi|322419940|ref|YP_004199163.1| Type II secretion system F domain-containing protein [Geobacter sp.
           M18]
 gi|320126327|gb|ADW13887.1| Type II secretion system F domain protein [Geobacter sp. M18]
          Length = 321

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 108/180 (60%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  KF + FP+AL +I RS+RAG   + A+ ++  + +DPV   F+   E Q 
Sbjct: 135 LHFKIRQRLEKFTELFPDALTMIARSLRAGHSFNSAIQLVGEEIADPVGELFKTAYEQQL 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL ++E+++ +   +   ++ FF+T I++ + +GGNLSE L NL++ +R+R  ++ +V+
Sbjct: 195 LGLRITETLTNLNERIESLDLRFFTTAIAINNDVGGNLSEILENLAKTIRERLKIRRQVR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + + + + +++G+LP     +    +P Y +VL  + +G  +L  A    ++G+ V+R
Sbjct: 255 VYTAQGRMTGYVLGALPVFTFLIFNVLNPKYESVLYKETKGLYVLAFAVVLQVVGLFVIR 314


>gi|83749634|ref|ZP_00946617.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|207744162|ref|YP_002260554.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
 gi|83723695|gb|EAP70890.1| TRANSMEMBRANE TIGHT ADHERENCE TADB-RELATED PROTEIN; tadB1
           [Ralstonia solanacearum UW551]
 gi|206595566|emb|CAQ62493.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
          Length = 325

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 94/175 (53%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRM 72
               P A D+I R++RAG  +  A+ +   +   P+  E   V    + G+S++++++ +
Sbjct: 151 ETQLPEATDLISRALRAGHSLPSALEMAGDELPQPIGPELAIVFGQINYGVSMNDALAGL 210

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
           +  +P+ ++ +    I +Q + GGNL+E L N+  ++R R  +  KV+ LS E +   WI
Sbjct: 211 IDRVPVDDLRYLVIAILIQRESGGNLAEILDNVGTLIRKRLQLLDKVRVLSAEGRLGGWI 270

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           + +LP  ++ +VY  +P  M+ L  DP G  ++  A A    G++ +R ++   +
Sbjct: 271 LTALPPAMAVVVYQLNPELMSTLWKDPVGIHMMWYAIAMTCFGVLWIRHIVRIHI 325


>gi|167902782|ref|ZP_02489987.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 223

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 36  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 95

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 96  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 155

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 156 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 215

Query: 182 MINFD 186
           + N D
Sbjct: 216 IANLD 220


>gi|291437533|ref|ZP_06576923.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340428|gb|EFE67384.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 312

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 84/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V     
Sbjct: 126 LNWQRQKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELSKVANQLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 186 VGASMDDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   + +A     +G +++R
Sbjct: 246 TQLSQVSMTSYAVPVLGVGSLFLMNGVKDGALERMTGSPVGQAAVIIAFGLYAVGFVLIR 305

Query: 181 LMINFDV 187
            +   DV
Sbjct: 306 RLSRIDV 312


>gi|167624198|ref|YP_001674492.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
 gi|167354220|gb|ABZ76833.1| type II secretion system protein [Shewanella halifaxensis HAW-EB4]
          Length = 325

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  K  + FP+ALD++ R+++AG   SDA+ ++  +   P+  EF  +    +
Sbjct: 139 LNRDTAKRMEKIEESFPDALDVLRRALQAGYSFSDAIKLVTEEMEGPLAKEFSLMFANIN 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
                  ++   +  +P      F++ + VQ + GGNL+E + NL+R++R R   + +V+
Sbjct: 199 YSKDTKRALLGFIERVPSVSAMAFASAVMVQKETGGNLAENINNLARVIRLRFTFRRRVR 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            LS E + SAWI+  LPF +  ++Y  +PGY+  L     G+ LL   A  M +G M + 
Sbjct: 259 TLSAEGRLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGNQLLIWGAIGMFVGGMWIS 318

Query: 181 LMINFDV 187
            +I  D+
Sbjct: 319 KLIRIDM 325


>gi|126452248|ref|YP_001066154.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242314755|ref|ZP_04813771.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|126225890|gb|ABN89430.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242137994|gb|EES24396.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
          Length = 331

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 144 RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 203

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 204 GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 263

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 264 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 323

Query: 182 MINFD 186
           + N D
Sbjct: 324 IANLD 328


>gi|163801673|ref|ZP_02195571.1| hypothetical Flp pilus assembly protein TadB [Vibrio sp. AND4]
 gi|159174590|gb|EDP59392.1| hypothetical Flp pilus assembly protein TadB [Vibrio sp. AND4]
          Length = 300

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/183 (26%), Positives = 99/183 (54%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L+KKR   F + FP+AL+I++ ++ AG  +  A++ +    +DP+  EF+ + +   L
Sbjct: 114 RYLVKKRRTNFENTFPDALNILMSAITAGDSLMQAISYVGDVMNDPIGVEFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +    + R  +  P  E  FF+  +      GG L   LA L R+L D + +  K  A
Sbjct: 174 GETPEVVLQRSCKNYPYPEFLFFAVTLRANIARGGQLKGVLARLIRVLVDARTLDKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N +++DP G ++L        +G++++ L
Sbjct: 234 MTSEARISAKIVAAIPVIFMIILNYINPDNLNFVLHDPSGRIVLFYVLGSEFLGLLIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVR 296


>gi|121599706|ref|YP_993002.1| Flp pilus assembly protein TadB [Burkholderia mallei SAVP1]
 gi|124386517|ref|YP_001026334.1| hypothetical protein BMA10229_A0332 [Burkholderia mallei NCTC
           10229]
 gi|126449976|ref|YP_001080392.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|121228516|gb|ABM51034.1| Flp pilus assembly protein TadB [Burkholderia mallei SAVP1]
 gi|124294537|gb|ABN03806.1| putative membrane protein [Burkholderia mallei NCTC 10229]
 gi|126242846|gb|ABO05939.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
          Length = 331

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 144 RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 203

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 204 GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 263

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 264 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 323

Query: 182 MINFD 186
           + N D
Sbjct: 324 IANLD 328


>gi|53719427|ref|YP_108413.1| hypothetical protein BPSL1814 [Burkholderia pseudomallei K96243]
 gi|76811973|ref|YP_333440.1| hypothetical protein BURPS1710b_2045 [Burkholderia pseudomallei
           1710b]
 gi|126441337|ref|YP_001058912.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134282297|ref|ZP_01769002.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|217421505|ref|ZP_03453009.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226196396|ref|ZP_03791978.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237812169|ref|YP_002896620.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254259104|ref|ZP_04950158.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|52209841|emb|CAH35813.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76581426|gb|ABA50901.1| putative membrane protein [Burkholderia pseudomallei 1710b]
 gi|126220830|gb|ABN84336.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|134246335|gb|EBA46424.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|217395247|gb|EEC35265.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225931613|gb|EEH27618.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506496|gb|ACQ98814.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254217793|gb|EET07177.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 331

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 144 RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 203

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 204 GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 263

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 264 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 323

Query: 182 MINFD 186
           + N D
Sbjct: 324 IANLD 328


>gi|197123314|ref|YP_002135265.1| type II secretion system protein [Anaeromyxobacter sp. K]
 gi|196173163|gb|ACG74136.1| type II secretion system protein [Anaeromyxobacter sp. K]
          Length = 320

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 61/184 (33%), Positives = 102/184 (55%), Gaps = 1/184 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              KR+AK  +  P ALD++ RS+RAG  V+ A  V+  +  +PV  EF R  E Q LGL
Sbjct: 136 ARAKRSAKLSEQLPEALDMMARSLRAGHAVTAAFQVVASEMPEPVSVEFARAYEEQRLGL 195

Query: 64  SLSESISRMVRYMP-LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +L  ++ +M    P   ++  F+    +Q + GGNL+E L  +   +R R     K++AL
Sbjct: 196 TLERAVVQMSERCPGNGDMKIFAVSAVIQRETGGNLAEILDQIGETIRQRYRFYGKLRAL 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +ASA I+G+LPF V+  +   +P Y+ VL    +G M++  A+   ++G++ +  +
Sbjct: 256 TGEGRASAVILGALPFAVAVALSILNPEYLMVLPGTAKGQMIILGASVSWVVGLLWLYRL 315

Query: 183 INFD 186
              D
Sbjct: 316 TQVD 319


>gi|21223383|ref|NP_629162.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|8218172|emb|CAB92603.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 316

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   
Sbjct: 130 LNWQRQKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELGKVADQLA 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 190 IGASMDDALGELAGRLPSRELVVLVTTLVLSNRAGGQVVGALRNLTETLEERKETRREVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   +  A A   +G +++R
Sbjct: 250 TQLSQVTMTSYAVPVLGIGSLLLMNGVKDGALERMTGSPAGQAAVITAFALYAVGFVLIR 309

Query: 181 LMINFDV 187
            +   DV
Sbjct: 310 RLSRIDV 316


>gi|149909543|ref|ZP_01898197.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
 gi|149807448|gb|EDM67399.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
          Length = 305

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 85/182 (46%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L ++   +F + FP AL+++  +V +G  +  A+  +       V  EF+ + +   LG
Sbjct: 121 WLQRREKKQFEEAFPEALNMLTSAVSSGESIMHAIIFVGTALDGEVGKEFKLMGDRLRLG 180

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    + GG L E +  L+R++ D + ++ K  AL
Sbjct: 181 DSPDSVFKKSCNRFPYPAFQFFVITLRANMRHGGQLKEIMTRLNRLMFDARAIEKKKFAL 240

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA I+G++PF    L+ + SP     ++  P G  +L        IGI ++  +
Sbjct: 241 TSEARASAKIVGAIPFVFLFLLQYLSPENFEFVMFHPSGRPILYYVLISEAIGISIIWAL 300

Query: 183 IN 184
           + 
Sbjct: 301 MK 302


>gi|254178308|ref|ZP_04884963.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|160699347|gb|EDP89317.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
          Length = 331

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 144 RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 203

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 204 GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 263

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 264 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 323

Query: 182 MINFD 186
           + N D
Sbjct: 324 IANLD 328


>gi|256785514|ref|ZP_05523945.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289769410|ref|ZP_06528788.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289699609|gb|EFD67038.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 316

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   
Sbjct: 130 LNWQRQKRIEKFINQLPELARILANATQAGLALRTAIGMAAEELEAPAGEELGKVADQLA 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 190 IGASMDDALGELAGRLPSRELVVLVTTLVLSNRAGGQVVGALRNLTETLEERKETRREVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   +  A A   +G +++R
Sbjct: 250 TQLSQVTMTSYAVPVLGIGSLLLMNGVKDGALERMTGSPAGQAAVITAFALYAVGFVLIR 309

Query: 181 LMINFDV 187
            +   DV
Sbjct: 310 RLSRIDV 316


>gi|156744076|ref|YP_001434205.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235404|gb|ABU60187.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 323

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 106/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M+   ++R   F D  P  LD+I  S+R G  +  ++A + G   +P+R+E RRV +   
Sbjct: 137 MRIRRQRRKQAFSDQLPETLDLITASMRGGFSLVQSLANVAGDVQEPMRTELRRVFQEVQ 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+++++  +V+ M   ++    T I + +++GGNL + L N+S  +R+R  ++ +V+
Sbjct: 197 LGLSITQALDNLVQRMESTDLDLVVTAIKIHARVGGNLGQILENISTTMRERAKLRREVR 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++   + S+++IG+LPF ++ +++  +P YM  L        +   A    + G +++R
Sbjct: 257 VITSMQRISSYVIGALPFALALIIFTINPTYMMRLFQPGLILCIPIGAFVSSVAGFLIIR 316

Query: 181 LMINFDV 187
            +++  +
Sbjct: 317 KIVDVRI 323


>gi|149175287|ref|ZP_01853909.1| secretion system protein TadB [Planctomyces maris DSM 8797]
 gi|148845896|gb|EDL60237.1| secretion system protein TadB [Planctomyces maris DSM 8797]
          Length = 323

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 105/187 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  KF    P+AL+++ R++R+G  +S  ++V+V +   P+ +EF    E Q+
Sbjct: 137 LLFRRNRRFKKFGQQLPDALELVGRALRSGHSLSSGLSVVVQEMPPPISTEFALAYEEQN 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + E++  M+  MP  ++ FF T + +Q Q GG+L+E L  +  I+R R  +  +VQ
Sbjct: 197 LGIPIGEALKNMLTRMPNLDLKFFVTAVVIQRQAGGDLAEILDKIGYIIRQRFKIMGQVQ 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E + S  ++ +LP  +   VY+ +P Y+ +L  D  G  ++       ++G + ++
Sbjct: 257 ALTGEGRISGVVLMALPIALFFAVYYLNPDYVMLLFTDELGRKMIAGGIVLQVLGALWIK 316

Query: 181 LMINFDV 187
            ++N  +
Sbjct: 317 KIVNIKI 323


>gi|254198194|ref|ZP_04904616.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|169654935|gb|EDS87628.1| type II secretion system protein [Burkholderia pseudomallei S13]
          Length = 331

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 144 RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 203

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 204 GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 263

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 264 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 323

Query: 182 MINFD 186
           + N D
Sbjct: 324 IANLD 328


>gi|319795560|ref|YP_004157200.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598023|gb|ADU39089.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 285

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 50/185 (27%), Positives = 95/185 (51%), Gaps = 1/185 (0%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              KKR  +   + P+AL  I  ++RAG  +S AV V+V     P+  EF  V++ Q LG
Sbjct: 102 WQRKKRRQQIESELPDALLFIASALRAGSALSVAVQVLVRDQQGPLGQEFGLVLKEQRLG 161

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S  ++I +M + + + +       + V  ++GGNLSE L  L+  LR +  ++ ++QAL
Sbjct: 162 VSFDDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIQAL 221

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + +    ++   P  +  ++Y   P  M +L +   G  +L V    + +G  ++R +
Sbjct: 222 TAQGRIQGLVMTLFPLLLMGVLYLMQPT-MGLLFSTKIGWAVLFVIGVMLFLGYAMIRKI 280

Query: 183 INFDV 187
           +  D+
Sbjct: 281 VAIDI 285


>gi|281356957|ref|ZP_06243447.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281316515|gb|EFB00539.1| Type II secretion system F domain protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 294

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  +R  KF     +AL +I  S++AG  ++ A+  +  Q+  P+  EFR +I+   
Sbjct: 108 LRQLKVRRLEKFNFQLEDALGVISSSLKAGFSINQALEEVAEQNIHPISVEFRLLIQEIR 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ + +++  M R +  ++    +T I    Q GG L+  L  ++ ++R+R  +  KV+
Sbjct: 168 LGVPVEQALENMNRRLRSEDFELVATAILTARQTGGELTGTLERVASLIRERVRISNKVR 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+   +  A +I   P  +   +++ +P  +   + +P G  LL VA  F +IG +++R
Sbjct: 228 ALTALGRLQAILIALTPVALLIGLWWINPVMIRAFVTNPIGIALLIVAGIFDVIGFLIIR 287

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 288 RIVTIEV 294


>gi|295836765|ref|ZP_06823698.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|295826196|gb|EFG64731.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 314

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 89/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   
Sbjct: 128 LNWQRAKRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ E++  + R +P +E+    T +++ ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 188 LGRSVDEALDELQRRLPSRELVVLVTTLALSNKAGGTVVGSLRNLTVTLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R
Sbjct: 248 TMLSEVNATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLGRIDV 314


>gi|302521639|ref|ZP_07273981.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302430534|gb|EFL02350.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 242

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   
Sbjct: 56  LNWQRAKRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLA 115

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ E++  + R +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 116 LGRSIDEALDELSRRLPSRELVVLVTTLVLSNKAGGTVVGSLRNLTVTLEERKETRREVR 175

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R
Sbjct: 176 TMLSEVNATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIR 235

Query: 181 LMINFDV 187
            +   DV
Sbjct: 236 RLGRIDV 242


>gi|209546475|ref|YP_002278393.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537719|gb|ACI57653.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 317

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 105/184 (57%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R  KF    P ALD+  RS+ AG P+  A++++  +  DP+ +EF  + +    G
Sbjct: 133 RARARRMRKFELKLPEALDVANRSLAAGHPLPAAISLVAREMPDPIGTEFGLLSDELTYG 192

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++L +++  +   + +++++  +  +SVQ+  GGNL E L NLS+ LRDR  +KAKV+A+
Sbjct: 193 VTLDDALVNLADRVGVEDLNLLAISLSVQAGTGGNLVEILQNLSKTLRDRSMLKAKVKAI 252

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + +A  +   PF +  ++   SP Y + +     G +++ V  A M IG +++  M
Sbjct: 253 SSEGRITAIFMSMYPFLLYAMIKALSPTYFDPVWESGHGAVVVTVLLAVMAIGNVILYKM 312

Query: 183 INFD 186
           +NF+
Sbjct: 313 VNFE 316


>gi|329890993|ref|ZP_08269336.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846294|gb|EGF95858.1| bacterial type II secretion system protein F domain protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 327

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 80/186 (43%), Positives = 120/186 (64%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K R  KF   F +A+DI+VR ++ GLPV D   +I  +S +P+  EFR ++E   
Sbjct: 141 IGMKAKARMKKFSLAFADAIDILVRGIKTGLPVHDCFKIIARESPEPLAGEFRTLVEGMG 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +GL+L++++ +M   MP  E+ FF+ VI++Q + GGNL+EAL NL+ +LR R+ M  K++
Sbjct: 201 VGLTLAQALDKMYERMPTPELKFFAIVIAIQQKSGGNLAEALGNLTTVLRARRMMVEKIK 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS EA ASA II SLP  V  LV  ++P YM ++  D RG ++L  AA +M  G+ VM+
Sbjct: 261 ALSSEAIASAGIIASLPPAVMILVMLSNPSYMMLMFTDIRGQVMLMGAALWMATGVFVMK 320

Query: 181 LMINFD 186
            MI+F 
Sbjct: 321 RMISFK 326


>gi|153833200|ref|ZP_01985867.1| TadB [Vibrio harveyi HY01]
 gi|156977405|ref|YP_001448311.1| Flp pilus assembly protein TadB [Vibrio harveyi ATCC BAA-1116]
 gi|148870471|gb|EDL69386.1| TadB [Vibrio harveyi HY01]
 gi|156528999|gb|ABU74084.1| hypothetical protein VIBHAR_06192 [Vibrio harveyi ATCC BAA-1116]
          Length = 300

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 94/183 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L+ +R   F + FP+AL+I++ +V AG  +  A++ +     + +  EF+ + +   L
Sbjct: 114 RYLVTRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGDVMDNSIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  +      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTLRANIARGGQLKGVLARLIRVLVDARTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N ++ DP G ++L         G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFMIILNYVNPDNVNFVLYDPSGRLVLFYVLGSEFFGLFIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVR 296


>gi|85705156|ref|ZP_01036256.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670478|gb|EAQ25339.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 322

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +   
Sbjct: 136 ISMKASKRMALLEEQLPDAIELMVRSLRVGHPFSSAIGIVATEVGDPLATEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDMGEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAKVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   +   P      +    P Y N  +        + V   F+++ ++VMR
Sbjct: 256 AITAEAKWSGKFLSGFPIMALIGIQVIKPDYYNEAMEHAFFIPAVLVVGVFLVMNLIVMR 315

Query: 181 LMINFDV 187
            ++N  V
Sbjct: 316 ALVNIKV 322


>gi|319791196|ref|YP_004152836.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315593659|gb|ADU34725.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 285

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 98/185 (52%), Gaps = 1/185 (0%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              KKR  +   + P+AL  I  ++RAG  +S A+ V+V     P+  EF  V++ Q LG
Sbjct: 102 WQRKKRRQQIESELPDALLFIASALRAGSALSVAIQVLVRDQVGPLGQEFGLVLKEQRLG 161

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +S  ++I +M + + + +       + V  ++GGNLSE L  L+  LR +  ++ +++AL
Sbjct: 162 VSFDDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIKAL 221

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + +    ++   P  +  ++Y   P  M++L     G ++L V A  +++G  ++R +
Sbjct: 222 TAQGRIQGLVMTLFPLLLMGVLYLMQPT-MSLLFTTTIGWVVLTVIAIMLMLGYAMIRKI 280

Query: 183 INFDV 187
           +  D+
Sbjct: 281 VAIDI 285


>gi|113867006|ref|YP_725495.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113525782|emb|CAJ92127.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 282

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 98/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K + +KR     D  P+AL ++  ++RAG     A+  +V +S  P+  EF  ++    
Sbjct: 96  VKKMQRKRLMAIEDQMPDALLMMSSALRAGASFPMALESVVAESRPPISQEFDLLMREVR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L +++  M + +P+ +    +  I++  ++GGNL+E L +++R LR++  M+ K++
Sbjct: 156 LGVDLMDALRNMEKRIPVPDFLMVTAAITISREVGGNLAETLESVARTLREKHQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + K    ++  LP  +  ++    P  M  L + P G   L V A   L+G   + 
Sbjct: 216 ALTAQGKMQGLVMTGLPLFLIVVLNHMEPVAMAPLFSSPIGWGTLSVIAVMELLGYKAIS 275

Query: 181 LMINFDV 187
            + + DV
Sbjct: 276 KITHIDV 282


>gi|167919044|ref|ZP_02506135.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
          Length = 216

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 29  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 88

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 89  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 148

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 149 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 208

Query: 182 MINFD 186
           + N D
Sbjct: 209 IANLD 213


>gi|239943898|ref|ZP_04695835.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           15998]
 gi|239990352|ref|ZP_04711016.1| putative integral membrane protein [Streptomyces roseosporus NRRL
           11379]
 gi|291447361|ref|ZP_06586751.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291350308|gb|EFE77212.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 314

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 86/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KRT +F++  P    I+  + +AGL +  ++++   +  +P   E  RV     
Sbjct: 128 LNWQRIKRTERFINQLPELSRILANATQAGLALRTSLSMAAEELENPAGEELARVARRLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L +++S +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 188 VGEPLEDALSELTDRLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTETLEERKETRREVK 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+ +         L+    PG ++ +     G   + VA     IG +V+R
Sbjct: 248 TQLSQVTVTAYAVPIFGVGAMLLMNAVMPGALDRMTGAFIGQAAVVVAIVLYAIGFVVIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLSRIDV 314


>gi|149188859|ref|ZP_01867149.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
 gi|148837279|gb|EDL54226.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
          Length = 300

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 99/183 (54%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R   F + FP+AL+I++ +V AG  +  A++ +    ++P+  EF+ + +   L
Sbjct: 114 RFLVGRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGEAMNNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLQRSCKNYPYPEFLFFTVTIRANIARGGQLKGVLARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P   + ++ + +P  ++ ++NDP+G  +L       LIG+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLIFTVILNYVNPANVDFVLNDPQGQYVLFYVLGSELIGLSIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVR 296


>gi|167911028|ref|ZP_02498119.1| type II secretion system protein [Burkholderia pseudomallei 112]
          Length = 217

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 30  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 89

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 90  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 149

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 150 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 209

Query: 182 MINFD 186
           + N D
Sbjct: 210 IANLD 214


>gi|323495641|ref|ZP_08100712.1| flp pilus assembly protein tadb [Vibrio sinaloensis DSM 21326]
 gi|323319276|gb|EGA72216.1| flp pilus assembly protein tadb [Vibrio sinaloensis DSM 21326]
          Length = 306

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M  L +++  +F   FP+AL+++  +V +G  +  ++  +       V  EF+R+ E   
Sbjct: 120 MSWLEQRQQKEFEMAFPDALNMLASAVSSGESLMHSIMFVGKTLEGSVGEEFKRMGERLQ 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S      +     P +   FF   +    Q GG L + +  L+R++ D + ++ K  
Sbjct: 180 LGESPDSVFKKSCNRFPYRSFQFFVITLRANMQRGGQLKDVITRLNRLMFDARAIEKKKY 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ EA+ SA I+ ++PF    ++ + SP   + ++N P+G  +L        IGI ++ 
Sbjct: 240 ALTSEARTSAKIVAAIPFFFLFILQYLSPENYDFVMNHPKGQPILYYMLISEAIGIGIIW 299

Query: 181 LMIN 184
            ++ 
Sbjct: 300 SLMK 303


>gi|328884728|emb|CCA57967.1| putative integral membrane protein [Streptomyces venezuelae ATCC
           10712]
          Length = 315

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+++   +   P   E  +V +   
Sbjct: 129 LGWQRQKRIEKFINQLPELSRILANATQAGLALRMALSLAADEMEAPAGDELEKVAQQLA 188

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G SL +++  +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 189 VGTSLDDALGELAERLPSRELVVLVTTLVLANRAGGTVVSSLRNLTETLEERKETRREVR 248

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+ +  +      L+    PG ++ +     G   +  A    ++G + +R
Sbjct: 249 TQLSQVSMTAYSVPVIGVGSLLLIDNMQPGALDRMTGSGLGQFAVVAAFGLYVVGFIAIR 308

Query: 181 LMINFDV 187
                DV
Sbjct: 309 RFSKIDV 315


>gi|312882148|ref|ZP_07741897.1| Flp pilus assembly protein TadB [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370194|gb|EFP97697.1| Flp pilus assembly protein TadB [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 300

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 93/183 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ KR   F + FP+AL+I++ +V AG  +  A+  +     + +  EF+R+ +   L
Sbjct: 114 RSLVTKRRRDFENTFPDALNILMSAVSAGDSLMQAIIYVGDVMDNAIGREFKRMGDRFKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  I      GG L   LA L R+L + + ++ K  A
Sbjct: 174 GESPDVILHRACKTYPYPEFLFFTVTIRANIARGGQLKGVLARLIRVLVESRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+  +P     L+ + +P  ++ +++DP G  LL        +G+ ++ L
Sbjct: 234 MTSEARISAKIVAMIPVIFMLLLNYINPENIDFILHDPSGRGLLYYVVGSEFLGLFIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVK 296


>gi|212635450|ref|YP_002311975.1| Tight adherence TadB-like transmembrane protein [Shewanella
           piezotolerans WP3]
 gi|212556934|gb|ACJ29388.1| Tight adherence TadB-like transmembrane protein, putative
           [Shewanella piezotolerans WP3]
          Length = 325

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 58/181 (32%), Positives = 98/181 (54%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR  K  + FP+ALD++ R+++AG   SDAV ++  +   P+  EF  +    +      
Sbjct: 145 KRMDKIEESFPDALDVLRRALQAGYSFSDAVKLVTEEMEGPLAKEFSLMFANINYSKDTK 204

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++   +  +P      F++ + VQ + GGNL+E + NLSR++R R   + +V+ LS E 
Sbjct: 205 RALLSFIERVPSVSAMAFASAVMVQKETGGNLAENIQNLSRVIRLRFTFRRRVRTLSAEG 264

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + SAWI+  LPF +  ++Y  +PGY+  L     GH LL   A  M +G + +  +I  D
Sbjct: 265 RLSAWILILLPFVLFAVIYIQTPGYVGELTGTEEGHKLLMWGAIGMFVGGLWISKIIRID 324

Query: 187 V 187
           +
Sbjct: 325 M 325


>gi|83719955|ref|YP_442976.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|257139200|ref|ZP_05587462.1| pilus assembly protein, putative [Burkholderia thailandensis E264]
 gi|83653780|gb|ABC37843.1| pilus assembly protein, putative [Burkholderia thailandensis E264]
          Length = 330

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 143 RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 202

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 203 GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 262

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 263 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 322

Query: 182 MINFD 186
           + N D
Sbjct: 323 IANLD 327


>gi|90412172|ref|ZP_01220178.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
 gi|90326896|gb|EAS43281.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum 3TCK]
          Length = 302

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            LIKKR  +F   FP+AL+I++ +V AG  V  +++ +     + V   F+ + E   LG
Sbjct: 118 WLIKKRQNEFEQAFPDALNIMMSAVTAGESVMQSISYVGKTLDNKVGDLFQDMGERLKLG 177

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               +   R  ++ P     FF   I      GG L   +A L R+L D + +  K  A+
Sbjct: 178 EPPEQVFKRASKHYPYPTFLFFVVTIRANMSRGGQLKAVMARLIRVLVDSRTLDKKKSAM 237

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ SLPF    ++ F SP  +N ++ DP G  +L        +G+ ++ L+
Sbjct: 238 TSEARLSAKIVASLPFIFMVILSFISPQNLNYVLTDPNGRYVLYYVVGSETLGLFIIWLL 297

Query: 183 IN 184
           I 
Sbjct: 298 IR 299


>gi|294631143|ref|ZP_06709703.1| integral membrane protein [Streptomyces sp. e14]
 gi|292834476|gb|EFF92825.1| integral membrane protein [Streptomyces sp. e14]
          Length = 313

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  AV +   +   P   E  +V     
Sbjct: 127 LSWQRQKRIEKFINQLPELARILANATQAGLALRTAVGMAAEELEAPAGEELGKVSHQLA 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 187 LGASMDDALGELADRLPSRELVVLVTTLVLANRAGGQVVSALRNLTETLEERKETRREVR 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G +  +   P G   + VA A   +G +++R
Sbjct: 247 TQLSQVNMTSYAVPVLGIGALFLMNGVKDGALERMTGSPIGQGAVIVAFALYAVGFVLIR 306

Query: 181 LMINFDV 187
            +   DV
Sbjct: 307 RLSRIDV 313


>gi|70734196|ref|YP_257836.1| hypothetical protein PFL_0694 [Pseudomonas fluorescens Pf-5]
 gi|68348495|gb|AAY96101.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 293

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 101/184 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + ++  P  LD  VRS+++G  ++DAV   +  S+DP++S   R+     
Sbjct: 108 IAWLYQRRLKRMIEQLPALLDHSVRSLKSGRTLADAVLGAIEASNDPLKSAMGRIQRNVQ 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG++L +++S    +    E+  F+  + V  + GGN SE L NL +++R+R+    ++ 
Sbjct: 168 LGVNLPDAVSDFAEFYEQDELRMFALGLKVNHRYGGNASELLENLIKLIREREQGARQLS 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +AW++G+LP  +      T+PGYM  + +D  G  +L  A    + G + + 
Sbjct: 228 AMTGETRMTAWVLGTLPLLLVGYFMLTNPGYMLGMWHDSAGQKMLITAVCLQIFGCLALW 287

Query: 181 LMIN 184
            M+ 
Sbjct: 288 RMLR 291


>gi|167815891|ref|ZP_02447571.1| type II secretion system protein [Burkholderia pseudomallei 91]
          Length = 212

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 25  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 84

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 85  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 144

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 145 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 204

Query: 182 MINFD 186
           + N D
Sbjct: 205 IANLD 209


>gi|152994351|ref|YP_001339186.1| type II secretion system protein [Marinomonas sp. MWYL1]
 gi|150835275|gb|ABR69251.1| type II secretion system protein [Marinomonas sp. MWYL1]
          Length = 329

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 100/187 (53%), Gaps = 4/187 (2%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++ + K   +F  + P A+D IVR  RAG+PVS+A  ++      P+  EF  V +   L
Sbjct: 143 RNAMAKHLKEFKQNLPQAIDSIVRIARAGVPVSNAFNLVAENLPGPLAKEFSLVDKWLRL 202

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L +++    + +PL E  FF  ++ +  + GG LS+ L  L+  LR+R+ +  K++A
Sbjct: 203 GVPLRQAMQDSAKRVPLNEYRFFVVILIINQEAGGRLSDTLERLAHTLRERQELALKIRA 262

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI----M 177
            + E +ASA I+ SL       +Y  SP     L+ND  G+ +L  A   +L+G+     
Sbjct: 263 KTSEVRASAVIVASLAPLSLAYMYLNSPKDFQFLLNDSTGNNVLFYAFGSVLLGLSITHF 322

Query: 178 VMRLMIN 184
           +++ +I 
Sbjct: 323 MIKRVIR 329


>gi|126725974|ref|ZP_01741816.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2150]
 gi|126705178|gb|EBA04269.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2150]
          Length = 323

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR     +  P+A++++VRS++ G P S A+A +  +S DP+ +EF  + +   
Sbjct: 137 VNGKAKKRLGMMEEQLPDAIELMVRSLKVGHPFSSAIAAVAAESPDPIGTEFGVIADEAA 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  +++S+  M   + +Q++ F + V+ +Q++ GGNL+E L  L+ ++R R  +  KV 
Sbjct: 197 YGGEITDSLQEMAERLDMQDLRFLAVVVGIQAKSGGNLAEILEGLASVIRSRFRLFRKVA 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S + + + P      +  T P + + ++        + V A  ++I I+ MR
Sbjct: 257 AITAEAKFSGFFLSAFPILALIGMLITKPDFYDEVMETSMFVPAVIVVAFLLIINIVFMR 316

Query: 181 LMINFDV 187
           +M N  V
Sbjct: 317 VMTNIKV 323


>gi|294676063|ref|YP_003576678.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474883|gb|ADE84271.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 322

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR     D  P+A++++VRS+R G P++ A+  +  +  DP+ +EF  + +   
Sbjct: 136 VNGKAGKRLKLAEDQLPDAVELMVRSLRVGHPLASAIQAVAKEIPDPLGTEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G ++ +S+  +   + +Q++ F +  +S+Q   GGNL+E L  L++++R R  +  +V+
Sbjct: 196 YGRNVVDSLRDLAERLDMQDLRFLAVAVSIQQTSGGNLAEVLEGLAKVIRSRFRLFRRVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E K S   + + P  V  ++   +P Y + + + P       +  A +   ++ M+
Sbjct: 256 AITAEPKWSGVFLSAFPVAVLVVIQVVAPTYYDNVKDSPSFVPAALIVFALLGANVLFMK 315

Query: 181 LMINFDV 187
           +M    V
Sbjct: 316 IMTTIKV 322


>gi|29829794|ref|NP_824428.1| hypothetical protein SAV_3252 [Streptomyces avermitilis MA-4680]
 gi|29606903|dbj|BAC70963.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 313

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 89/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   F+   P+   ++  +  AGL +  A+A+   +   P   E  RV +   
Sbjct: 127 LNWQRQKRIEAFIGQLPDVARLLANATAAGLALRTALAMAAEELEAPAGEELARVADQLT 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ +++  +   +P +E+    T + + ++ GG++  +L NL++ L DRK  + +V+
Sbjct: 187 LGRSVDDALDELAERLPSRELIVLVTTLVLANKAGGSVVSSLRNLTQTLEDRKETRREVR 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ +  L      L+  ++ G +  +     G  L+ ++     +G  V+R
Sbjct: 247 TMLSEVNATAFTVPLLGLGSLLLINSSNEGALARVTGSSLGQGLILLSLGLYTVGFFVIR 306

Query: 181 LMINFDV 187
            +   +V
Sbjct: 307 RLGKIEV 313


>gi|89053484|ref|YP_508935.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863033|gb|ABD53910.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 322

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 95/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    KKR +   +  P+A++++VRS+R G P   ++  +  + SDP+ SE   + +   
Sbjct: 136 VSRTAKKRLSLLEEQLPDAVELMVRSLRVGHPFVASINTVSREMSDPIASELGVIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  ++ESI  M   + +Q++ F +  + +Q   GGNL+E LA L+ ++R R  +  KV+
Sbjct: 196 YGRDVAESIRAMADRLDIQDLRFLAVAVGIQQTSGGNLAEILAGLADVMRARFKLFRKVR 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ EA+ S   +   P      +    P Y + +I+ P         A  + +  ++MR
Sbjct: 256 VITAEARGSGNFLSVFPILALVGINVMQPDYYSEVIDTPVFIPAAAGVAVALGLNWVIMR 315

Query: 181 LMINFDV 187
           +++N  V
Sbjct: 316 VLVNIKV 322


>gi|302553854|ref|ZP_07306196.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471472|gb|EFL34565.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 314

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/187 (19%), Positives = 86/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  KF++  P    I+  + +AGL +  A+ +   +   P   E  +V +   
Sbjct: 128 LNWQRQKRIEKFINQLPEMARILANATQAGLALRTAIGMAAEEMEAPAGEELGKVSDQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ +++  +   +P +E+    T + + ++ GG +  AL NL+  L +RK  + +V+
Sbjct: 188 VGASMDDALGELADRLPSRELVVLVTTLVLSNRAGGQVVSALRNLTETLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +++ +  L      L+     G ++ +     G   + +A +   +G +++R
Sbjct: 248 TQLSQVTMTSYAVPVLGVGSLFLMNGVKDGALDRMTGSAFGQAAVIIAFSLYAVGFVLIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLSRIDV 314


>gi|119773847|ref|YP_926587.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
 gi|119766347|gb|ABL98917.1| putative type II secretion system protein F [Shewanella amazonensis
           SB2B]
          Length = 283

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 99/186 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++L ++R  +F+   P+AL++I  S++AG  V++A+  +  +   P++ EF+  +  Q L
Sbjct: 98  RYLHQRRRRRFVHQLPDALNMIAASMQAGANVTNAIEFMADEMDAPIKQEFQLFLREQRL 157

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+  + ++  + + +P  E       + +   +GGNL+E L  LS  LR +  M+ K+ +
Sbjct: 158 GVEFNTALDNVYKRIPESEFQLVVAGMQISRDVGGNLAEVLVRLSETLRKKIEMEGKITS 217

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ + K    ++  LP  +   +Y   P  M  ++ +P G  ++ V++  +  G M ++ 
Sbjct: 218 LTSQGKMQGIVMTLLPVAIGFTLYHMEPVSMGRILTEPVGWAVIAVSSLLLFGGYMTIKK 277

Query: 182 MINFDV 187
           +I  DV
Sbjct: 278 IITIDV 283


>gi|307294431|ref|ZP_07574275.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880582|gb|EFN11799.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 333

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 102/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  K  + FP ALD  VR +RAG P++ A+ ++  +  DP+ SEF  V++   
Sbjct: 147 LTRLAQRRRKKMEEQFPVALDTFVRGLRAGHPIAAALDLLTKEMRDPIGSEFGIVVDEVT 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L +++ RM     + E+  F   +SVQS+ GGNL+E L NLS ++R+R ++  KV+
Sbjct: 207 YGADLRDALQRMAERWDMNEMHMFVISLSVQSETGGNLAEILENLSAVIRERASLFMKVR 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + +A ++ +LP      ++  +P +   +  +    +         +IG + +R
Sbjct: 267 ALSSEGRMTAVMLTALPILAFVGLFLVNPAFYLDVAQEKMFIVGFVGLITLYIIGFVTIR 326

Query: 181 LMINFDV 187
            M++  V
Sbjct: 327 RMVDLKV 333


>gi|115361040|ref|YP_778177.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115286368|gb|ABI91843.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 325

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/178 (29%), Positives = 101/178 (56%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             +R  K     P+  D+I R++R+G   S A+ ++  +  DP+  EFR   +  + G+S
Sbjct: 143 RNRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPDPMGGEFRITFDEINYGVS 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS 
Sbjct: 203 LHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSA 262

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           E + SAWI+G LPF  + ++   +  +++VL  DP G  ++GV    M  G++ +R +
Sbjct: 263 EGRLSAWILGLLPFGTAAMMAMMNREFLSVLWQDPAGIKMVGVMLGSMAFGLLWIRRI 320


>gi|318057611|ref|ZP_07976334.1| hypothetical protein SSA3_06719 [Streptomyces sp. SA3_actG]
 gi|318080453|ref|ZP_07987785.1| hypothetical protein SSA3_28141 [Streptomyces sp. SA3_actF]
 gi|333024717|ref|ZP_08452781.1| putative integral membrane protein [Streptomyces sp. Tu6071]
 gi|332744569|gb|EGJ75010.1| putative integral membrane protein [Streptomyces sp. Tu6071]
          Length = 314

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR   F+   P+   ++  +  AGL +  A+A+   +  +P   E   V +   
Sbjct: 128 LNWQRAKRIEAFISQLPDVARLLANATAAGLALRTALAMAAEELENPAGEELSNVADQLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S+ E++  + R +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 188 LGRSIDEALDELSRRLPSRELVVLVTTLVLSNKAGGTVVGSLRNLTVTLEERKETRREVR 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  A+A+ + +L      LV   + G ++ +     G  L+ ++     +G  V+R
Sbjct: 248 TMLSEVNATAFTVPALGLGSLLLVNAQNDGALHRVTGSGLGQFLILLSLGLYTVGFFVIR 307

Query: 181 LMINFDV 187
            +   DV
Sbjct: 308 RLGRIDV 314


>gi|320008844|gb|ADW03694.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 311

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/187 (19%), Positives = 86/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KRT  F+   P    ++  +  AGL +  ++A+   +   P   E R V +   
Sbjct: 125 LNWHRTKRTEAFISQLPEISRVLANATHAGLSLRTSIAMAADELESPAGDELRVVADQLG 184

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G +L +++  +   +P +E+    + + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 185 VGRTLDDALGELAERLPSRELVVLVSTLILSNRAGGQVVSSLRNLTVTLEERKETRREVR 244

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +  A+A+ + ++      LV    PG ++ +     G + + V+     +G + +R
Sbjct: 245 TQLSQINATAYAVPAIGIGAMLLVNSILPGALDRMTGSVVGQIAVIVSLGLYALGFVAIR 304

Query: 181 LMINFDV 187
            +   D+
Sbjct: 305 RVSKIDI 311


>gi|221633001|ref|YP_002522226.1| type II secretion system protein F domain [Thermomicrobium roseum
           DSM 5159]
 gi|221156079|gb|ACM05206.1| Bacterial type II secretion system protein F domain
           [Thermomicrobium roseum DSM 5159]
          Length = 323

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 102/185 (55%), Gaps = 1/185 (0%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              + R  +F++   + + ++  S+RAG  +   + ++  +S+ P+  EFRRV+    LG
Sbjct: 140 WRGRHRLQRFVNQLGDTIGLMANSLRAGYSLLQTMDLVARESAPPMSEEFRRVVREVGLG 199

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L +++  ++  +P +++    T I++  ++GGNL++ L  +   +R+R  +K +++ L
Sbjct: 200 VPLQDALDHLLERIPSEDLDLLVTAIAINHEVGGNLAQILEIIGETIRERVRIKGEIRVL 259

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + +   S +II  LP  ++ L++  +P Y+  L+  P    +   A   M++G +VMR +
Sbjct: 260 TAQQSLSGYIISLLPVGLAILIFLLNPSYLLSLLRWPW-ICMPIGAVICMVLGFVVMRRI 318

Query: 183 INFDV 187
           +  +V
Sbjct: 319 VAIEV 323


>gi|170700845|ref|ZP_02891834.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170134253|gb|EDT02592.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 325

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 101/178 (56%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             +R  K     P+  D+I R++R+G   S A+ ++  +  +P+  EFR   +  + G+S
Sbjct: 143 RNRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPEPMGGEFRITFDEINYGVS 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS 
Sbjct: 203 LHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSA 262

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           E + SAWI+G LPF  + ++   +  +++VL  DP G  ++GV    M  G++ +R +
Sbjct: 263 EGRLSAWILGLLPFGTAAMMAMVNREFLSVLWQDPAGIKMVGVMLGSMAFGLLWIRRI 320


>gi|220913385|ref|YP_002488694.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860263|gb|ACL40605.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 316

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R   F    P+ L +    +RAG  +  A+     ++  P+  E  R++    
Sbjct: 130 LNMLTARRRKTFDAQVPDTLQMFSGGLRAGHSLLRAIDAAAQENQGPMAEELSRIVNETR 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L ES++ + R    ++  + S  I +  ++GG+L+E L ++   +RDR  +K +V+
Sbjct: 190 IGRDLGESMADVSRRTASEDFYWISQAIEIHREVGGDLAEVLDHVGETIRDRNQVKGQVR 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SA ++ +LP  +   +   +P Y  V      G ++L  A A + +G + + 
Sbjct: 250 ALSAEGRISAMVLMALPILMFIGLVTFNPTYARVFTTTFIGFVMLAAAVALLAVGGLWLS 309

Query: 181 LMIN 184
            +I 
Sbjct: 310 RIIK 313


>gi|167894382|ref|ZP_02481784.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 205

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 18  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 77

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 78  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 137

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 138 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 197

Query: 182 MINFD 186
           + N D
Sbjct: 198 IANLD 202


>gi|167845810|ref|ZP_02471318.1| type II secretion system protein [Burkholderia pseudomallei B7210]
          Length = 202

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 15  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 74

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 75  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 134

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 135 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 194

Query: 182 MINFD 186
           + N D
Sbjct: 195 IANLD 199


>gi|167824264|ref|ZP_02455735.1| type II secretion system protein [Burkholderia pseudomallei 9]
          Length = 204

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 17  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 76

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 77  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 136

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 137 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 196

Query: 182 MINFD 186
           + N D
Sbjct: 197 IANLD 201


>gi|167738670|ref|ZP_02411444.1| type II secretion system protein [Burkholderia pseudomallei 14]
          Length = 200

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 13  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 72

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 73  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 132

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 133 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 192

Query: 182 MINFD 186
           + N D
Sbjct: 193 IANLD 197


>gi|237653360|ref|YP_002889674.1| type II secretion system protein [Thauera sp. MZ1T]
 gi|237624607|gb|ACR01297.1| type II secretion system protein [Thauera sp. MZ1T]
          Length = 289

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 94/184 (51%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L ++R        P+AL +I   +RAG+ ++ A+  +V +   P+  EF   +    LG+
Sbjct: 106 LRQRRLDLIEQQLPDALQVIAGGLRAGVSMTVALQQLVREGRPPIAQEFDLTLREHRLGI 165

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L E++  +   + +  ++     + + ++ GG+L+EAL   +  +R +  M+ K+ AL+
Sbjct: 166 PLDEALDHLAARVRMPSLTLVIAAMRIANETGGSLAEALERAALTVRSQLAMEGKIGALT 225

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + K  A ++G LP  +  ++    P  M  L + P G   L V A   ++G++++R ++
Sbjct: 226 AQGKLQAVVVGMLPLALLLVLDRMEPEAMGFLWHSPPGWATLAVIATLEVLGVLLIRRIV 285

Query: 184 NFDV 187
             DV
Sbjct: 286 AIDV 289


>gi|254393102|ref|ZP_05008262.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294814749|ref|ZP_06773392.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326443128|ref|ZP_08217862.1| hypothetical protein SclaA2_18783 [Streptomyces clavuligerus ATCC
           27064]
 gi|197706749|gb|EDY52561.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294327348|gb|EFG08991.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 313

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    KRT  F+   P    ++  + +AGL +  A+A+   +  DP   E   V +   
Sbjct: 127 LEWQRVKRTEAFIAQLPELTRVLANATQAGLSLRTALAMAAEELDDPAGHELGIVADQLA 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G SL +++  +   +P +E+    T + + ++ GG +  +L NL++ L +RK  + +V 
Sbjct: 187 VGQSLDDALGTLAERLPSRELIVLVTTLILANRAGGQVVTSLRNLTQSLEERKETRREVT 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               + K +A  +  L      ++   +PG ++ +     G      A     +G  ++R
Sbjct: 247 TTLSQIKVTALAVPLLGLGFLLMINGMTPGALDRMTGSVVGQGATLAAFGLYGLGAFLIR 306

Query: 181 LMINFDV 187
            +    V
Sbjct: 307 RLSRIQV 313


>gi|328952511|ref|YP_004369845.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452835|gb|AEB08664.1| Type II secretion system F domain protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 317

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 88/185 (47%), Gaps = 1/185 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              +R  K +   P+A+D IVRS++ G  V  A   +      P+ ++FR + E   +GL
Sbjct: 133 RRARREEKLVAQLPDAIDTIVRSLKVGQSVDAATLEVARGFPPPIGADFRAINEEMAMGL 192

Query: 64  SLSESISRMVRYMPL-QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
                I    R  P   +V        +Q + GG L++ LA L+  +R R + + +V+A 
Sbjct: 193 PFETVIKNFQRRYPRLPDVRILCATFVIQRETGGKLTDILAGLASTIRARLHFQRRVRAS 252

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A+I+G LP   + + +   P YM V  + P G  LL V       G +VMR M
Sbjct: 253 TAEGRTTAFILGILPLGFAAVTWLLRPEYMRVFRDHPLGRKLLVVVILMEAAGFLVMRAM 312

Query: 183 INFDV 187
           +   V
Sbjct: 313 LRVKV 317


>gi|72162674|ref|YP_290331.1| integral membrane protein [Thermobifida fusca YX]
 gi|71916406|gb|AAZ56308.1| putative integral membrane protein [Thermobifida fusca YX]
          Length = 310

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 89/186 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR   F    P    ++  + +AGL +  A+ +   + +DP  +E R V E+  
Sbjct: 124 LNRQEEKRREAFTAQLPELARVLSNATQAGLALPTAIDMAADELADPAGAELRHVAESIK 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    E+++ + + MP +E+    + + V ++ GG L  AL N+S  L +RK  + +V+
Sbjct: 184 VGQPFEEALNDLRKRMPSREIGVLISTLLVSARSGGALVTALRNISETLENRKETRREVR 243

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  E  ++AW +  +      L+    PG +  +     G ++LG A     IG +V+R
Sbjct: 244 TILSETTSTAWTLLLMGVGSLFLLNALMPGTVARMTESFAGLVVLGAALTLFTIGFVVIR 303

Query: 181 LMINFD 186
            M   D
Sbjct: 304 RMSRID 309


>gi|167719678|ref|ZP_02402914.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 205

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 18  RILIGRFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 77

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 78  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 137

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+N+L +   GH +L +AA  + +G+ ++R 
Sbjct: 138 LTAEGRIASKIIAAVPFAIAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRK 197

Query: 182 MINFD 186
           + N D
Sbjct: 198 IANLD 202


>gi|116255774|ref|YP_771607.1| putative transmembrane pilus component protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115260422|emb|CAK03526.1| putative transmembrane pilus component protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 318

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 132 IRYYLQRRWLQIESQLPYAVDQIVSAVRTGKPLAIAVNAVADTGQMPASREFERIAREQK 191

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 192 LGIGLVEALDRHGRNVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 251

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 252 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 311

Query: 181 LMINFDV 187
            M+   V
Sbjct: 312 SMMKVSV 318


>gi|78062902|ref|YP_372810.1| type II secretion system protein [Burkholderia sp. 383]
 gi|77970787|gb|ABB12166.1| type II secretion system protein [Burkholderia sp. 383]
          Length = 325

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 119/185 (64%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++++   +++PVR+ FR + ++  +
Sbjct: 138 RALVERFRIRFLEAFPDAIDVIVRAVRAGIPVTQAISMVGDGAAEPVRATFRSMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GADLKDVLTQAADRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   G+ +L +AA  + +G++V+R 
Sbjct: 258 LTAEGRITTNIISAVPFVMIGALFLVNRDYVMLLFSTHPGNTMLTIAAGLLTVGLLVIRK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|319788659|ref|YP_004148134.1| type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467171|gb|ADV28903.1| Type II secretion system F domain [Pseudoxanthomonas suwonensis
           11-1]
          Length = 282

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 95/185 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L ++R  +  +  P+AL ++  S+RAG+  S A+ V+V     P+  E   V+  QH+G
Sbjct: 98  MLRRRRLDRIQEQLPDALQMLASSLRAGVGFSPAMEVLVQDGQPPLAQELALVLRQQHMG 157

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +   E++    + +P+ +   F + +++  ++GGNL+E LA L+  LR R  M+ KV+AL
Sbjct: 158 VRADEALESFSKRVPIVDAELFVSAVNISREVGGNLAETLATLAETLRRRLIMEKKVKAL 217

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + + K    ++  LP  +   +       M  + +   G +++GV      +G  + + +
Sbjct: 218 TAQGKLQGIVMALLPVFLVGYLSLMYAETMAPMFHSWHGWLVIGVCVVMEYLGYRMCKKI 277

Query: 183 INFDV 187
           +  DV
Sbjct: 278 MTIDV 282


>gi|182436319|ref|YP_001824038.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776949|ref|ZP_08236214.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464835|dbj|BAG19355.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657282|gb|EGE42128.1| Type II secretion system F domain protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 314

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 86/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KRT +F++  P    I+  + +AGL +  ++++   +  DP   E  RV     
Sbjct: 128 LNWQRIKRTERFINQLPELSRILANATQAGLALRTSLSMAAEELEDPAGEELARVARRLA 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L +++S +   +P +E+    T + + ++ GG +  +L NL+  L +RK  + +V+
Sbjct: 188 VGEPLEDALSELTDRLPSRELVVLVTTLVLSNRAGGTVVSSLRNLTETLEERKETRREVK 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+ +         L+    PG ++ +     G + + V+     IG +V+R
Sbjct: 248 TQLSQVTVTAYAVPLFGIGAMLLMNAVMPGALDRMTGAFFGQVAVVVSIVLYAIGFVVIR 307

Query: 181 LMINFDV 187
                DV
Sbjct: 308 RFSRIDV 314


>gi|148975966|ref|ZP_01812755.1| hypothetical Flp pilus assembly protein TadB [Vibrionales bacterium
           SWAT-3]
 gi|145964711|gb|EDK29964.1| hypothetical Flp pilus assembly protein TadB [Vibrionales bacterium
           SWAT-3]
          Length = 300

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/183 (26%), Positives = 94/183 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+ +R   F + FP+AL+I++ +V AG  +  A++ +     +P+  EF+ + +   L
Sbjct: 114 RFLVTRRRRDFENTFPDALNILMSAVTAGDSLMQAISYVGEVMDNPIGREFKLMGDRLKL 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S    + R  +  P  E  FF+  +      GG L   LA L R+L D + ++ K  A
Sbjct: 174 GESPEVVLKRSCKNYPYPEFLFFTVTLRANIARGGQLKGVLARLIRVLVDSRTLEKKKMA 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA I+ ++P     ++ + +P  +N ++ D  G ++L       L G+ ++ L
Sbjct: 234 MTSEARISAKIVAAIPLVFMIILNYVNPDNVNYVLYDESGRVVLFYVLGSELFGLFIVWL 293

Query: 182 MIN 184
           ++ 
Sbjct: 294 LVR 296


>gi|209515955|ref|ZP_03264816.1| type II secretion system protein [Burkholderia sp. H160]
 gi|209503613|gb|EEA03608.1| type II secretion system protein [Burkholderia sp. H160]
          Length = 325

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 64/185 (34%), Positives = 117/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +  A+FL  FP+ LD+I+R+VRAG+PV  A++    ++ +PVRS FR + ++  L
Sbjct: 138 RFLIARFRAQFLLVFPDTLDLIIRAVRAGIPVVQAISTAGKEAEEPVRSTFRTMGDSLRL 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L E + + V  + + + SFF+  + +Q + GGNL E L NLS I+R R++++ K +A
Sbjct: 198 GADLKEVLDKAVARLQIADFSFFAVCLLLQRETGGNLGETLENLSGIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF +   +Y  +  Y+++L +   GH +L +AA  ++IG+ +++ 
Sbjct: 258 LTAEGRIASKIISAVPFAIMGFLYVINRPYVDLLFHTRAGHKMLTLAAVLLVIGLSLIQK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|307245408|ref|ZP_07527496.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307254363|ref|ZP_07536201.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307258821|ref|ZP_07540553.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306853749|gb|EFM85966.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306862662|gb|EFM94618.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306867172|gb|EFM99028.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 295

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 80/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G  +
Sbjct: 114 RRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLARGEDV 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 174 MAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 234 ARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIWWLMR 292


>gi|190149861|ref|YP_001968386.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251576|ref|ZP_07337750.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307249755|ref|ZP_07531733.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252111|ref|ZP_07534010.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307263185|ref|ZP_07544806.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|189914992|gb|ACE61244.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302649574|gb|EFL79756.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306858170|gb|EFM90248.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860411|gb|EFM92425.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306871547|gb|EFN03270.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 295

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 80/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G  +
Sbjct: 114 RRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLARGEDV 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 174 MAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 234 ARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIWWLMR 292


>gi|172065280|ref|YP_001815992.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171997522|gb|ACB68439.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 325

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 101/178 (56%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             +R  K     P+  D+I R++R+G   S A+ ++  +  DP+  EFR   +  + G+S
Sbjct: 143 RNRRMLKLERQLPDICDMIARALRSGHSFSSALGMVGEEFPDPMGGEFRITFDEINYGVS 202

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L +++  +   +P  ++ +F   + +Q + GGNL+E L +++ ++R+R  +  KV+ LS 
Sbjct: 203 LHDALVNLATRVPAHDLRYFVIAVLIQRETGGNLAELLDSIASLVRERFKLFDKVRVLSA 262

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           E + SAWI+G LPF  + ++   +  +++VL  DP G  ++G     M +G++ +R +
Sbjct: 263 EGRLSAWILGLLPFGTAAMMAMLNREFLSVLWQDPAGIKMVGAMLGSMALGLLWIRRI 320


>gi|46143338|ref|ZP_00204445.1| COG4965: Flp pilus assembly protein TadB [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208033|ref|YP_001053258.1| tight adherence protein B [Actinobacillus pleuropneumoniae L20]
 gi|165975970|ref|YP_001651563.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|303252183|ref|ZP_07338351.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307247523|ref|ZP_07529568.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|126096825|gb|ABN73653.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165876071|gb|ABY69119.1| Flp pilus assembly protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|302648966|gb|EFL79154.1| tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|306856026|gb|EFM88184.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
          Length = 295

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 80/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G  +
Sbjct: 114 RRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFAIIYKRLARGEDV 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 174 MAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 234 ARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIWWLMR 292


>gi|282865304|ref|ZP_06274356.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559777|gb|EFB65327.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 312

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KRT  F++  P    ++  + +AGL +  A+ + V +  +P + E RRV +   
Sbjct: 126 LNWQRGKRTEAFINQLPELTRVLANATQAGLALRTAIGMAVEELDNPAQEELRRVADRLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G SL ++++ +V  +P +E++   + + + ++ GG +  +L NL+  L +RK  + +V 
Sbjct: 186 VGHSLDDALNELVERLPSRELTVLVSTLILSNRAGGTIVSSLRNLTETLEERKETRREVT 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L  + K +A  +  L      ++     G ++ +     G + + VAA     G   + 
Sbjct: 246 TLLSQVKVTAVAVPILGLGFLLIINGMRAGALDDMTGSTPGRIAVVVAAGLYAAGFFFIN 305

Query: 181 LMINFDV 187
            +    +
Sbjct: 306 RLTRVRI 312


>gi|116623252|ref|YP_825408.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226414|gb|ABJ85123.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 321

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 111/187 (59%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   + R A F D FP+ L+ + RS+RAG   S A+ +   + SDP+  E RR  E Q+
Sbjct: 135 VRRKARMRVAAFEDQFPDCLEFVSRSMRAGHAFSVAIEMAHREFSDPLAGELRRAFEEQN 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L   + ++ + +P  +V FF + + +Q + GGNL+E L  L++++R+R  ++A+++
Sbjct: 195 LGQPLEIVLRKLSQRVPSMDVQFFVSAVLLQKRTGGNLAELLDKLAQLMRERFKLRARIR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S +   S  I+ ++P  V+ +++  +P Y    I+DP GH L+       L+G +++R
Sbjct: 255 AVSAQGLMSGRILSAIPAGVAVMMFLVNPKYARFFIDDPVGHELMAAGLGLQLLGYLIIR 314

Query: 181 LMINFDV 187
            ++ FDV
Sbjct: 315 KIVTFDV 321


>gi|307256570|ref|ZP_07538351.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306864980|gb|EFM96882.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 295

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 80/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G  +
Sbjct: 114 RRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFAIIYKRLARGEDV 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 174 MAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 234 ARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIWWLMR 292


>gi|332798624|ref|YP_004460123.1| Type II secretion system F domain-containing protein
           [Tepidanaerobacter sp. Re1]
 gi|332696359|gb|AEE90816.1| Type II secretion system F domain protein [Tepidanaerobacter sp.
           Re1]
          Length = 309

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 97/186 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K  I K+  +F     +AL I+   +RAG  ++ A+  +     DP+ SEFR       
Sbjct: 123 LKMSINKKQIQFEKQLGDALQILANGLRAGFSLTQAIESLAKDMPDPLGSEFRTASRELL 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ +   +S++   M  +++   +  + +Q Q+GGNL+E L N+S+ +RDR  +K  V+
Sbjct: 183 LGMDIETVLSKIADRMKSEDMRLLTAAVVIQLQVGGNLAEILDNISQTIRDRLAIKRSVR 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  I+G +P  +  ++   SP Y ++      GH+++ ++     +G + + 
Sbjct: 243 TLTAQGRISGQIVGIIPIALLLIISIISPDYTSIFFTTTYGHIMIFISVIMECLGFLAIY 302

Query: 181 LMINFD 186
            +++  
Sbjct: 303 KIVDIK 308


>gi|253580449|ref|ZP_04857714.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848179|gb|EES76144.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 257

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 42/192 (21%), Positives = 89/192 (46%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRV 55
             +I++R       F +AL  +  +V+AG  V  AV   V            +  EFR +
Sbjct: 66  NRMIRERRKNLNYQFKDALTSLSVAVQAGYSVESAVKTCVRDLERLYGKGTDIVEEFRYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
              QH+ + L E    +     ++++  F++V     + GG+++  +  +SR+L D+ ++
Sbjct: 126 ESQQHISVPLEELFLDLGERSQIEDIENFASVFYTAKRTGGDMNRVIQKVSRMLGDKIDV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +++A     K+   I+  +P  +   +  TSPG+++VL  +P G   + +        
Sbjct: 186 KKEIEATLAAKKSEQMIMSLMPVGIILYLQMTSPGFLSVLYGNPFGIAAMSICLVIYAAA 245

Query: 176 IMVMRLMINFDV 187
             + R +++ +V
Sbjct: 246 YWLGRRIVDIEV 257


>gi|90406746|ref|ZP_01214939.1| MaoC protein [Psychromonas sp. CNPT3]
 gi|90312199|gb|EAS40291.1| MaoC protein [Psychromonas sp. CNPT3]
          Length = 308

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 95/184 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            +  ++  +F   FP  ++ I R+V AG+ V  A+A +       +  EF  + +   +G
Sbjct: 123 FIRAQQIKEFEHSFPQVIEQISRAVAAGISVPQAIAQVPEYQQGLLAHEFSLLRDRLEIG 182

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL +++ +    +P     FFS  + +  + GG L E L +LSR L +   +K K+++L
Sbjct: 183 ISLKQALQQSTYRLPYSGFHFFSVALILNQENGGQLREVLHSLSRTLHNNHAIKMKIKSL 242

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A ++  LP C+ +++YF SP    VL + P G+ +L      M +G+ ++ ++
Sbjct: 243 TAEPRMTALVLACLPLCLISVMYFKSPASFAVLTDTPTGNDVLMYVIGSMALGLGIINVL 302

Query: 183 INFD 186
               
Sbjct: 303 TKVR 306


>gi|254506141|ref|ZP_05118285.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
 gi|219550959|gb|EED27940.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus 16]
          Length = 306

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 89/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  ++  +F   FP+AL+++  +V +G  +  ++  +       V  EF+R+ E   
Sbjct: 120 LTILESRQQKEFEMAFPDALNMLASAVSSGESLMHSIIFVGKSLEGSVGEEFKRMGERLQ 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S      +     P +   FF   +    Q GG L + +  L+R++ D + ++ K  
Sbjct: 180 MGESPDTVFRKSCNRFPYRSFQFFVITLRANMQRGGQLKDVITRLNRLMFDARAIEKKKY 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ EA+ SA I+ ++PF    ++ + SP   + ++N P+G  +L        IGI ++ 
Sbjct: 240 ALTSEARTSAKIVAAIPFFFLFMLQYLSPENYDFVMNHPKGQPILYYMLISEAIGISIVW 299

Query: 181 LMIN 184
            ++ 
Sbjct: 300 GLMR 303


>gi|54309664|ref|YP_130684.1| Flp pilus assembly protein TadB [Photobacterium profundum SS9]
 gi|46914102|emb|CAG20882.1| hypothetical Flp pilus assembly protein TadB [Photobacterium
           profundum SS9]
          Length = 302

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L+KKR  +F   FP+AL+I++ +V AG  +  +++ +     + V + F+ + E   LG
Sbjct: 118 WLLKKRRDEFEQTFPDALNIMMSAVTAGESIMQSISYVGKTLDNKVGAVFQDMGERLKLG 177

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               +   R  ++ P     FF   I      GG L   +A L R+L D + +  K  A+
Sbjct: 178 EPPEQVFKRASKHYPYPTFLFFVVTIRANMSRGGQLKPVMARLIRVLVDSRTLDKKKSAM 237

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ SLPF     + F SP  +N ++ DP G  +L        +G+ ++ L+
Sbjct: 238 TSEARLSAKIVASLPFIFMVFLSFISPQNLNYVLTDPSGRYVLYYVVGSETLGLFIIWLL 297

Query: 183 IN 184
           I 
Sbjct: 298 IR 299


>gi|312883312|ref|ZP_07743038.1| putative Flp pilus assembly protein TadB [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368928|gb|EFP96454.1| putative Flp pilus assembly protein TadB [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 304

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 91/183 (49%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K++  ++   F+++FP+AL+I+  ++ +G  +  A   +  Q ++ V  EF+ + E   +
Sbjct: 119 KYMGGRKKKIFVENFPDALNILSGAISSGQSIVHAFEYVGSQLNNDVGKEFKIISERLLI 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +  + + R     P  E  FF + I +    GG L + +  ++R++ + ++++ K  +
Sbjct: 179 GENPDDVLERSGIQYPYLEYFFFISAIRINISRGGQLKDIINKINRLMFESRSLEKKKNS 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E++ SA I+G LP     ++ F SP   + ++    G  +         IG  ++  
Sbjct: 239 LTAESRMSAKILGVLPIGFLFVLKFISPEDFDFVMFQEEGRPIFYYLICSEFIGFFIIWR 298

Query: 182 MIN 184
           +I 
Sbjct: 299 IIK 301


>gi|32471257|ref|NP_864250.1| hypothetical protein RB1148 [Rhodopirellula baltica SH 1]
 gi|32396959|emb|CAD71929.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 314

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 3/179 (1%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P    +I R+VR+G  V+ A+ +I      P+R EF    E Q LG+    
Sbjct: 138 RNQQLSRQLPEVFQLISRAVRSGQTVTSALQMIAEDCPSPIREEFALCYEQQELGMWREL 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +  ++     + E+  F   + VQ++ GG+L E L NLS+++  R  ++ +++AL+ E +
Sbjct: 198 AFRKLAERNQVMELRIFVVALLVQNRSGGDLVELLDNLSKMVTKRLRLRDRIKALTAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             A ++  LPF     +   SP Y   L+  PR   LL        IG +++R ++NF+
Sbjct: 258 MQALVLVVLPFVALGAIVLFSPEYAETLLERPR---LLVATGVSQGIGALLIRRIVNFE 313


>gi|86360425|ref|YP_472313.1| hypothetical protein RHE_PE00149 [Rhizobium etli CFN 42]
 gi|86284527|gb|ABC93586.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 321

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 135 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAVAVNAVADTGQMPASREFERIAREQK 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 195 LGIGLVEALDRHGRTVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIS 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 255 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 314

Query: 181 LMINFDV 187
            M+   V
Sbjct: 315 SMMKVSV 321


>gi|209809174|ref|YP_002264712.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
 gi|208010736|emb|CAQ81127.1| bacterial type II secretion system protein F [Aliivibrio
           salmonicida LFI1238]
          Length = 303

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 87/182 (47%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L K+   +F D FP+AL+++  +V +G  +  A+  +       V  EF+R+ E   LG
Sbjct: 118 WLGKREKNRFEDSFPDALNMLSSAVSSGEGIMHAIIFVGASLDGKVGKEFKRMGEQLQLG 177

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S      +     P     FF   +    + GG L E +  L+R++   ++++ K  AL
Sbjct: 178 ESPDTVFRKSCARFPYPSFQFFIITLRTSMERGGQLKEIMRRLNRLMFGARSIEKKKYAL 237

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ S+PF    ++ + SP     ++ +P G  +L        IGI+ + L+
Sbjct: 238 TSEARTSAKIVASIPFIFLFMLQYLSPENYEYVMFNPDGRPILYYVLISESIGILTIWLL 297

Query: 183 IN 184
           + 
Sbjct: 298 MK 299


>gi|323493930|ref|ZP_08099047.1| putative Flp pilus assembly protein TadB [Vibrio brasiliensis LMG
           20546]
 gi|323311871|gb|EGA65018.1| putative Flp pilus assembly protein TadB [Vibrio brasiliensis LMG
           20546]
          Length = 304

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 92/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L +++  KF ++FP+AL+I+  ++ +G  +  A   +  Q  + V +EF+ + E   +G
Sbjct: 120 KLKQRQEEKFKNNFPDALNILSGAISSGQSIVHAFEYVGKQLDNEVGNEFKFMAERLLIG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL
Sbjct: 180 EDPDDVLERSATTFPYLEYFFFASTIRINLSRGGQLKDVINRINRLMFDSRAVEKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA II  LP     ++ FTSP   + ++ +P G  +         IG + +  +
Sbjct: 240 TSEARASAKIIACLPVIFLVILKFTSPENYSFVMFEPGGQPIFYYVLISEFIGFVCIWFI 299

Query: 183 IN 184
           + 
Sbjct: 300 LR 301


>gi|221197784|ref|ZP_03570830.1| type II secretion system protein [Burkholderia multivorans CGD2M]
 gi|221204658|ref|ZP_03577675.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221175515|gb|EEE07945.1| type II secretion system protein [Burkholderia multivorans CGD2]
 gi|221181716|gb|EEE14117.1| type II secretion system protein [Burkholderia multivorans CGD2M]
          Length = 337

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 88/186 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 152 LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLR 211

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 212 GGVEIDRAMLHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 271

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  +++ V  T+P Y++ + NDP G MLL +A    L G + + 
Sbjct: 272 AMSAETRLSAFVLVMLPIAIASFVIMTNPQYLHGMWNDPSGQMLLVIAFLLQLFGSIWLY 331

Query: 181 LMINFD 186
            M    
Sbjct: 332 RMARLR 337


>gi|221213136|ref|ZP_03586112.1| type II secretion system protein [Burkholderia multivorans CGD1]
 gi|221167349|gb|EED99819.1| type II secretion system protein [Burkholderia multivorans CGD1]
          Length = 337

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 88/186 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 152 LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLR 211

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 212 GGVEIDRAMLHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 271

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  +++ V  T+P Y++ + NDP G MLL +A    L G + + 
Sbjct: 272 AMSAETRLSAFVLVMLPIAIASFVIMTNPQYLHGMWNDPSGQMLLVIAFLLQLFGSIWLY 331

Query: 181 LMINFD 186
            M    
Sbjct: 332 RMARLR 337


>gi|227114880|ref|ZP_03828536.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 326

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 98/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     L
Sbjct: 141 RSTLQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+
Sbjct: 201 GIPLRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQS 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+ +L       +Y  SP   + L +DP G  +L  A   + +G+++  +
Sbjct: 261 KTSEARASAKIVAALFPGCLAYLYMKSPEDFSFLFSDPVGTTVLIYALCSVSVGMLITHV 320

Query: 182 MIN 184
           M+ 
Sbjct: 321 MVK 323


>gi|167842100|ref|ZP_02468784.1| type II secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 200

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 13  RILIARFKQRFLGVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 72

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + + +    + L + SFF   + +Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 73  GADLKDVLEQQAERLQLADFSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRA 132

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+++L     GH +L +AA  + IG+ ++R 
Sbjct: 133 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIDLLFRTRAGHKMLILAAVLLTIGLAMIRK 192

Query: 182 MINFD 186
           + N D
Sbjct: 193 IANLD 197


>gi|325111218|ref|YP_004272286.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324971486|gb|ADY62264.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 286

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/184 (20%), Positives = 86/184 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +  +R  + L   P  +D + R+ R G  +   + ++   +  P+  E  R +    
Sbjct: 98  LMTMRSRRQGQILRQLPPMIDELARAARTGRSLDQCLEMVATDTPAPLGDEMERSVRKLQ 157

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++++E++  +     +  +   +T +SV  Q GG+L   L  L+R LRDR     +++
Sbjct: 158 MGVTMNEALYELPERTGVNGLRILATALSVHQQTGGDLVRVLERLARTLRDRGMFLGRLR 217

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++  ++A+A ++  LP  +     F  P Y+  L+    G  +        ++G + + 
Sbjct: 218 AITAGSRATALLMILLPPAILVFFIFRDPDYLASLMASNWGRFITIAGVILEIVGAIWIL 277

Query: 181 LMIN 184
            ++N
Sbjct: 278 KILN 281


>gi|167581956|ref|ZP_02374830.1| pilus assembly protein, putative [Burkholderia thailandensis TXDOH]
          Length = 219

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 32  RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 91

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 92  GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 151

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 152 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 211

Query: 182 MINFD 186
           + N D
Sbjct: 212 IANLD 216


>gi|304311187|ref|YP_003810785.1| type II secretion system protein F [gamma proteobacterium HdN1]
 gi|301796920|emb|CBL45133.1| type II secretion system protein F [gamma proteobacterium HdN1]
          Length = 295

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 95/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K R+ KF+   P+AL  +  ++++GL +  ++  +V    +P+  EF +V+    
Sbjct: 109 LLEMKKNRSDKFVKQMPDALAAMSTALKSGLNLVKSLQQVVRNQPEPLAQEFAQVLVEYR 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L++S   + + +   EV   ++ I +   +GGNL+    NL+  LR+   ++ K++
Sbjct: 169 IGTDLNDSFGDLAKRIDRPEVVLMNSAIRINRSVGGNLAATFENLADSLRETSKVEGKIK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++    +   +  ++P  V+ + +      M +L +   G + LG+      +G+  ++
Sbjct: 229 AMTAMGSSQGKLALAVPIVVALVFFQQERAAMEMLFHTKLGWIWLGMMVFSAFLGMTFIK 288

Query: 181 LMINFDV 187
            ++N DV
Sbjct: 289 KIVNVDV 295


>gi|171921005|gb|ACB59188.1| TadB [Actinobacillus suis ATCC 33415]
          Length = 295

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 79/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G   
Sbjct: 114 RRNKKLFNEKFPEVIQVLNSATSSGISLLQALERCGKDITGPIGEEFSIIYKRLARGEDA 173

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 174 MAVFHDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 233

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 234 ARMSAAIVACFPVAFFLFMKVTTPENFDFVVNDPNGRIILYYVVGSELLGMFIIWWLMR 292


>gi|218708111|ref|YP_002415732.1| putative bacterial type II secretion system protein F [Vibrio
           splendidus LGP32]
 gi|218321130|emb|CAV17080.1| putative bacterial type II secretion system,protein F, TadB [Vibrio
           splendidus LGP32]
          Length = 306

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL K+   +F + FP+AL+++  S+ AG  +   +  +  +    V  EF+ + E  +LG
Sbjct: 122 HLQKREKKRFEETFPDALNMLASSLSAGESIGRGIGYVGKKLEGEVGKEFKLMSERLNLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             + +   +  R  P     FF   +    Q GG L E ++ L+R + + + ++ K  AL
Sbjct: 182 EPIDDVFRKSCRRFPYPSFHFFVITLRANMQRGGQLKEVMSRLNRQMFEARAVERKKFAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+G+ PF    ++ F SP     +++ P G  +L        IG++++  +
Sbjct: 242 TSEARISAKIVGATPFFFLFILQFLSPENFEFVMHHPEGRPILYYLITSESIGMLIIWAL 301

Query: 183 IN 184
           + 
Sbjct: 302 MK 303


>gi|77456873|ref|YP_346378.1| type II secretion system protein [Pseudomonas fluorescens Pf0-1]
 gi|77380876|gb|ABA72389.1| putative Flp pilus assembly protein TadB [Pseudomonas fluorescens
           Pf0-1]
          Length = 293

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 98/182 (53%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              ++R  + ++  P  LD  VRS+++G  ++DAV   +  S DP++    RV     LG
Sbjct: 110 WRYQRRLRRMIEQLPQLLDHTVRSLKSGRTLADAVLGAIDASEDPLKHAMGRVQRNVQLG 169

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           +SL E++  +       E+  F+  + V  + GGN SE L NL R++R+R     +++A+
Sbjct: 170 VSLPEAVGDVAELYEKDELRLFAVGLKVNHRYGGNASELLENLIRMIRERDQASRQLRAM 229

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +AW++G LP  ++     ++P Y+  + ND  G M+L  A    +IG +++  M
Sbjct: 230 TGETRITAWVLGLLPVGLAGYFLLSNPKYLIAMWNDHSGQMMLASAFGLQVIGSLLLWRM 289

Query: 183 IN 184
           + 
Sbjct: 290 LR 291


>gi|167620120|ref|ZP_02388751.1| pilus assembly protein, putative [Burkholderia thailandensis Bt4]
          Length = 217

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 61/185 (32%), Positives = 115/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + LI +   +FL  FP+ALD+I+R+VRAG+PV+ A+     +S +PVR+ FR + +   +
Sbjct: 30  RMLIARFKQRFLSVFPDALDLIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRV 89

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  + + + +    + L + SFF   +++Q + GGNL+E L NLS I+R R++++ K +A
Sbjct: 90  GADMKDVLEQQAARLQLADFSFFGVCLTLQRETGGNLTETLENLSGIIRARRDIRMKTRA 149

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + ++ II ++PF ++  ++  +  Y+ +L +   GH +L +A   + IG+ ++R 
Sbjct: 150 LTAEGRIASKIIAAVPFAIAAFLFVVNRPYIELLFHTRAGHKMLILAVVLLTIGLAMIRK 209

Query: 182 MINFD 186
           + N D
Sbjct: 210 IANLD 214


>gi|327539549|gb|EGF26159.1| type II secretion system protein [Rhodopirellula baltica WH47]
          Length = 314

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 3/179 (1%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P    +I R+VR+G  V+ A+ +I      P+R EF    E Q LG+    
Sbjct: 138 RNQQLSRQLPEVFQLISRAVRSGQTVTSALQMIAEDCPSPIREEFALCYEQQELGMWREL 197

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +  ++     + E+  F   + VQ++ GG+L E L NLS+++  R  ++ +++AL+ E +
Sbjct: 198 AFRKLAERNQVMELRIFVVALLVQNRSGGDLVELLDNLSKMVTKRLRLRDRIKALTAEGR 257

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
             A ++  LPF     +   SP Y   L+  PR   LL        IG +++R ++NF+
Sbjct: 258 MQALVLVVLPFVALGAIVLFSPEYAETLLERPR---LLVATGVSQGIGALLIRRIVNFE 313


>gi|261251277|ref|ZP_05943851.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260938150|gb|EEX94138.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 304

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 93/182 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L +++  KF  +FP+AL+I+  ++ +G  +  A   +  Q ++ V +EF+ + E   +G
Sbjct: 120 KLKQRQEEKFKTNFPDALNILSGAISSGQSIVHAFEYVGKQLNNEVGNEFKFMAERLLIG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  AL
Sbjct: 180 EDPDDVLERSATTFPYLEYFFFASTIRINLSRGGQLKDVINRINRLMFDSRAVEKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ASA II  LP     ++ FTSP   + ++ +P G  +         IG + + L+
Sbjct: 240 TSEARASAKIIACLPVIFLVILKFTSPENYSFVMFEPGGQPIFYYVLISEFIGFVCIWLI 299

Query: 183 IN 184
           + 
Sbjct: 300 LR 301


>gi|221066736|ref|ZP_03542841.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220711759|gb|EED67127.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 317

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 79/186 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   + KR  + L   P+ LD +VR +  G     A  + V     P+    ++   +  
Sbjct: 132 LWRRLSKRREQLLQQLPSFLDNMVRLITIGNSPHAAFQLAVVNVPAPLGDALQQASASLR 191

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               L  ++  + R   L E    + V  + ++ GG   + L  +S  +RDR++ + ++ 
Sbjct: 192 ASPDLGHAMGLLERSWRLSEFGLLAAVFRMSTRYGGRADQVLERVSAYIRDRQSAERELH 251

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWI+  LP  V  L+   + GY   +  D  G  ++  AA    +G   + 
Sbjct: 252 ALSAEVRLSAWILALLPVAVGGLIMILNQGYFMTMWQDETGRKMVLGAAGLEALGSFFLY 311

Query: 181 LMINFD 186
            +    
Sbjct: 312 RLARLK 317


>gi|218676253|ref|YP_002395072.1| putative Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
 gi|218324521|emb|CAV25998.1| putative Flp pilus assembly protein TadB [Vibrio splendidus LGP32]
          Length = 304

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 89/183 (48%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
             L +++   F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +
Sbjct: 119 SKLKQRQMNSFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNDVGKEFKLMAERLLI 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  A
Sbjct: 179 GEDPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNA 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ EA+ASA II  LP     ++ FTSP   + ++ +  G  +        L+G   + L
Sbjct: 239 LTSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLVSELLGFFCIWL 298

Query: 182 MIN 184
           ++ 
Sbjct: 299 ILR 301


>gi|86147188|ref|ZP_01065504.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio sp. MED222]
 gi|85835072|gb|EAQ53214.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio sp. MED222]
          Length = 306

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           HL K+   +F + FP+AL+++  S+ AG  +   +  +  +    V  EF+ + E  +LG
Sbjct: 122 HLQKREKKRFEETFPDALNMLASSLSAGESIGRGIGYVGKKLEGEVGKEFKLMSERLNLG 181

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             + +   +  R  P     FF   +    Q GG L E ++ L+R + + + ++ K  AL
Sbjct: 182 EPIDDVFRKSCRRFPYPSFHFFVITLRANMQRGGQLKEVMSRLNRQMFEARAVERKKFAL 241

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+G+ PF    ++ F SP     +++ P G  +L        IG++++  +
Sbjct: 242 TSEARISAKIVGATPFFFLFILQFLSPENFEFVMHHPEGRPILYYLITSESIGMLIIWAL 301

Query: 183 IN 184
           + 
Sbjct: 302 MK 303


>gi|227326305|ref|ZP_03830329.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 326

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 98/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     L
Sbjct: 141 RSTLQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+
Sbjct: 201 GIPLRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQS 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+ +L       +Y  SP   + L +DP G  +L  A   + +G+++  +
Sbjct: 261 KTSEARASAKIVAALFPGCLAYLYMKSPEDFSFLFSDPVGTTVLIYALCSVSVGMLITHV 320

Query: 182 MIN 184
           M+ 
Sbjct: 321 MVK 323


>gi|114321308|ref|YP_742991.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227702|gb|ABI57501.1| type II secretion system protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 294

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 87/184 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R        P  ++ I+RS++AG  +S AVA    +   PV    +RV     
Sbjct: 109 VYWRGQRRLRAMEAQLPGFVEHIIRSLQAGRTLSVAVAAATREMRPPVAEVMQRVQREVD 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G SLS+++        +  +   +  + +  + GG+  + +  +  +LR R+  + +++
Sbjct: 169 MGASLSDALQGAADIYRVDALQLVAIGVRINLRYGGSAIQLMEQVVTLLRQRERARRELK 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SA ++  LP  V       +P Y   ++    G  LLG A A+ ++GI ++ 
Sbjct: 229 AMTGETRISAGVLAILPVGVGGYTVMMNPDYYATMLESTVGVWLLGGAMAWQVLGIFLIW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMVK 292


>gi|251789650|ref|YP_003004371.1| type II secretion system protein [Dickeya zeae Ech1591]
 gi|247538271|gb|ACT06892.1| type II secretion system protein [Dickeya zeae Ech1591]
          Length = 325

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 96/183 (52%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K   +  +  P+A+D I RS RAG+PV++    +    S P+ +EFR +     L
Sbjct: 140 RSTLQKHLHQLRESLPDAIDAITRSCRAGVPVANTFGQVAAHLSGPLANEFRLIDHWLKL 199

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR R+ +  KVQ+
Sbjct: 200 GVPLRQVIQTSAGRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRQRRELALKVQS 259

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+ +L       +Y  SP   + L NDP G  +L  A   + +G+++  L
Sbjct: 260 KTSEARASAKIVAALFPGCLGYMYLKSPEDFDFLFNDPVGSTVLVYALCSVTLGMVITHL 319

Query: 182 MIN 184
           M+ 
Sbjct: 320 MVK 322


>gi|118581109|ref|YP_902359.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
 gi|118503819|gb|ABL00302.1| type II secretion system protein [Pelobacter propionicus DSM 2379]
          Length = 321

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 56/179 (31%), Positives = 105/179 (58%), Gaps = 1/179 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + ++ KKR + F +  P+AL +I RS+RAG  ++ AV ++  ++ +P+   FR   E Q 
Sbjct: 134 VSNVRKKRYSSFTEQLPDALTMIARSLRAGHSLTSAVELVGSETPEPLGGLFRAAYEQQK 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGL +++++  M++ M   ++ FF TVI++ ++ GGNLSE L  L+  +R+R  ++ +VQ
Sbjct: 194 LGLRITDALGGMLQRMDSLDLRFFVTVITIHAESGGNLSEILDKLAATIRERIKLRRQVQ 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLV-YFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
             + + + S +I+ +LP      + Y   PGY +V + + +GH  +  A    +IG + 
Sbjct: 254 VYTAQGRMSGYILVALPIFAFFFLQYVMLPGYEDVFMKETKGHYAIAYAIISQIIGFLF 312


>gi|261867451|ref|YP_003255373.1| TadB [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412783|gb|ACX82154.1| TadB [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 295

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G    
Sbjct: 115 RNKKTFNAMFPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPV 174

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 175 SVFEDSYDRYPYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEA 234

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+   P      + F  P   + LINDP G  +L       L G+ ++  ++ 
Sbjct: 235 RMSAIIVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLMR 292


>gi|317489755|ref|ZP_07948254.1| hypothetical protein HMPREF1023_01953 [Eggerthella sp. 1_3_56FAA]
 gi|316911101|gb|EFV32711.1| hypothetical protein HMPREF1023_01953 [Eggerthella sp. 1_3_56FAA]
          Length = 322

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  KR     +  P+AL  +    +AGL +      +  +   P+ + F R      
Sbjct: 135 LRTVQDKRRDALREGIPDALRSMAVCFQAGLSLLQTFQQVASEVQGPLGTLFARAAHQLE 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G     ++  + R   + E++F +  + VQ Q GG++ + L      ++    ++  ++
Sbjct: 195 TGEGAGRALEVLRRGSSVAELAFVAVALDVQHQAGGSMKQVLDAARDTVQSEIELRRALR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + +AK SA ++  LPF +  +    S G+++     P G  LL +A      GI+ +R
Sbjct: 255 VQTAQAKLSARVVSVLPFVLIAVFSLVSEGFLDPFFASPMGMALLAIALGMQAAGIVAVR 314

Query: 181 LMINFDV 187
            M+  +V
Sbjct: 315 RMLAVEV 321


>gi|209546005|ref|YP_002277895.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538862|gb|ACI58795.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 287

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 101 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAVAVNAVADTGQMPASREFERIAREQK 160

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 161 LGIGLVEALDRHGRTVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 220

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 221 TSSSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 280

Query: 181 LMINFDV 187
            M+   V
Sbjct: 281 SMMKVSV 287


>gi|293391328|ref|ZP_06635662.1| Flp pilus assembly protein TadB [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|32452627|gb|AAP43989.1| TadB [Aggregatibacter actinomycetemcomitans]
 gi|290951862|gb|EFE01981.1| Flp pilus assembly protein TadB [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 295

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  + + +  A+       +  +  EF+ +     +G   +
Sbjct: 115 RNKKTFNAMFPEVIQILNAAATSSVGLLQALERCGKDLTGQLGQEFKSIHRRLSIGEDPA 174

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T+I      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 175 TVFDDSYDRYPYKEFYFFITIIRNNLNKGGQIREVISRLGRVIADSNKMEKKKKAMTSEA 234

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+   P      + F  P   + L+NDP G  +L       L G+ ++  ++ 
Sbjct: 235 RMSAIIVACFPVGFFFFMQFAMPENFDFLVNDPTGRYVLYYVFGSELFGMGIIWWLMR 292


>gi|323700364|ref|ZP_08112276.1| Type II secretion system F domain [Desulfovibrio sp. ND132]
 gi|323460296|gb|EGB16161.1| Type II secretion system F domain [Desulfovibrio desulfuricans
           ND132]
          Length = 324

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 100/175 (57%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   +KR  +F    P ALD++ R+++AG      + ++  +   P+  EF + ++  +
Sbjct: 138 LQGKKRKRMDRFQKQLPEALDLMARALKAGHTFGGGMRMVADEFDGPIGPEFGKTLDEIN 197

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S +   +   ++ FF   +++Q + GGNL+E +A ++ ++R+R  +  K++
Sbjct: 198 YGMDVDRALSNLQSRVDCPDLKFFVVSVNIQRETGGNLAEIIAKIAALVRERFALFGKIR 257

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
            LS E + SA+I+ +LPF ++ ++Y  +  Y+++L     G  ++  AA  M+IG
Sbjct: 258 VLSAEGRVSAYILIALPFLLTGILYVVNSDYISLLWTRELGQNMVWGAAISMIIG 312


>gi|253687072|ref|YP_003016262.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753650|gb|ACT11726.1| type II secretion system protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 326

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 98/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     L
Sbjct: 141 RSTLQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LR+R+ ++ KVQ+
Sbjct: 201 GIPLRQVIQASATRVPMSEYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQS 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+ +L       +Y  SP   + L +DP G  +L  A   + +G+++  +
Sbjct: 261 KTSEARASAKIVAALFPGCLAYLYMKSPDDFSFLFSDPVGTSVLIYALCSVSVGMLITHV 320

Query: 182 MIN 184
           M+ 
Sbjct: 321 MVK 323


>gi|257790306|ref|YP_003180912.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325830204|ref|ZP_08163661.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
 gi|257474203|gb|ACV54523.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|325487671|gb|EGC90109.1| type II secretion system protein F domain protein [Eggerthella sp.
           HGA1]
          Length = 322

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ +  KR     +  P+AL  +    +AGL +      +  +   P+ + F R      
Sbjct: 135 LRTVQDKRRDALREGIPDALRSMAVCFQAGLSLLQTFQQVASEVQGPLGTLFARAAHQLE 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G     ++  + R   + E++F +  + VQ Q GG++ + L      ++    ++  ++
Sbjct: 195 TGEGAGRALEVLRRGSSVAELAFVAVALDVQHQAGGSMKQVLDAARDTVQSEIELRRALR 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             + +AK SA ++  LPF +  +    S G+++     P G  LL +A      GI+ +R
Sbjct: 255 VQTAQAKLSARVVSVLPFVLIAVFSLVSEGFLDPFFASPMGMALLAIALGMQAAGIVAVR 314

Query: 181 LMINFDV 187
            M+  +V
Sbjct: 315 RMLAVEV 321


>gi|42521750|ref|NP_967130.1| hypothetical protein Bd0110 [Bdellovibrio bacteriovorus HD100]
 gi|39574280|emb|CAE77784.1| TadB [Bdellovibrio bacteriovorus HD100]
 gi|51468908|emb|CAE47781.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 291

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 96/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ + ++R  KF+D   + L I+   ++AG    +++  +V    +P+  EF +V+    
Sbjct: 105 VRMIYEQRCTKFVDQMVDGLTIMANGIKAGSNPQESMKRVVEIMGNPMSQEFAQVLYQMQ 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S   +++ +   +P  +V  F T I++  + GGNL+E    +  ++R+R+ ++ K+Q
Sbjct: 165 VGDSFESALNDLGNRIPRPDVQMFVTSINILKETGGNLAETFQTIVLVVRERQKVEKKIQ 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ +      I+  +PF +  +     P ++  + N   G +LL       +IG ++++
Sbjct: 225 ALTAQGMMQGIIVTLIPFILMAVFLVIDPAFIKPMFNTTLGLVLLAAMLGLQIIGGVLIK 284

Query: 181 LMINFDV 187
            ++   V
Sbjct: 285 KLVTIKV 291


>gi|295395664|ref|ZP_06805856.1| possible integral membrane protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971480|gb|EFG47363.1| possible integral membrane protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 308

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 83/186 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L +++ AKF    P    I+  S  AGL +  A+ V   +  DP   EF  +     
Sbjct: 122 LDVLKERQRAKFFQQLPEFARIMANSTGAGLSIHTALGVAASELPDPASREFSALKRELE 181

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G  L  ++ RM   +  +++    + + +  + GG+L  +L N+S  L  RK  K +V+
Sbjct: 182 IGTPLDIALERMSERISGRDLDVLVSTLVIAQRSGGSLISSLRNMSDTLEFRKETKREVK 241

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L  ++  + +++ +       L+   + G +  L +   G + + +A     IG++ + 
Sbjct: 242 TLVSQSSYTGYLVVAFGVGFVLLLASFNDGLLLKLTSTIIGQIAIVIATVCYAIGLVAIN 301

Query: 181 LMINFD 186
            ++   
Sbjct: 302 RLVKVK 307


>gi|50119738|ref|YP_048905.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610264|emb|CAG73707.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 326

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 55/183 (30%), Positives = 97/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     L
Sbjct: 141 RSTLQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLAGPLANEFKTIDHWLKL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LRDR+ ++ KVQ+
Sbjct: 201 GIPLRQVIQASATRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRDRRELQLKVQS 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+  L       +Y  SP   + L +DP G  +L  A   + +G+++  +
Sbjct: 261 KTSEARASAKIVAMLFPGCLAYLYMKSPDDFSFLFSDPVGTTVLIYALCSVSVGMLITHV 320

Query: 182 MIN 184
           M+ 
Sbjct: 321 MVK 323


>gi|76663417|emb|CAE47793.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 291

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 97/187 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ + +KR A+F+D   + L I+   ++AG    +++  +V    +P+  EF +V+    
Sbjct: 105 VRMIYEKRCARFVDQMVDGLTIMANGIKAGSNPQESMKRVVEIMGNPMSQEFAQVLYQMQ 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S   +++ +   +P  +V  F T I++  + GGNL+E    +  ++R+R+ ++ K+Q
Sbjct: 165 VGDSFESALNDLGNRIPRPDVQMFVTSINILKETGGNLAETFQTIVLVVRERQKVEKKIQ 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ +      I+  +PF +  +     P ++  + +   G +LL       +IG ++++
Sbjct: 225 ALTAQGLMQGIIVTLIPFILMVVFSIIDPTFIKPMFSTTLGLVLLVAMLGLQIIGGVLIK 284

Query: 181 LMINFDV 187
            ++   V
Sbjct: 285 KLVTIKV 291


>gi|149200851|ref|ZP_01877826.1| type II secretion system protein [Roseovarius sp. TM1035]
 gi|149145184|gb|EDM33210.1| type II secretion system protein [Roseovarius sp. TM1035]
          Length = 322

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 101/187 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR A   +  P+A++++VRS+R G P S A+ ++  +  DP+ +EF  + +   
Sbjct: 136 ISMKASKRMALLEEQLPDAIELMVRSLRVGHPFSSAIGIVATEVGDPLATEFGIIADEAA 195

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + E++  M   + +Q++ F +  +++Q Q GGNL+E LA L++++R R  +  +V+
Sbjct: 196 YGRDMGEALKEMAERLDMQDLRFLAVAVTIQQQSGGNLAEILAGLAQVIRARFRLFRRVK 255

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ EAK S   + + P      +    P Y +  +  P     + V   F+++ ++VMR
Sbjct: 256 AITAEAKWSGKFLSAFPLLALVGIQLLKPDYYDEAMEHPFFIPAVLVVGVFLVLNLIVMR 315

Query: 181 LMINFDV 187
            +++  V
Sbjct: 316 ALVSIKV 322


>gi|307548791|dbj|BAJ19113.1| TadB [Aggregatibacter actinomycetemcomitans]
 gi|307548806|dbj|BAJ19127.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G    
Sbjct: 115 RNKKTFNAMFPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPV 174

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 175 SVFEDSYDRYPYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEA 234

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+   P      + F  P   + LINDP G  +L       L G+ ++  ++ 
Sbjct: 235 RMSAIIVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLMR 292


>gi|307133500|dbj|BAJ19012.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G    
Sbjct: 115 RNKKTFNAMFPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPV 174

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 175 SVFEDSYDRYPYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEA 234

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+   P      + F  P   + LINDP G  +L       L G+ ++  ++ 
Sbjct: 235 RMSAIIVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLMR 292


>gi|125973853|ref|YP_001037763.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|256004307|ref|ZP_05429289.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum DSM 2360]
 gi|281418015|ref|ZP_06249035.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|125714078|gb|ABN52570.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991741|gb|EEU01841.1| Flp pilus assembly protein TadB-like protein [Clostridium
           thermocellum DSM 2360]
 gi|281409417|gb|EFB39675.1| Type II secretion system F domain protein [Clostridium thermocellum
           JW20]
 gi|316939949|gb|ADU73983.1| Type II secretion system F domain [Clostridium thermocellum DSM
           1313]
          Length = 268

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 84/193 (43%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFRR 54
           K +I+KR ++    F + L  I  S+ AG  V  A    +             +  E   
Sbjct: 76  KDIIEKRKSELNLQFKDLLYSISASLTAGKSVETAFKEALNDLCILYPDPDTYIIREVEY 135

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    +  ++ +++  + +   L+++  F+ V     + GGNL   + N + I+ D+  
Sbjct: 136 IVRRLEMNETIEDALEDLAKRSHLEDIQNFTDVFKTCKRTGGNLVNVIRNSTNIINDKIE 195

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  L    K    ++  +PF +  ++  T+  YM  + +   G +++  A   + I
Sbjct: 196 IKEEINTLLAAKKFEQKVLSVMPFIMILILSLTTEDYMAPVFDTIVGRIVMTFAIIIIAI 255

Query: 175 GIMVMRLMINFDV 187
           G  V + +++  +
Sbjct: 256 GYFVSKKIMDIKI 268


>gi|10334986|gb|AAD38173.2|AF152598_2 TadB [Aggregatibacter actinomycetemcomitans]
 gi|26000716|gb|AAN75212.1| TadB [Aggregatibacter actinomycetemcomitans]
          Length = 295

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G    
Sbjct: 115 RNKKTFNAMFPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRIAIGEDPV 174

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 175 SVFEDSYDRYPYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNKMEKKKKAMTSEA 234

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+   P      + F  P   + LINDP G  +L       L G+ ++  ++ 
Sbjct: 235 RMSAIIVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSELFGMGIIWWLMR 292


>gi|148261009|ref|YP_001235136.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|326404409|ref|YP_004284491.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|146402690|gb|ABQ31217.1| type II secretion system protein [Acidiphilium cryptum JF-5]
 gi|325051271|dbj|BAJ81609.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 319

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 62/178 (34%), Positives = 98/178 (55%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R    L+ FP+AL  IVR VR G+PV +A+ V+      P   EF R+ +   +G  L 
Sbjct: 138 RRATALLNQFPDALATIVRCVRVGIPVQEALRVVSQDMPAPTSREFGRIADQVAIGTPLE 197

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++ +M     L E  FF+T IS+Q++ GG L++ L  L+ ++R R  MKA+  AL+ EA
Sbjct: 198 LALRQMADRAHLAEYGFFATAISLQARYGGGLAQTLEGLAEVIRKRVAMKARGYALASEA 257

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+G +P   +  +    P Y+ VL     G+++L  A   +  G +VMR +I 
Sbjct: 258 RTSALILGIIPLVAALAIEVIQPAYLRVLFVTHGGNIVLAAAVGLLAGGALVMREIIR 315


>gi|170696832|ref|ZP_02887932.1| type II secretion system protein [Burkholderia graminis C4D1M]
 gi|170138260|gb|EDT06488.1| type II secretion system protein [Burkholderia graminis C4D1M]
          Length = 356

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M     +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V     
Sbjct: 170 MSMRASRRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLQTTEAPLRECLDHVSRMLR 229

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S +      +E+     V+ +  + GG     L  +S  +RD +  + ++ 
Sbjct: 230 SGVEIDRALSHVAVLYGARELELVGAVLRLSVKYGGRADVMLDRMSSFMRDLEQAERELV 289

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++ 
Sbjct: 290 AMSSETRLSSWVLGMLPVGIGGFLILTNPRYFGSMWFDPGGRQILYLAFALQLTGAYLLY 349

Query: 181 LMINFD 186
            +    
Sbjct: 350 RLARLK 355


>gi|302536566|ref|ZP_07288908.1| integral membrane protein [Streptomyces sp. C]
 gi|302445461|gb|EFL17277.1| integral membrane protein [Streptomyces sp. C]
          Length = 312

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +RT +F++  P    I+  + +AGL +  A+ +   +   P   E  RV +   
Sbjct: 126 LNWQRARRTERFINQLPELARILANATQAGLALRTAIGIAAEELEAPAGEELSRVADRLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ E++  +V  +P +E+    + + + ++ GG +  +L NL+  L  RK  + +++
Sbjct: 186 VGHSIEEALGEIVERLPSRELVVLVSTLVLSARAGGAIVGSLRNLTVTLEQRKETRREIR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+++ ++      LV    PG ++ +     G   + +A     +G +++R
Sbjct: 246 TQLSQVTVTAYLVPAIGLGSLLLVDLMMPGALDRMTGAWIGQTAVLIALGLFTLGFVLIR 305

Query: 181 LMINFDV 187
            +   DV
Sbjct: 306 RLSKIDV 312


>gi|52425831|ref|YP_088968.1| MaoC protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307883|gb|AAU38383.1| MaoC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 293

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/179 (24%), Positives = 79/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++   +F + FP  + I+  +  +G  +  A+       S  +  EF  + +   +G   
Sbjct: 112 RRNRKEFEEMFPEVIQILNSATSSGAGLLQALERCGKDISGQIGEEFTAIHKRLAIGEDA 171

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +          P +E  FF T+I V    GG + E +  L R++ D K M+ K  A++ E
Sbjct: 172 NSVFEDSYSRYPYKEYYFFITIIRVNLDKGGQMREVILRLGRVIADSKKMEKKKSAMTSE 231

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+ S P      + F  P     L+NDP G M+L        +G+ ++  ++ 
Sbjct: 232 ARMSAMIVASFPVAFFIFMKFMMPENFEFLLNDPGGRMILYYVLGSESLGMGIIWWLMR 290


>gi|153811266|ref|ZP_01963934.1| hypothetical protein RUMOBE_01658 [Ruminococcus obeum ATCC 29174]
 gi|149832764|gb|EDM87848.1| hypothetical protein RUMOBE_01658 [Ruminococcus obeum ATCC 29174]
          Length = 247

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 88/192 (45%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE---- 57
           K LI++R  K    F +AL+ +  +V+AG  V +AVA            E   V E    
Sbjct: 56  KGLIRERKRKLNYQFKDALNALSVAVQAGYSVENAVAACSRDLERLYPKETDIVKEFHYI 115

Query: 58  --TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                + + + E +  +     +++V  F+ V     + GG+++  +   +R+L D+ ++
Sbjct: 116 ETQLRVSVPVEELLLSLGDRSGIEDVENFAAVFYTAKRTGGDMNRIIQTSARMLGDKIDV 175

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + +++      KA   I+  +P  +   +  TSPG+++VL  +  G   + +     ++ 
Sbjct: 176 RKEIETTLAAKKAEQMIMSLMPAGIILYLKLTSPGFLSVLYGNLFGMCAMTLCLGIYVLS 235

Query: 176 IMVMRLMINFDV 187
             + R +++ +V
Sbjct: 236 YWLGRRIVDIEV 247


>gi|307261000|ref|ZP_07542682.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306869302|gb|EFN01097.1| Tight adherence protein B [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 199

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 80/179 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F + FP  + ++  +  +G+ +  A+       + P+  EF  + +    G  +
Sbjct: 18  RRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTIIYKRLARGEDV 77

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF ++I      GG + E ++ L R + D   M+ K +A++ E
Sbjct: 78  MAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNKMEQKKKAMTSE 137

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+   P      +  T+P   + ++NDP G ++L       L+G+ ++  ++ 
Sbjct: 138 ARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSELLGMFIIWWLMR 196


>gi|86144314|ref|ZP_01062646.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
 gi|85837213|gb|EAQ55325.1| Flp pilus assembly protein TadB [Vibrio sp. MED222]
          Length = 304

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 91/183 (49%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            +L  ++  +F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +
Sbjct: 119 NNLKARQVERFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNEVGKEFKFMAERLLI 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G    + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  A
Sbjct: 179 GEDPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNA 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ EA+ASA II  LP     ++ FTSP   + ++ +  G  +     A  L+G   + L
Sbjct: 239 LTSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLASELVGFFCIWL 298

Query: 182 MIN 184
           ++ 
Sbjct: 299 ILR 301


>gi|319783870|ref|YP_004143346.1| type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169758|gb|ADV13296.1| Type II secretion system F domain [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 321

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 99/172 (57%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P AL++I R ++AG PV  A+A++  +  DP+ SEF  + +    G  L  +++ +  
Sbjct: 149 QLPEALELITRGLKAGHPVPVAIAMVAREMPDPIGSEFGVIADEVTYGSDLVSALNSLFD 208

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +  +++  F T +S+Q+  GGNL E L  L+  +R+R  ++ KV+A++ E + SA+I+ 
Sbjct: 209 RVGQEDLPLFVTAVSIQTSSGGNLREILDGLATTIRERGKLRRKVRAIATEGRMSAYILT 268

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           ++P  +   +    PG+ + +  +P+   LLG +  ++++G ++M  M NF 
Sbjct: 269 AVPALLFAAIMALMPGFYSDVWGEPKTWYLLGASITWLMLGNLMMFKMSNFK 320


>gi|167463710|ref|ZP_02328799.1| Flp pilus assembly protein TadB-like protein [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322384398|ref|ZP_08058084.1| hypothetical protein PL1_0930 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321150756|gb|EFX44216.1| hypothetical protein PL1_0930 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 304

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 81/191 (42%), Gaps = 8/191 (4%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-------DPVRSEFRRVI 56
           L+++R  +    F  AL  +  S+ AG  V +A    +             +  EF  ++
Sbjct: 115 LMRRRKEEMNQQFKQALQCLSTSLSAGKSVENAFRDTLQDLELLYPDPSAMIVQEFGVMV 174

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                G  +   I        L++++ F+ V     + GGNL E +   S ++ ++  + 
Sbjct: 175 RRLDNGEPIEACILGFAERAGLEDITNFADVFITCKRTGGNLIEVIRRTSHLISEKLQIV 234

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            ++  +  + K  + I+ + P  +  ++ F+SP YM  L     G +++ +    + + +
Sbjct: 235 QEISVMVAQKKFESKIMLTAPVAIIGILCFSSPDYMKPLYE-GAGRLIMTIGLTVLFLCL 293

Query: 177 MVMRLMINFDV 187
            + + +++  V
Sbjct: 294 WITKKIMDIKV 304


>gi|288956973|ref|YP_003447314.1| type II secretion system [Azospirillum sp. B510]
 gi|288909281|dbj|BAI70770.1| type II secretion system [Azospirillum sp. B510]
          Length = 319

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 76/184 (41%), Positives = 115/184 (62%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +RT +FLD  P+A+D++VR+ RAG+PVS+A+     ++ +PVRSEFRRV +   
Sbjct: 133 LGMLTHRRTIRFLDRLPDAIDLVVRASRAGVPVSEAIIAAGRETEEPVRSEFRRVADQVS 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L +++ +    + L +  FF   + VQ + GG L+E L NLS ILR RK+M+ KV+
Sbjct: 193 IGVDLKDALRQSSARVRLPDFDFFVVALVVQRETGGQLAETLGNLSDILRKRKDMRLKVK 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E + SA I+ SLPF    L++   P Y+  L  DP GH LL  AAA + +G+ V+ 
Sbjct: 253 ALTAEGRMSANIVASLPFVSGGLIFAVDPTYVLNLFTDPLGHKLLAAAAACLGLGMFVIG 312

Query: 181 LMIN 184
            M  
Sbjct: 313 RMTR 316


>gi|325109818|ref|YP_004270886.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324970086|gb|ADY60864.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 319

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 94/184 (51%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               +R     D  P   D++ R++ +G  +S A  ++  Q   P+  EF+   + Q+LG
Sbjct: 138 QRRNQRINTLRDQLPETFDLMSRAIESGQTISGAFQLVSTQCGGPIAKEFQHCCQQQNLG 197

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           L    ++  + R   + E+  F+  + VQ Q GG+ S+ L NL+  +R+R  +  KV+A+
Sbjct: 198 LPYEITLRDLARRTGVMELQMFAVALIVQRQAGGDPSDVLKNLAEAVRNRIKLAMKVKAI 257

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +A AW++ +LPF     +Y     Y +VL+  P    ++ + A  + +GI  +R +
Sbjct: 258 TSEGRAQAWVLSALPFVSFGGIYLLDRDYASVLLERPN---VMAIMAVSIALGIAWIRQI 314

Query: 183 INFD 186
           +  +
Sbjct: 315 VCIE 318


>gi|161524902|ref|YP_001579914.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189350348|ref|YP_001945976.1| Flp pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342331|gb|ABX15417.1| type II secretion system protein [Burkholderia multivorans ATCC
           17616]
 gi|189334370|dbj|BAG43440.1| Flp pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 330

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 145 LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQSALQTTEEPLRGCLDHVSRMLR 204

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 205 TGVEIDRAMLHIAKIYRTKEFELLGSVLRLSVKYGGRADVMLERMAIFMRDLEQAERELT 264

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y+  + NDP G MLL  A    L G + + 
Sbjct: 265 AMSAETRLSAFVLMMLPIAIGSFVVMTNPKYLQGMWNDPSGRMLLTFAFLAQLAGSVWLY 324

Query: 181 LMINFD 186
            M    
Sbjct: 325 RMARLR 330


>gi|326797331|ref|YP_004315151.1| type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
 gi|326548095|gb|ADZ93315.1| Type II secretion system F domain protein [Marinomonas mediterranea
           MMB-1]
          Length = 327

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 100/187 (53%), Gaps = 4/187 (2%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           ++ + K   +F  + P A+D IVR V+AG+P ++A  +I      P+  E   + +   L
Sbjct: 141 RNAMGKHLKEFKQNLPQAIDSIVRVVKAGVPATNAFGLIANNLPGPLAKELALIDKWLSL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           GLSL +++      +PL E  FF+ ++ +  + GG LS+ L  LS  LR+R+ +  K++A
Sbjct: 201 GLSLRQAMQDSAIRVPLNEYRFFAVILVINQEAGGRLSDTLERLSETLRERQELALKIRA 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI----M 177
            + E +ASA I+  L       +YF SP     L++DP G+ +L  A   +L G+     
Sbjct: 261 KTSEVRASAVIVAMLAPLSLAYMYFNSPKDFQFLLSDPTGNSVLIYAFGSVLTGLAITHF 320

Query: 178 VMRLMIN 184
           +++ +I 
Sbjct: 321 MIKRVIR 327


>gi|241667101|ref|YP_002985185.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862558|gb|ACS60223.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 287

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 88/187 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ +++R  +     P A+D IV +VR G P++ AV  +      P   EF R+   Q 
Sbjct: 101 IRYFLQRRWLQIESQLPYAVDQIVSAVRTGKPLAIAVNAVADTGQMPASREFERIAREQK 160

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++ R  R +P          + + ++ GG++SE L  +S+  ++   +  K+ 
Sbjct: 161 LGIGLVEALDRHGRNVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKIT 220

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
             S +A+ +  ++      +  +++F  P  ++ +  +  G ++  V A     G   MR
Sbjct: 221 TSSSQARMNFRVVNGGALFMMLMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMR 280

Query: 181 LMINFDV 187
            M+   V
Sbjct: 281 SMMKVSV 287


>gi|264680615|ref|YP_003280525.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262211131|gb|ACY35229.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 321

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 87/186 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +K  A+     P  LD  VR V  G  V  A  +    + DP++S   +      
Sbjct: 132 LYTRAQKYRARLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLAR 191

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + 
Sbjct: 192 AGMDLENAVAHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLS 251

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SAW++  LP  V  L+   +  Y   + +D  G  ++GVAAA  + G++++ 
Sbjct: 252 AMTAETRLSAWVLSLLPVAVCCLIISFNASYFLNMWDDASGRNIIGVAAALQVFGVVLLY 311

Query: 181 LMINFD 186
            +   D
Sbjct: 312 RLAKLD 317


>gi|295107880|emb|CBL21833.1| hypothetical protein [Ruminococcus obeum A2-162]
          Length = 247

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 85/192 (44%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIE---- 57
           K LI++R       F +AL+ +  +V+AG  V +AV             E   V E    
Sbjct: 56  KGLIRERKKNLNYQFKDALNALSVAVQAGYSVENAVMACSRDLERLYPQETDIVREFHYM 115

Query: 58  --TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                + + + E +        ++++  F+ V     + GG+++  +   SR+L D+ ++
Sbjct: 116 ETQLKVSVPVEELLMSFGDRSGIEDIENFAAVFYTAKRTGGDMNRIIQTSSRMLGDKIDV 175

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + +++      KA   I+  +P  +   +  TSPG++ VL  +P G + + +      + 
Sbjct: 176 RREIETTLAAKKAEQMIMSLMPAGIILYLKMTSPGFLEVLYGNPFGILAMSLCLGIYGLS 235

Query: 176 IMVMRLMINFDV 187
             + R +++ +V
Sbjct: 236 YWLGRRIVDIEV 247


>gi|148657457|ref|YP_001277662.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148569567|gb|ABQ91712.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 335

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 101/177 (57%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +F D  P  LD+I  S+R G  +  ++A +     +P R+E RRV +   LGLS+++++ 
Sbjct: 159 EFNDQLPETLDLITASMRGGFSLVQSLASVASDVQEPTRTELRRVFQEVQLGLSVTQALD 218

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +V+ M   ++    T I + +++GGNL + L N+S  +R+R  ++ +V+ ++   + S+
Sbjct: 219 NLVQRMESADLDLVVTAIKIHARVGGNLGQILENISTTMRERAKLRREVRVITSMQRISS 278

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           ++IG+LPF ++ +++  +P YM  L        +   A    ++G +++R +++  +
Sbjct: 279 YVIGALPFALALIIFTINPTYMMRLFQPGLILCIPIGAFISSVVGFLIIRKIVDVRI 335


>gi|319779647|ref|YP_004130560.1| Flp pilus assembly protein TadB [Taylorella equigenitalis MCE9]
 gi|317109671|gb|ADU92417.1| Flp pilus assembly protein TadB [Taylorella equigenitalis MCE9]
          Length = 281

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 93/186 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K LIKKR  K +  FP+ L  +  ++++G  +  ++ +I   S  P+  EF   +    L
Sbjct: 95  KWLIKKRQKKLIQQFPDFLLSLSNALKSGAGLQHSIKLINETSEKPISQEFALFLHQIRL 154

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S+ ES++ +++  P   +S F T++ V  + GGNL+  L  LS  +R+   +  K+ A
Sbjct: 155 GSSVEESLTVLLQRNPSMNMSQFVTLVKVSYKTGGNLANMLEVLSTNMRENNLLIKKIDA 214

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ +++  +WI+  LP  +  ++   +P   N       G+  L +     + G + M+ 
Sbjct: 215 LTSQSRMQSWIMTLLPIFLLMVLSVVAPNLTNYFWEHKYGYFALALIVIMEIGGFLTMKK 274

Query: 182 MINFDV 187
           ++   V
Sbjct: 275 LMKIRV 280


>gi|261820218|ref|YP_003258324.1| type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
 gi|261604231|gb|ACX86717.1| Type II secretion system F domain protein [Pectobacterium wasabiae
           WPP163]
          Length = 326

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 98/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +  ++K      +  P A+D I RS RAG+PV++  +++    + P+ +EF+ +     L
Sbjct: 141 RSTLQKHLKALRESLPEAIDAITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRL 200

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + I      +P+ E  FF  ++ +  + GG L E L  LS  LRDR+ ++ KVQ+
Sbjct: 201 GIPLRQVIQASATRVPMAEYRFFVVILIINQEAGGRLGETLERLSATLRDRRELQLKVQS 260

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + EA+ASA I+ +L       +Y  SP   + L +DP G  +L  A   + +G++V  +
Sbjct: 261 KTSEARASAKIVAALFPGCLAYLYMKSPEDFSFLFSDPVGTSVLIYALCSVSVGMLVTHV 320

Query: 182 MIN 184
           M+ 
Sbjct: 321 MVK 323


>gi|103488239|ref|YP_617800.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
 gi|98978316|gb|ABF54467.1| type II secretion system protein [Sphingopyxis alaskensis RB2256]
          Length = 333

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 64/187 (34%), Positives = 103/187 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  +R  +    FP ALDI VR +R+G P+  A+ ++  +  DP+ +EF  V +   
Sbjct: 147 ITRLADRRRRRMEQQFPIALDIFVRGLRSGHPIPAALQLLTVEMEDPIGTEFGIVTDEIA 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            GL L E+++RM     L ++  F   +SVQ + GGNL+E L NLS+++RDR +M  KV+
Sbjct: 207 FGLDLREALARMAERWGLPDMHMFVVSVSVQMETGGNLAEILENLSKVIRDRASMFMKVR 266

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + +A I+ +LP      ++ T+P +   +  DP   +  G      L+G   +R
Sbjct: 267 ALSSEGRMTAVILTALPILAFVGLFLTNPVFYLDVATDPIFFIGFGGLILLYLVGFFTIR 326

Query: 181 LMINFDV 187
            MI+  V
Sbjct: 327 RMIDLKV 333


>gi|186473166|ref|YP_001860508.1| type II secretion system protein [Burkholderia phymatum STM815]
 gi|184195498|gb|ACC73462.1| type II secretion system protein [Burkholderia phymatum STM815]
          Length = 275

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 90/187 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +  +R        P+ L +I   +RAG     A+   V +S  P+  EF  ++    
Sbjct: 89  LSWMRTRRIETLERQLPDMLLMIAGGLRAGASFPIALESAVQESVPPISQEFDLLLREIR 148

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + + +P+ +    +  + +  ++GGNL++AL +++  LRD+  M+ K++
Sbjct: 149 LGIDLDVAMRNIEQRIPVPDFMMVTAAVMISREVGGNLAQALESVASTLRDKLQMEGKIR 208

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++    P  M  L   P G   L V AA  L+G   + 
Sbjct: 209 ALTSQGRMQGIVMTCLPLFLMMVLRAMEPVAMAPLFTSPIGWATLAVVAAMELLGYASIA 268

Query: 181 LMINFDV 187
            ++  +V
Sbjct: 269 RIVRINV 275


>gi|148974881|ref|ZP_01811861.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
 gi|145965390|gb|EDK30639.1| Flp pilus assembly protein TadB [Vibrionales bacterium SWAT-3]
          Length = 304

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 91/183 (49%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
             L +++  +F  +FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+ + E   +
Sbjct: 119 NKLKQRQMDRFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDNEVGKEFKFMAERLLI 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G +  + + R     P  E  FF++ I +    GG L + +  ++R++ D + ++ K  A
Sbjct: 179 GEAPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKINRLMFDSRAVEKKKNA 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ EA+ASA II  LP     ++ FTSP   + ++ +  G  +        L+G   + L
Sbjct: 239 LTSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPIFYYVLVSELLGFFCIWL 298

Query: 182 MIN 184
           ++ 
Sbjct: 299 ILR 301


>gi|332970973|gb|EGK09947.1| integral membrane protein [Desmospora sp. 8437]
          Length = 315

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 90/187 (48%), Gaps = 1/187 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++        +          ++  +  AGL +   + ++V +   PV+ E  RV+    
Sbjct: 130 LRSRQHIYAQRMDSQLSEVCRLLSSAASAGLSIPQGLRLVVQEMPAPVKIELGRVVREIE 189

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  L  +++ ++  +  Q++  F   + +Q + GG+L++ ++ ++  + +RK +   ++
Sbjct: 190 LGRDLEGALNDLLERIHTQDMKVFINALIIQRRAGGDLAKVMSQMAATMEERKIIHQTIK 249

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ +A+ SA+ +  +   ++ ++     G+ + L     G ++L +     ++G++++R
Sbjct: 250 AVTSQARTSAYALPIISLLIAFMLSKMIDGFYD-LFTTLPGMIVLALFVGLQVLGVVLVR 308

Query: 181 LMINFDV 187
              N  V
Sbjct: 309 KFSNIRV 315


>gi|115358175|ref|YP_775313.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115283463|gb|ABI88979.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 325

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|84385700|ref|ZP_00988731.1| putative TadB [Vibrio splendidus 12B01]
 gi|84379680|gb|EAP96532.1| putative TadB [Vibrio splendidus 12B01]
          Length = 304

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 89/177 (50%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  KF D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    +
Sbjct: 125 REKKFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGKEFKKMSERLLIGEDPDD 184

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++R     P  E  FF++ I +    GG L   +  ++RI+ + + ++ K  AL+ EA+
Sbjct: 185 VLARSASTFPYVEYFFFASTIRINLSRGGQLKNVINRINRIMFEARAIEKKKNALTSEAR 244

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           +SA II +LP     ++  TSP     ++ +  G  +        LIG  ++ +++ 
Sbjct: 245 SSAKIIAALPVIFMCILKLTSPENYQFVMFEEGGKPIFYYVLISELIGFFLISMILR 301


>gi|170720031|ref|YP_001747719.1| type II secretion system protein [Pseudomonas putida W619]
 gi|169758034|gb|ACA71350.1| type II secretion system protein [Pseudomonas putida W619]
          Length = 293

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 102/184 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + ++  P  LD  VRS++AG  ++DAV   +  S +P+RS   RV     
Sbjct: 108 LSWLCRRRVHQLVEQLPALLDYSVRSLKAGRTLNDAVLGGIDGSREPLRSTMTRVRRNVQ 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L ++++ +       E+  F+  + +  + GGN SE + NL +++R+R+    +++
Sbjct: 168 LGVPLDDAVNELAELYNQDELRLFAMGLRINQRYGGNTSELMENLIKLIREREQGSRQLK 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A I+G+LP C+       +P Y+  +  D  G M+L +A A  ++G +V+ 
Sbjct: 228 AMTGETRITAMILGALPLCMVGYFLMANPHYLLTMWQDSSGQMMLLLAFALQVVGCLVLW 287

Query: 181 LMIN 184
            M+ 
Sbjct: 288 RMMR 291


>gi|254381955|ref|ZP_04997318.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194340863|gb|EDX21829.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 312

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 85/187 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  +F++  P    I+  + +AGL +  A+ +   +   P   E  RV +   
Sbjct: 126 LNWQRSRRNERFINQLPELARILANATQAGLALRTAIGMAADELEAPAGEELARVADRLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S+ ES+  +   +P +E+    + + + ++ GG +  +L NL+  L  RK  + +++
Sbjct: 186 IGHSIEESLGEITERLPSRELVVLVSTLVLSARAGGAIVGSLRNLTVTLEQRKETRREIR 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               +   +A+++  +      LV    PG ++ +     G   + VA     +G +++R
Sbjct: 246 TQLSQVTVTAYLVPVMGLGSLLLVDAMMPGALDRMTGAVIGQTAVLVAIGLFTLGFVLIR 305

Query: 181 LMINFDV 187
            +   DV
Sbjct: 306 RLSKIDV 312


>gi|325108940|ref|YP_004270008.1| type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324969208|gb|ADY59986.1| Type II secretion system F domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 323

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 95/161 (59%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P+AL+++ R++R+G  ++  + V+V +  DP+  EF    E Q+LG+ + +++  +  
Sbjct: 151 QLPDALELVARALRSGHSLASGLQVVVQEMPDPISREFGMAYEEQNLGVPIDQALKNVFH 210

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            +P  +  FF+T +++Q Q GG+L+E L  +  I+R+R  +  +VQAL+ E + S  ++ 
Sbjct: 211 RVPNLDFKFFATAVAIQRQSGGDLAEILDKIGHIIRERFRIMGQVQALTGEGRISGIVLM 270

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           +LP  +  ++Y+ +P YM +L  +  G  ++  A    ++G
Sbjct: 271 ALPIVLFFVMYYLNPEYMMLLFTEEMGRKMIAGAVVMQILG 311


>gi|319941898|ref|ZP_08016219.1| hypothetical protein HMPREF9464_01438 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804551|gb|EFW01421.1| hypothetical protein HMPREF9464_01438 [Sutterella wadsworthensis
           3_1_45B]
          Length = 292

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 95/174 (54%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
            FL  FP A+D   RS++AG+PV  A+ ++     D       ++     +GL   E++ 
Sbjct: 115 AFLSRFPEAVDNFTRSIQAGIPVDRALKILGEAYDDEFGRRVLKLCREMKVGLPFREALG 174

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
                +   +V FF  V+++  + G  LS  LA+LS +LR+R+ +  K++AL+ E++ASA
Sbjct: 175 NFADELDDPDVDFFCEVLALNRETGSALSPMLASLSMMLRERRAIDRKLKALTSESRASA 234

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            ++  LP  +  L  F +P  +  L+NDP G ++ G A A ML G ++++ M  
Sbjct: 235 RVLCLLPVFILGLQAFLNPSQLLFLVNDPAGRIVAGCALACMLAGFIIIQRMSR 288


>gi|104779903|ref|YP_606401.1| type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
 gi|95108890|emb|CAK13586.1| Putative type II/IV secretion system membrane protein [Pseudomonas
           entomophila L48]
          Length = 292

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/184 (28%), Positives = 100/184 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +++  + ++  P  LD  VRS++AG  +SDAV   V  + +P+RS   RV     
Sbjct: 107 LSWRCRRQLRQIIEQLPGLLDYSVRSLKAGRTLSDAVLGGVEATREPLRSAMLRVRRNVQ 166

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L +++S +       E+  F+  + +  + GGN SE + NL +++R+ +    +++
Sbjct: 167 LGVPLDDAVSELAELYGQDELRMFALGLRINQRHGGNASELMENLIKLIREHEQGDRQLR 226

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +AWI+G+LP  +     F +PGY+  +  D  G M+L  A A   +G +V+ 
Sbjct: 227 AMTGETRITAWILGALPLGMVGYFLFANPGYLMAMWRDSHGQMMLLFAFALQAVGCLVLW 286

Query: 181 LMIN 184
            M+ 
Sbjct: 287 RMMR 290


>gi|172062963|ref|YP_001810614.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171995480|gb|ACB66398.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 325

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|27378606|ref|NP_770135.1| hypothetical protein blr3495 [Bradyrhizobium japonicum USDA 110]
 gi|27351754|dbj|BAC48760.1| blr3495 [Bradyrhizobium japonicum USDA 110]
          Length = 338

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 97/180 (53%), Gaps = 1/180 (0%)

Query: 6   KKRTA-KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
           ++R A +     P+A+ ++  +VR+GLPV +A   +  +   P   +F  V    +LG  
Sbjct: 154 QRRVALQLFRQLPDAIQLVTSTVRSGLPVHEAFRALAREMPQPTAGQFAIVCNEVNLGRP 213

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
            +E++  + R   + E + F+  ++VQ + GG+L+E L NL   +R R  + A+ +AL+ 
Sbjct: 214 PAEAVEGVYRRTQVAEYAMFAVTLAVQLKSGGSLAETLQNLGDTVRQRVALAARAKALAG 273

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E   S+  +   P     ++Y ++P  +++L  DP G+ LL  A A +L+G +V+  M+ 
Sbjct: 274 EVIFSSRALTISPLIGGGVLYASNPQTVDLLFTDPVGNKLLAYAVASVLVGALVISWMVR 333


>gi|160897512|ref|YP_001563094.1| type II secretion system protein [Delftia acidovorans SPH-1]
 gi|160363096|gb|ABX34709.1| type II secretion system protein [Delftia acidovorans SPH-1]
          Length = 320

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 81/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  + L   P  LD +VR +  G     A  + +    DP+    ++      
Sbjct: 135 IWRRQAKRRERLLQQLPGFLDNMVRLISIGNSPHAAFQMALNNVPDPLGDALQQAAAMLS 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               L +++ ++ R   L E    + V  +  + GG     L  +S  +RDR++ + ++ 
Sbjct: 195 ASPDLGQAMGQLERNWRLPEFGLLAAVFRMSVRYGGRADLVLERVSAYIRDRQSAERELH 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAW++  LP  V  L+   + GY   + ND  G  ++ VAAA   +G  ++ 
Sbjct: 255 ALSSEIRMSAWVLALLPLVVGALIMVINRGYFMRMWNDDSGQTMVLVAAALEALGAFLLY 314

Query: 181 LMINFD 186
            +    
Sbjct: 315 RLAKLR 320


>gi|171320622|ref|ZP_02909642.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171094135|gb|EDT39222.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 325

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 116/185 (62%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L + ++     + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GADLKDVLTHASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRITTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|170704075|ref|ZP_02894707.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170131017|gb|EDS99712.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 325

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 118/185 (63%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L+++   +FL+ FP+A+D+IVR+VRAG+PV+ A++ +   +++PVRS FR + ++  +
Sbjct: 138 RALVERFRLRFLEAFPDAIDLIVRAVRAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRV 197

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ L + +++    + + + SFF+  + +Q + GG+L E L  LS I+R R++++ K +A
Sbjct: 198 GVDLKDVLTQASDRLMIADFSFFTVYLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRA 257

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ E + +  II ++PF +   ++  +  Y+ +L +   GH++L +AA  + IG++ +  
Sbjct: 258 LTAEGRVTTKIISAVPFVMIGALFLVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINK 317

Query: 182 MINFD 186
           +   D
Sbjct: 318 ISKLD 322


>gi|84685157|ref|ZP_01013056.1| Putative Flp pilus assembly protein TadB [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666889|gb|EAQ13360.1| Putative Flp pilus assembly protein TadB [Rhodobacterales bacterium
           HTCC2654]
          Length = 316

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 95/181 (52%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR        P+ALD++ R +  G P++  +  +     DP+ +EFR + +    G SL+
Sbjct: 136 KRADALTRQLPDALDLMKRGLSVGHPLNVTIRNVATTLPDPIAAEFRILADQVAYGDSLT 195

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +++  + R + +++  + S  + +Q   GGNL   L  L+R++R R  M+ +V A+S E 
Sbjct: 196 DAVDDLARRIDIEDFHYLSAAVQIQHATGGNLGAMLETLARVIRGRFAMRRRVSAVSSEG 255

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           + +A I+ ++P  +      T+P Y   + +DP    + G   A +L   +++R +++F 
Sbjct: 256 RITAIILSAMPVLMYVGTSLTAPEYYASVKDDPAFWPMCGAILALVLGNALMLRKLVSFR 315

Query: 187 V 187
           V
Sbjct: 316 V 316


>gi|299532822|ref|ZP_07046209.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298719046|gb|EFI60016.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 327

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 82/183 (44%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             +K   +     P  LD  VR V  G  V  A  +    + DP++S   +       G+
Sbjct: 141 RAQKYRTRLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLARAGM 200

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + A++
Sbjct: 201 DLENAVTHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLSAMT 260

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAW++  LP  V  L+   +  Y   + ND  G  ++  A A  + G++++  M 
Sbjct: 261 AETRLSAWVLSLLPVAVGCLIISFNASYFLNMWNDASGRNIIWAAVALQVFGVLLLYRMA 320

Query: 184 NFD 186
             D
Sbjct: 321 KLD 323


>gi|319940444|ref|ZP_08014789.1| hypothetical protein HMPREF9464_00008 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806070|gb|EFW02819.1| hypothetical protein HMPREF9464_00008 [Sutterella wadsworthensis
           3_1_45B]
          Length = 326

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/175 (30%), Positives = 83/175 (47%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            +     P A+D I R  RAG+P   A  +        +  E R +     LG+ L + +
Sbjct: 149 EELGKSLPEAIDSIARICRAGVPAQTAFGLAAQNLRGALSEELRTIDRWLRLGVPLKQVL 208

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
                 +PL E  FF+ ++ +  + GG L++ L  L+  LR+R  +  KVQA + EA+AS
Sbjct: 209 QESAHRVPLPEYRFFAVIVIISQESGGRLADTLERLAATLRERAELALKVQAKTSEARAS 268

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
             I+  L   V    Y  +P     L+ DP G  +LG AAA +  G+ V  LM+ 
Sbjct: 269 IKIVACLVPGVLIYQYIQAPQDFQFLVTDPTGLKVLGYAAASVAAGLFVTWLMVR 323


>gi|149188842|ref|ZP_01867132.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
 gi|148837262|gb|EDL54209.1| hypothetical Flp pilus assembly protein TadB [Vibrio shilonii AK1]
          Length = 301

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 97/183 (53%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L  +R  +F   FP+AL++++ +V AG  +  AV+ +     + V  EF+ + +   L
Sbjct: 115 QWLSNRRRVQFQQTFPDALNVLMSAVTAGESLMQAVSFVGQNLDNEVGREFKNMGDRLKL 174

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S  + + R  +  P  E  FF+  I      GG L   LA L R+L D + M+ K  A
Sbjct: 175 GESPDQVLQRAAKRFPYPEFIFFTIAIRANMSRGGQLRGVLARLIRVLVDARTMETKKMA 234

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ SA ++ ++P   + ++Y  +P  +N +++DP+G  +L       L+G+ ++ L
Sbjct: 235 MTSEARISAKVVAAIPVIFAVILYNVNPDNINYILHDPKGVWVLYYVVGSELVGLFIVWL 294

Query: 182 MIN 184
           ++ 
Sbjct: 295 LVK 297


>gi|28900580|ref|NP_800235.1| putative TadB protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808960|dbj|BAC62068.1| putative TadB [Vibrio parahaemolyticus RIMD 2210633]
          Length = 289

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 87/175 (49%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    + +
Sbjct: 112 QRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGEEFKKMSERLLIGEDPDDVL 171

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
           +R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+AS
Sbjct: 172 ARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEARAS 231

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A II +LP     ++  TSP   N ++ +  G  +         IG   + +++ 
Sbjct: 232 AKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFIYMILR 286


>gi|238793625|ref|ZP_04637248.1| Type II secretion system protein F domain protein [Yersinia
           intermedia ATCC 29909]
 gi|238727040|gb|EEQ18571.1| Type II secretion system protein F domain protein [Yersinia
           intermedia ATCC 29909]
          Length = 293

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 78/184 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K     F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 107 IRFPRKNNHTIFKRDFPEVLLMINMAASSGTSINQVLERCGKEVGGPLGDELSLICRRLN 166

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S         +     E  F  T+I +  Q GG L E  + LS+++   K  + K  
Sbjct: 167 VGESPETVFYDAYQRFHYPEFYFLITIILLNLQQGGQLRELTSRLSQVITKNKTSEQKKA 226

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  I+  +PF  S  +YF  P  +  + N P G ++     +  +IGI ++R
Sbjct: 227 VMTAQTRMSVNILSIIPFVFSLFLYFMDPTAIESMWNHPTGRIIYYYIISSEIIGIALIR 286

Query: 181 LMIN 184
            M+ 
Sbjct: 287 SMLR 290


>gi|225572861|ref|ZP_03781616.1| hypothetical protein RUMHYD_01052 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039787|gb|EEG50033.1| hypothetical protein RUMHYD_01052 [Blautia hydrogenotrophica DSM
           10507]
          Length = 247

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 87/192 (45%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
           +  I+++  +    F + LD +  +++AG  V +A+++   +          +  E R +
Sbjct: 56  QQKIREQQRELNYQFKDMLDSLNVTLQAGYSVENAISLCARELERLYGREADLTRELREM 115

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +   L + +      +      ++V  F+ V     + GG++ + L   +++L D+  +
Sbjct: 116 EDKLKLSVPVERLFMDLGSRSHSEDVENFAVVFQTAKRSGGDMRKILEKSAQMLGDKIEV 175

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +++A+    K+   ++  +PF +   +  TSPG++ VL  +  G  ++    A  L  
Sbjct: 176 KKEIEAVLTAKKSEQRLMSVMPFGIILYMSLTSPGFLEVLYGNLFGVAVMTGCLAVYLFA 235

Query: 176 IMVMRLMINFDV 187
             +   +++ +V
Sbjct: 236 WWLGNRIVDIEV 247


>gi|313835700|gb|EFS73414.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA2]
 gi|314928371|gb|EFS92202.1| type II secretion system F domain protein [Propionibacterium acnes
           HL044PA1]
 gi|314970223|gb|EFT14321.1| type II secretion system F domain protein [Propionibacterium acnes
           HL037PA3]
 gi|328908048|gb|EGG27807.1| LOW QUALITY PROTEIN: Type II secretion system F domain protein
           [Propionibacterium sp. P08]
          Length = 307

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 94/186 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++RTAKF++  P    ++  +  AGL +  A+A++  +  +P RSEF +V     
Sbjct: 121 VRRSQQRRTAKFVNQLPELARLLANASHAGLSLPTAIAMVSDELGEPARSEFAQVENRLR 180

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G SL  ++  +  ++  +EV+   + + V ++ GG+L  AL  ++  L +RK  + +V 
Sbjct: 181 FGASLQTALDELASHVRSREVTVLMSTLIVSARSGGSLVTALRGIADSLEERKETRREVT 240

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  ++ A+A++I  +   +   +    PG + ++ +   G + L    +   +G +V+R
Sbjct: 241 TILSQSLATAYLIIIIGLGLLVALNMFEPGTVELMTHSLVGRICLIAGLSLFAVGFVVIR 300

Query: 181 LMINFD 186
            M    
Sbjct: 301 QMTKVK 306


>gi|220918107|ref|YP_002493411.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955961|gb|ACL66345.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 321

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 59/181 (32%), Positives = 104/181 (57%), Gaps = 1/181 (0%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R+ +  +  P ALD++ RS+RAG   + A  V+  +  +PV  EF R  E+Q LGL + 
Sbjct: 140 RRSNRLSEQLPEALDMMARSLRAGHAFTSAFEVVATEMPEPVAVEFARAFESQRLGLPVE 199

Query: 67  ESISRMVRYMP-LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           ++I +M    P  +++  F+    +Q + GGNL+E L +++  +R R    +K+ AL+ E
Sbjct: 200 QAIVQMTERAPGNRDLRIFAVSALIQKETGGNLAEILGSIAETIRARYRFYSKLSALTAE 259

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +AS  I+G LP  ++ ++   +P YM  L++DP GHM++  AA   L+G+  +  +   
Sbjct: 260 GRASGAILGMLPILMALVLRIMNPAYMGRLVSDPLGHMIMLFAALSWLVGVAWLYSLTKV 319

Query: 186 D 186
           D
Sbjct: 320 D 320


>gi|172060498|ref|YP_001808150.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
 gi|171993015|gb|ACB63934.1| type II secretion system protein [Burkholderia ambifaria MC40-6]
          Length = 330

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 145 LTSRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLR 204

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    QE     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 205 TGVEIDRAMLHIAKIYRTQEFELLGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 264

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y+  +  DP G MLL +A    + G + + 
Sbjct: 265 AMSAETRLSAFVLVMLPIGIGSFVVMTNPKYLEGMWIDPGGRMLLVLAFLLQIAGSVWLY 324

Query: 181 LMINFD 186
            M    
Sbjct: 325 RMARLR 330


>gi|226325182|ref|ZP_03800700.1| hypothetical protein COPCOM_02974 [Coprococcus comes ATCC 27758]
 gi|225206530|gb|EEG88884.1| hypothetical protein COPCOM_02974 [Coprococcus comes ATCC 27758]
          Length = 301

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 83/187 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K R A+F +    +L ++  ++RAG  +  A+  +   S DP++SE         
Sbjct: 114 VRSRGKSRKARFDEQLARSLPMVAENMRAGSSIERALRSVGENSDDPLKSELLACAGAMQ 173

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +   +  ++  M +    +++      ++   ++GG+L+++L  +   +  R +++  ++
Sbjct: 174 IDGDIVAALDDMAKRTGSKDLVLLQAAVASHKEVGGSLADSLERIGDTIDARLSLRRHIE 233

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           + +    AS   +  +   +  ++    P   +    DP G  +L V   F   G +++ 
Sbjct: 234 SETSSVIASMKALIVMLLILFAIIMVGIPQAYDFYTQDPLGIPVLIVVVLFAATGSVIIY 293

Query: 181 LMINFDV 187
            M + DV
Sbjct: 294 KMADIDV 300


>gi|167562911|ref|ZP_02355827.1| hypothetical protein BoklE_10150 [Burkholderia oklahomensis EO147]
          Length = 258

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 83/186 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 73  LASRTQKRRLQIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 132

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 133 SGVEIDRAMVYIAELYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELA 192

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 193 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQVAGGYWLY 252

Query: 181 LMINFD 186
            +    
Sbjct: 253 RLARLR 258


>gi|156975615|ref|YP_001446522.1| Flp pilus assembly protein TadB [Vibrio harveyi ATCC BAA-1116]
 gi|156527209|gb|ABU72295.1| hypothetical protein VIBHAR_03348 [Vibrio harveyi ATCC BAA-1116]
          Length = 301

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/182 (28%), Positives = 94/182 (51%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L  KR   F   FP+AL+I++ +V AG  +  A + +       V  EF+ + +   LG
Sbjct: 116 WLQNKRRLDFEKKFPDALNILMSAVTAGESLMHAFSFVGENMEGEVGREFKEMGDRLKLG 175

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            +  + + R  +  P  E  FF+  I      GG L   LA L RIL D + +++K  A+
Sbjct: 176 ENAEKVLLRSCKAFPYPEYIFFTITIRANINRGGQLKNVLARLIRILVDARTLESKRMAM 235

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA ++ ++P   + +V    P +++ ++NDP+G M+L       ++G+ V+ L+
Sbjct: 236 TSEARISAKVVAAIPIAFAFMVNQIDPSHIDFILNDPQGRMVLYYVVGSEVLGLFVVWLL 295

Query: 183 IN 184
           + 
Sbjct: 296 VK 297


>gi|167570102|ref|ZP_02362976.1| hypothetical protein BoklC_09676 [Burkholderia oklahomensis C6786]
          Length = 268

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 83/186 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 83  LASRTQKRRLQIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 142

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 143 SGVEIDRAMVYIAELYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELA 202

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 203 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQVAGGYWLY 262

Query: 181 LMINFD 186
            +    
Sbjct: 263 RLARLR 268


>gi|91775992|ref|YP_545748.1| type II secretion system protein [Methylobacillus flagellatus KT]
 gi|91709979|gb|ABE49907.1| type II secretion system protein [Methylobacillus flagellatus KT]
          Length = 303

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 93/181 (51%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            +++R    +   P  +D + R++  G  V  AV  +      P+R+   RV+    LG 
Sbjct: 121 RLQRRQRIIVTQIPLFIDQVSRALSTGKSVEGAVRSVTEDMQMPLRAVLDRVVRATDLGA 180

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
             ++++ +      ++E+   +  I + S  G +  E L ++ +++R ++  + ++ A++
Sbjct: 181 GFADAMQKAAELHHIKELGLIALAIRISSNYGSSPQEMLKSIVQMIRQQEQAQRELAAMT 240

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E K +AW++   P  +   ++  +PGY+++++NDP G ++   A A  ++G+++   M+
Sbjct: 241 GETKMTAWVLSLTPLLIVGYMFIANPGYIDMMLNDPSGALIFKAALAMQVVGVLIFWRMM 300

Query: 184 N 184
            
Sbjct: 301 K 301


>gi|307730003|ref|YP_003907227.1| type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1003]
 gi|307584538|gb|ADN57936.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1003]
          Length = 404

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M     +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V     
Sbjct: 218 MSMRASRRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLRTTEAPLRECLDHVSRMLR 277

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S +      +E+     V+ +  + GG     L  +S  +RD +  + ++ 
Sbjct: 278 SGVEIDRALSHVAVLYGARELELLGAVLRLSVKYGGRADVMLDRMSSFMRDLEQAERELV 337

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++ 
Sbjct: 338 AMSSETRLSSWVLGMLPIGIGGFLILTNPRYFGSMWFDPGGRQILYLAFALQLTGAYLLY 397

Query: 181 LMINFD 186
            +    
Sbjct: 398 RLARLK 403


>gi|262164952|ref|ZP_06032690.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
 gi|262027332|gb|EEY45999.1| flp pilus assembly protein TadB [Vibrio mimicus VM223]
          Length = 303

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 91/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L   +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G
Sbjct: 119 KLRAHKTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIG 178

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               E ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL
Sbjct: 179 EDPDEVLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNAL 238

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA++SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + ++
Sbjct: 239 TSEARSSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMI 298

Query: 183 IN 184
           + 
Sbjct: 299 LR 300


>gi|269216232|ref|ZP_06160086.1| putative bacterial type II secretion system protein F domain
           protein [Slackia exigua ATCC 700122]
 gi|269130491|gb|EEZ61569.1| putative bacterial type II secretion system protein F domain
           protein [Slackia exigua ATCC 700122]
          Length = 335

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 84/186 (45%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
                    +  +  P+AL  +     AGL V  A A +  ++  P+R  F  V     L
Sbjct: 149 SRRRDAELQRMRELVPDALRCMEACFHAGLTVPQAFAEVARETKPPLRDAFSMVSHDMEL 208

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S+ E++ R  R   L E+SF +  + VQ   GG+ S  + +    +     ++  ++ 
Sbjct: 209 GRSVDEALERFRRASSLPELSFVAMALDVQHACGGDASRIVQSAQESVERGIELRRSLRV 268

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + +AK SA ++  +P  +  ++    PG+M+       G  LL  AAA  + GI ++  
Sbjct: 269 QTAQAKLSAQVVSIMPIALLVVLSGIDPGFMDPFFESGAGIALLVCAAAMEIAGIAIVSR 328

Query: 182 MINFDV 187
           +++ D+
Sbjct: 329 VLDVDI 334


>gi|296158798|ref|ZP_06841627.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
 gi|295891003|gb|EFG70792.1| Type II secretion system F domain protein [Burkholderia sp. Ch1-1]
          Length = 356

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V     
Sbjct: 170 LTLRVNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLR 229

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S++     ++E+     V+ +  + GG     L  ++  +RD ++ + ++ 
Sbjct: 230 TGVEIDRALSQVALIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELV 289

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A A  L G  ++ 
Sbjct: 290 AMSAETRLSSWVLAMLPVGIGGFLILSNPKYFASMWFDPTGRQLVYLAFALQLGGAYLLY 349

Query: 181 LMINFD 186
            + N  
Sbjct: 350 RLANLR 355


>gi|238789151|ref|ZP_04632939.1| Type II secretion system protein F domain protein [Yersinia
           frederiksenii ATCC 33641]
 gi|238722683|gb|EEQ14335.1| Type II secretion system protein F domain protein [Yersinia
           frederiksenii ATCC 33641]
          Length = 187

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 80/184 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           MK   K+  + F  DFP  L +I  +  +G  ++  +     + S P+  E   +    +
Sbjct: 1   MKLSRKRHHSLFKKDFPEVLLMINMASGSGASINHVLERCGQEVSGPLGHELVLICRRLN 60

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S         +     E  F  T+I +  Q GG L E  + LS+++   K  + K  
Sbjct: 61  LGESPETVFYDAYQRFNYPEFYFLITIILLNIQQGGQLKELTSRLSQVISKNKTTEQKKS 120

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L+ + + S  II ++P   S L+YF     +  + ++P G M+         IGI V+R
Sbjct: 121 VLTAQTRMSVNIISAMPVAFSLLLYFIDAKNIESMWDNPIGRMIFFYIITSEAIGIYVIR 180

Query: 181 LMIN 184
            M+ 
Sbjct: 181 KMLR 184


>gi|217978830|ref|YP_002362977.1| type II secretion system protein [Methylocella silvestris BL2]
 gi|217504206|gb|ACK51615.1| type II secretion system protein [Methylocella silvestris BL2]
          Length = 319

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 104/184 (56%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +K   +F+D FP+A+D + R +RAGLP++ AV  I  ++  P+ + F  + +   
Sbjct: 131 LVRRQRKTERQFMDLFPDAVDTVARMIRAGLPITAAVRTIASEAGAPISTVFAMIADELK 190

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + +++    + + L +  FF+  +++Q   GGNL   L  LS+I+R R+ ++ K +
Sbjct: 191 IGVPIEQTLDASSKQIGLADFRFFAVAVALQYSTGGNLMATLEALSQIVRKRRALRLKAK 250

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + E + +A+ +G +P   S  ++   PGY+  L  DPRG ++L  A   + +  + MR
Sbjct: 251 AATGEIRITAYALGGIPVLTSGALFVLQPGYLAPLWTDPRGPVILMAAGGLLFLAYLSMR 310

Query: 181 LMIN 184
           +++ 
Sbjct: 311 MIMR 314


>gi|258624767|ref|ZP_05719698.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|262173890|ref|ZP_06041567.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
 gi|258582929|gb|EEW07747.1| Flp pilus assembly protein TadB [Vibrio mimicus VM603]
 gi|261891248|gb|EEY37235.1| flp pilus assembly protein TadB [Vibrio mimicus MB-451]
          Length = 303

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 91/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L   +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G
Sbjct: 119 KLRAHKTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIG 178

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               E ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL
Sbjct: 179 EDPDEVLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNAL 238

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA++SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + ++
Sbjct: 239 TSEARSSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMI 298

Query: 183 IN 184
           + 
Sbjct: 299 LR 300


>gi|297192378|ref|ZP_06909776.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197723021|gb|EDY66929.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 312

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 87/187 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KRT  F+   P    ++  + +AGL +  A+ + V +  DP R E RRV +   
Sbjct: 126 LNWQRAKRTEAFISQLPELTRVLANATQAGLALRTAIGMAVEELDDPAREELRRVADQLA 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG SL +++  +V  +P +E++   + + + ++ GG +  +L NL+  L +RK  + +V 
Sbjct: 186 LGRSLDDALGDLVERLPSRELTVLVSTLILSNRAGGTIVTSLRNLTETLEERKETRREVT 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            L  + K +A  +  L      ++     G +  +     G + + +A     +G +++ 
Sbjct: 246 TLLSQVKVTAVAVPVLGLGFLLVINGMRDGALEDMTGALGGRVAVLIATGLYALGFILIN 305

Query: 181 LMINFDV 187
            +    +
Sbjct: 306 RLTRVRI 312


>gi|253576285|ref|ZP_04853616.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844412|gb|EES72429.1| type II secretion system protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 270

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 79/192 (41%), Gaps = 8/192 (4%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFRRV 55
           +L+++R       F  AL  +  S+ AG  V +     +           + V  E   +
Sbjct: 80  YLLRRRRENLSLHFKQALYSLSSSLAAGRSVENGFREAIDDLRLLYPDGDNDVMRELAII 139

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G  + E++    R   ++++  F+ V +   + GG+L E +   S ++ ++  +
Sbjct: 140 CARMDYGQPIEEALLDFSRRAAMEDIDNFADVFTTCKRSGGDLVEVIRRTSNLIGEKLEI 199

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
             ++  +  + +  A  + + P      + FTSP YM  L +   G ++ GVA     I 
Sbjct: 200 TQEISVMIAQKRFEAKAMLAAPVLFLLFMQFTSPDYMRPL-HHGAGLLISGVALLLYAIC 258

Query: 176 IMVMRLMINFDV 187
             +M  +I+  V
Sbjct: 259 AWLMLKIIDIRV 270


>gi|85711970|ref|ZP_01043024.1| Flp pilus assembly protein TadB [Idiomarina baltica OS145]
 gi|85694156|gb|EAQ32100.1| Flp pilus assembly protein TadB [Idiomarina baltica OS145]
          Length = 281

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 89/185 (48%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + +  KR        P  L  +   +++G+ + +AV  +  +   P+  E   +I    L
Sbjct: 95  RRMRNKRYRALQRQLPMLLMNLSNQLKSGMSMVNAVTSLFDEFEAPLGQEVNELIRQVRL 154

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L  +++   R +P+  ++     +++  + GG  S+ L  L+  L  ++ ++ + QA
Sbjct: 155 GDDLPTALTDWQRRVPIFSITLVVQALTLGYRNGGQQSQVLRRLAENLGQQQKVRDRQQA 214

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           LS + +  AW++  +P  +  L+ +  P +   L N   G + LGVA    LIG M+++ 
Sbjct: 215 LSAQGRMQAWVLICMPLALFLLLNWMKPTHTAYLTNTLIGQVALGVAIVLTLIGAMMVKR 274

Query: 182 MINFD 186
           ++N D
Sbjct: 275 ILNTD 279


>gi|258620799|ref|ZP_05715834.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
 gi|258586997|gb|EEW11711.1| Flp pilus assembly protein TadB [Vibrio mimicus VM573]
          Length = 303

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 91/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L   +TAKF  +FP+AL+I+  ++ AG  +  A   +  Q  + V  EF+ + E   +G
Sbjct: 119 KLRAHKTAKFQSNFPDALNILSGALSAGQSIVHAFEYVGKQLDNDVGYEFKFMAERLLIG 178

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               E ++R     P  E  FF++ I +    GG L E +  ++RI+ D + +  K  AL
Sbjct: 179 EDPDEVLARSAASFPYVEYFFFASTIRINLSRGGQLKEVINRINRIMFDARAVDKKKNAL 238

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA++SA II +LP     ++ FTSP   N ++ +  G  +        LIG   + ++
Sbjct: 239 TSEARSSAKIIAALPVIFLLILKFTSPENYNFVMFEEGGKPIFYYVVISELIGFFCIWMI 298

Query: 183 IN 184
           + 
Sbjct: 299 LR 300


>gi|83719714|ref|YP_443056.1| hypothetical protein BTH_I2539 [Burkholderia thailandensis E264]
 gi|83653539|gb|ABC37602.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 336

 Score = 97.9 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 151 LASRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLR 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 211 SGVEIDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 270

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 271 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQLVYLAFILQVAGGYWLY 330

Query: 181 LMINFD 186
            +    
Sbjct: 331 RLARLR 336


>gi|91783014|ref|YP_558220.1| putative tight adherence TadB related transmembrane protein
           [Burkholderia xenovorans LB400]
 gi|91686968|gb|ABE30168.1| Putative tight adherence TadB related transmembrane protein
           [Burkholderia xenovorans LB400]
          Length = 359

 Score = 97.5 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V     
Sbjct: 173 LTLRVNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLR 232

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S++     ++E+     V+ +  + GG     L  ++  +RD ++ + ++ 
Sbjct: 233 TGVEIDRALSQVALIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELV 292

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A A  L G  ++ 
Sbjct: 293 AMSAETRLSSWVLAMLPVGIGGFLILSNPKYFASMWFDPTGRQLVYLAFALQLGGAYLLY 352

Query: 181 LMINFD 186
            + N  
Sbjct: 353 RLANLR 358


>gi|296122065|ref|YP_003629843.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
 gi|296014405|gb|ADG67644.1| type II secretion system protein [Planctomyces limnophilus DSM
           3776]
          Length = 285

 Score = 97.5 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 81/184 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + ++   R  + L   P  L+ + R+   G  V   + ++   +  P+  E +  +    
Sbjct: 97  LMYVRSSRQNQILGQLPAMLEELARAATTGRSVEQCLQLVAADTPSPLGDELQLCVRRMQ 156

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ + ++++ +     L  +  F   + V  Q GG+L   L  LS+ +RDR     +++
Sbjct: 157 MGMPMRDAVADLPDRTGLMTLRLFCMTLGVHQQTGGDLVWVLEQLSKTIRDRLQYLGRLR 216

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++  ++A+A ++  LP  V        P Y + L+    G     +A    +IG + + 
Sbjct: 217 AMTAASRATALLMVVLPPGVLIFFTLRDPDYFSKLMGSSWGRNGTIIAFTLTMIGTIWVL 276

Query: 181 LMIN 184
            ++ 
Sbjct: 277 RILR 280


>gi|251791987|ref|YP_003006707.1| TadB [Aggregatibacter aphrophilus NJ8700]
 gi|247533374|gb|ACS96620.1| TadB [Aggregatibacter aphrophilus NJ8700]
          Length = 294

 Score = 97.5 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 75/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G    
Sbjct: 114 RNKKTFNAMFPEVIQIMNAAATSGAGLLQALERCGKDLTGQLGEEFKSIHKRLSIGEDPM 173

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T++      GG + E ++ L R++ D   M+ K +A++ EA
Sbjct: 174 AVFEDSYSRYPYKEFYFFITIVRTNLNKGGQIREVISRLGRLIADSNKMEKKKKAMTSEA 233

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA I+  LP      + F  P     LINDP G  +L       L G+ ++  ++ 
Sbjct: 234 RMSAMIVACLPVGFFFFMQFAMPENFEFLINDPSGRYVLYYVFGSELFGMGIIWWLMR 291


>gi|197302281|ref|ZP_03167340.1| hypothetical protein RUMLAC_01008 [Ruminococcus lactaris ATCC
           29176]
 gi|197298712|gb|EDY33253.1| hypothetical protein RUMLAC_01008 [Ruminococcus lactaris ATCC
           29176]
          Length = 197

 Score = 97.5 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 83/193 (43%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVR------SEFRR 54
           ++ +  K+  +F   F +++ I+  +++AG    +A+           +       E+  
Sbjct: 5   LEEMTDKKEEEFRVQFKDSIQIMAGALKAGYSAENAIRETCHDLKPMYKSESRIIKEYEI 64

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +I    + + + + +S     +  ++V  F TV +   + GG+    + +  +++ ++  
Sbjct: 65  MIRKLKIHIPVGQVLSEFAENVEQEDVDNFVTVFTTAQKSGGDSIVIIKDAVKVISEKME 124

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+  +PF +   +  T   ++ VL  +P G +++ +  A    
Sbjct: 125 TEKEIQTMIASKKLEFEIMSMIPFGMIGYMKLTFGDFLKVLYGNPAGIIVMSICLALYFT 184

Query: 175 GIMVMRLMINFDV 187
             +  + MI  +V
Sbjct: 185 AYIWGKKMIKIEV 197


>gi|238762412|ref|ZP_04623383.1| Type II secretion system protein F domain protein [Yersinia
           kristensenii ATCC 33638]
 gi|238699397|gb|EEP92143.1| Type II secretion system protein F domain protein [Yersinia
           kristensenii ATCC 33638]
          Length = 284

 Score = 97.5 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 43/183 (23%), Positives = 81/183 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K+    F  DFP AL +I  +  +G  ++  +     + S P+ +EF  +    +
Sbjct: 98  LRLSRKRHHTLFKKDFPEALLMINMAASSGASINQVLERCGQEISGPLGNEFSLICRRLN 157

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S         +     E  F  T+  +  Q GG L E  + LS ++   K  + K  
Sbjct: 158 VGESPEAVFYDSYQRFKHPEFYFLITITLLNLQQGGQLRELTSRLSEVINKNKTTEQKKA 217

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+YF  P  +  + + P G M+        ++GI+++R
Sbjct: 218 VMTAQVRMSVNIISIMPIAFSFLLYFLDPTTIESMWDHPIGRMIYYYIITSEIVGIVLIR 277

Query: 181 LMI 183
            M+
Sbjct: 278 KML 280


>gi|170732850|ref|YP_001764797.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
 gi|169816092|gb|ACA90675.1| type II secretion system protein [Burkholderia cenocepacia MC0-3]
          Length = 326

 Score = 97.5 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 79/186 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 141 ITSRISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSRMLR 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ 
Sbjct: 201 SGVDIDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELS 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  V + V  TSP Y   + ND  G  L+ +A     IG   + 
Sbjct: 261 AMSAETRLSAWVLALLPIAVGSFVIATSPRYFTAMWNDDTGRQLVYLAFVLQAIGGFWLF 320

Query: 181 LMINFD 186
            +    
Sbjct: 321 RLARLR 326


>gi|197336186|ref|YP_002155273.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
 gi|197317676|gb|ACH67123.1| Flp pilus assembly protein TadB [Vibrio fischeri MJ11]
          Length = 305

 Score = 97.5 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 87/182 (47%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L ++   +F + FP+AL+++  +V AG  ++ A+A +  +    V  EF+ + E   LG
Sbjct: 121 WLQEREKKQFNERFPDALNMLSSAVSAGESITHAIAFVGKKLEGDVGKEFKIMGERLQLG 180

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S  E   +     P     FF   +      GG L + ++ L+R++ D + ++ K  AL
Sbjct: 181 ESPDEVFKKSCVRFPYPAFRFFVITLRANMNRGGQLRDVISRLNRLMFDARAVERKKYAL 240

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ + PF    ++ F SP     ++    G  +L        IG++++  +
Sbjct: 241 TSEARISAKIVCATPFFFLFILQFLSPENYEFVMFHTEGRPILYYVLISEAIGMLIIWGL 300

Query: 183 IN 184
           + 
Sbjct: 301 LK 302


>gi|297581612|ref|ZP_06943534.1| flp pilus assembly protein TadB [Vibrio cholerae RC385]
 gi|297534019|gb|EFH72858.1| flp pilus assembly protein TadB [Vibrio cholerae RC385]
          Length = 299

 Score = 97.5 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 95/185 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L +KR  +F D+ P+ +D ++R++R G P+      I  Q        F ++++   +
Sbjct: 114 QQLQQKRMERFRDELPDIIDGLIRALRVGAPMLAVFQDIANQHQGVTSRLFHQIVDELRV 173

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G ++++ +    + MP+ E  F + V+S+Q + GG L+  L  L   LR R  + A +Q 
Sbjct: 174 GRTMADVMKLAAQRMPIAEFRFLTIVLSLQQETGGRLANVLERLGNTLRSRAELNASIQT 233

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ E++ SA ++ +LP  V  +++ T   + N L+    G +++      +L G+ ++R 
Sbjct: 234 ITSESRNSAKVLAALPVLVMLVLFSTGREHFNFLMATTGGQIVMIYITISILFGLFLIRR 293

Query: 182 MINFD 186
           M    
Sbjct: 294 MTQLK 298


>gi|134282399|ref|ZP_01769104.1| type II secretion system protein [Burkholderia pseudomallei 305]
 gi|134246437|gb|EBA46526.1| type II secretion system protein [Burkholderia pseudomallei 305]
          Length = 335

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 150 LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 210 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 270 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 329

Query: 181 LMINFD 186
            +    
Sbjct: 330 RLARLR 335


>gi|53719506|ref|YP_108492.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76810037|ref|YP_333344.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|126438493|ref|YP_001058810.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126453046|ref|YP_001066061.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|242314637|ref|ZP_04813653.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254188636|ref|ZP_04895147.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254197238|ref|ZP_04903660.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254259377|ref|ZP_04950431.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|254297790|ref|ZP_04965243.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52209920|emb|CAH35892.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei K96243]
 gi|76579490|gb|ABA48965.1| putative fimbriae-related outer membrane protein [Burkholderia
           pseudomallei 1710b]
 gi|126217986|gb|ABN81492.1| type II secretion system protein [Burkholderia pseudomallei 668]
 gi|126226688|gb|ABN90228.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157807876|gb|EDO85046.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157936315|gb|EDO91985.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653979|gb|EDS86672.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|242137876|gb|EES24278.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254218066|gb|EET07450.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 335

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 150 LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 210 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 269

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 270 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 329

Query: 181 LMINFD 186
            +    
Sbjct: 330 RLARLR 335


>gi|167582057|ref|ZP_02374931.1| hypothetical protein BthaT_28197 [Burkholderia thailandensis TXDOH]
          Length = 261

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 76  LASRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLR 135

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 136 SGVEIDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 195

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 196 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQLVYLAFILQVAGGYWLY 255

Query: 181 LMINFD 186
            +    
Sbjct: 256 RLARLR 261


>gi|293604634|ref|ZP_06687036.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
 gi|292816965|gb|EFF76044.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
          Length = 272

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 101/186 (54%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  +F    P AL ++  ++RAG+ ++  +  +V QS  P+  EF  ++  Q 
Sbjct: 86  VSQLRRRRAHRFEQQLPMALLMLAAAMRAGVALTTGLRHVVEQSGAPLAQEFGLMLREQR 145

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+    ++  +   MP    S     + + SQ GGNL+EAL ++++ LR R  ++AK+Q
Sbjct: 146 LGVPWDAALENLQTRMPGDSTSLVVAAMRIASQTGGNLAEALESIAQTLRARLQLQAKLQ 205

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +  AWI+G+LP  +  ++    P  M +L + P G  +L +       G++++R
Sbjct: 206 ALTSQGRLQAWIVGALPLLLLAVLDQLEPDIMGLLWHTPIGWGVLAILVVLETAGVLLIR 265

Query: 181 LMINFD 186
            ++  +
Sbjct: 266 RIVRIE 271


>gi|237812070|ref|YP_002896521.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|237505569|gb|ACQ97887.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 329

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 144 LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 203

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 204 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 263

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 264 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 323

Query: 181 LMINFD 186
            +    
Sbjct: 324 RLARLR 329


>gi|251795273|ref|YP_003010004.1| type II secretion system protein [Paenibacillus sp. JDR-2]
 gi|247542899|gb|ACS99917.1| type II secretion system protein [Paenibacillus sp. JDR-2]
          Length = 287

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 83/193 (43%), Gaps = 8/193 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFRR 54
             L+ +R  +    F  AL  +  S+ AG  V +A    +          +  +  EFR 
Sbjct: 96  SFLLVRRKERLQLQFKEALYSLASSLAAGRSVENAFLATIDDLKLLYPDPNTELLLEFRI 155

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V      G  L +++  + +   L +++ FS V +V  + GG+L E +   S+ + ++  
Sbjct: 156 VKYRLDNGEPLEQALRSLAKRTHLDDITQFSDVFAVCKRSGGDLVEVMKRTSQTIGEKLE 215

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  L  + +  A I+ ++PF     +   +P YM  L     G++LL +    +  
Sbjct: 216 VKQEISVLLAQKRFEARIMMAVPFAFLGFLSAFAPDYMKPLYG-GGGYVLLTIGLVVLSF 274

Query: 175 GIMVMRLMINFDV 187
              ++  ++   V
Sbjct: 275 CFWLIHRIMQIRV 287


>gi|323525749|ref|YP_004227902.1| Type II secretion system F domain-containing protein [Burkholderia
           sp. CCGE1001]
 gi|323382751|gb|ADX54842.1| Type II secretion system F domain protein [Burkholderia sp.
           CCGE1001]
          Length = 386

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 80/185 (43%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
                +R    +   P+ LD IVR +  G  V  A    +  +  P+R     V      
Sbjct: 201 SMRASRRRQAIVRQLPSFLDGIVRLITLGNSVPAAFQASLQITEAPLRECLDHVSRMLRS 260

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G+ +  ++S +      +E+     V+ +  + GG     L  +S  +RD ++ + ++ A
Sbjct: 261 GVEIDRALSHVAVLYGARELELVGAVLRLSVKYGGRADVMLDRMSSFMRDLEHAERELVA 320

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           +S E + S+W++G LP  +   +  T+P Y   +  DP G  +L +A A  L G  ++  
Sbjct: 321 MSSETRLSSWVLGMLPAGIGGFLILTNPRYFGAMWFDPGGRQILYIAFALQLTGAYLLYR 380

Query: 182 MINFD 186
           +    
Sbjct: 381 LARLK 385


>gi|260914308|ref|ZP_05920777.1| Flp pilus assembly protein TadB [Pasteurella dagmatis ATCC 43325]
 gi|260631409|gb|EEX49591.1| Flp pilus assembly protein TadB [Pasteurella dagmatis ATCC 43325]
          Length = 294

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 81/179 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++    F   FP  + I+  +  +G  +  A+       +  +  EF+ + +   +G   
Sbjct: 113 RRNHKMFNAMFPEVIQILTAAASSGAGLLQALERCGKDLTGQLGDEFKNIHKRLAIGEDP 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
                      P +E  FF T+I      GG + E ++ L RI+ D K M+ K +A++ E
Sbjct: 173 VTVFEDSYSRYPYKEFYFFITIIRTNLSKGGQIREVISRLGRIIADAKKMEQKKKAMTSE 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ SA I+ S P      + FT P   + LINDP G  +L       LIG++++  ++ 
Sbjct: 233 ARMSAMIVASFPIAFFFFMQFTMPENFDFLINDPSGRYVLYYVFGSELIGMLIIWWLMR 291


>gi|107022597|ref|YP_620924.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116689546|ref|YP_835169.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
 gi|105892786|gb|ABF75951.1| type II secretion system protein [Burkholderia cenocepacia AU 1054]
 gi|116647635|gb|ABK08276.1| type II secretion system protein [Burkholderia cenocepacia HI2424]
          Length = 326

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 79/186 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 141 ITSRISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSRMLR 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ 
Sbjct: 201 SGVDIDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELS 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  V + V  TSP Y   + ND  G  L+ +A     IG   + 
Sbjct: 261 AMSAETRLSAWVLALLPIAVGSFVIATSPRYFTAMWNDDAGRQLVYLAFVLQAIGGFWLF 320

Query: 181 LMINFD 186
            +    
Sbjct: 321 RLARLR 326


>gi|331092046|ref|ZP_08340877.1| hypothetical protein HMPREF9477_01520 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402247|gb|EGG81818.1| hypothetical protein HMPREF9477_01520 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 251

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 78/192 (40%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K   K+R  KF   F  AL  +   +  G  + +A+  +  +          +  EF  +
Sbjct: 60  KEYAKRRKEKFQKQFKEALQSLRTVLNVGYSIENAIREVKKEMTTLYGEDALITKEFSYL 119

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           +    + + + ++       + + EV+ F T++S   + GG++   L      +  +  +
Sbjct: 120 VRQLEMNIPVEQAWKTFADRVEMSEVTHFVTILSTIKRSGGDMIAVLRQTIETICMKLEV 179

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  + +  +    I+ ++P  +   +  + P +++VL  +  G +++ V        
Sbjct: 180 QQEIYTIIVAKQMEFRIMSAIPMGIIVYLKMSFPEFLSVLYQELVGKVVMTVCLLIYFAA 239

Query: 176 IMVMRLMINFDV 187
               + ++  +V
Sbjct: 240 YQWGKKILEIEV 251


>gi|260365460|ref|ZP_05777997.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
 gi|260877525|ref|ZP_05889880.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|260897534|ref|ZP_05906030.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|260901736|ref|ZP_05910131.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308087149|gb|EFO36844.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus Peru-466]
 gi|308090878|gb|EFO40573.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AN-5034]
 gi|308108899|gb|EFO46439.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ4037]
 gi|308114317|gb|EFO51857.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus K5030]
          Length = 304

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 87/175 (49%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    + +
Sbjct: 127 QRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLDNEVGEEFKKMSERLLIGEDPDDVL 186

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
           +R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+AS
Sbjct: 187 ARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEARAS 246

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A II +LP     ++  TSP   N ++ +  G  +         IG   + +++ 
Sbjct: 247 AKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFIYMILR 301


>gi|59711124|ref|YP_203900.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
 gi|59479225|gb|AAW85012.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio fischeri ES114]
          Length = 305

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 87/182 (47%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L +K   +F + FP+AL+++  +V AG  ++ A+A +  +    V  EF+ + E   LG
Sbjct: 121 WLQEKEKKQFNERFPDALNMLSSAVSAGESITHAIAFVGKKLEGDVGKEFKIMGERLQLG 180

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
            S  E   +     P     FF   +      GG L + ++ L+R++ D + ++ K  AL
Sbjct: 181 ESPDEVFKKSCVRFPYPAFRFFVITLRANMNRGGQLRDVISRLNRLMFDARAVERKKYAL 240

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA I+ + PF    ++ F SP     ++    G  +L        IG++++  +
Sbjct: 241 TSEARISAKIVCATPFFFLFILQFLSPENYEFVMFHAEGRPILYYVLISEAIGMLIIWGL 300

Query: 183 IN 184
           + 
Sbjct: 301 LK 302


>gi|317133735|ref|YP_004089646.1| Type II secretion system F domain [Ruminococcus albus 7]
 gi|315450197|gb|ADU23760.1| Type II secretion system F domain [Ruminococcus albus 7]
          Length = 292

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 90/186 (48%), Gaps = 2/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIET 58
           + +  KK    F + +  AL  +  S+RAG+ +  AV  +         ++ EFR++   
Sbjct: 101 VSYTEKKHKKNFEERYARALRQLSSSLRAGMTLQQAVEDLCKCPFIHYEIKKEFRQINSD 160

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
             LG S+SE+   M   +P  +V    + I +QS +GG+ +E++  ++  +  R  ++ +
Sbjct: 161 IQLGFSISEAFGHMAERIPTADVKDVVSAIKMQSLVGGSEAESIEIITNNINSRMMLRKE 220

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++ L    K +   +  LP  +   +Y++SP Y   L +   G ++  +A   M+IG  +
Sbjct: 221 IKTLFASTKMTIIGMDILPAIIILFLYYSSPMYFRPLFSTLIGRLVFVLAIILMVIGSYI 280

Query: 179 MRLMIN 184
            R  +N
Sbjct: 281 DRKFLN 286


>gi|13471028|ref|NP_102597.1| integral membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021772|dbj|BAB48383.1| probable integral membrane protein [Mesorhizobium loti MAFF303099]
          Length = 301

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 100/175 (57%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F    P AL++I R ++AG PV  A+A++  +  DP+ +EF  + +    G  L  +++ 
Sbjct: 126 FGMQLPEALELITRGLKAGHPVPVAIAMVSREMPDPIGTEFGVIADEVTYGSDLVSALNS 185

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           +   +  +++  F T +S+QS  GGNL E L  L+  +R+R  ++ KV+A+S E + SA+
Sbjct: 186 LFDRVGHEDLPLFITAVSIQSSSGGNLREILDGLALTIRERGKLRRKVRAISTEGRMSAY 245

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           I+ ++P  +   +    PG+   + ++P+   L+G +  ++++G ++M  M NF 
Sbjct: 246 ILTAIPALLFAAIMALMPGFYRDVWDEPKTWYLIGGSVTWLMLGNLMMFKMSNFR 300


>gi|302384577|ref|YP_003820399.1| Type II secretion system F domain protein [Clostridium
           saccharolyticum WM1]
 gi|302195205|gb|ADL02776.1| Type II secretion system F domain protein [Clostridium
           saccharolyticum WM1]
          Length = 245

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 88/192 (45%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
             L KKR  +   +F   + ++   + AG  V +A +  V +          V  EF  +
Sbjct: 54  SELKKKRLQQLNLEFKEGILLLASFLSAGYSVENAFSASVKELVILYGEEGMVSMEFGHI 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           +    +  S+ +++S       L +V  F+ V +   + GG L   +++ + ++RD+  +
Sbjct: 114 VSQIRINRSVEQALSEFAGRSGLDDVKNFAEVFAAAKRSGGELVSIISHTAAVIRDKMQV 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  ++   +    I+  +PF +   +  TSPG+ N++ N   G +L+ +  A  +  
Sbjct: 174 RQEILTMTASKQFEQKIMTMIPFFIVLYIDMTSPGFFNIMYNTGIGRILMTLCLAVYIGA 233

Query: 176 IMVMRLMINFDV 187
           I + R ++  ++
Sbjct: 234 IAIARHIMKIEI 245


>gi|283787696|ref|YP_003367561.1| tight adherence protein B [Citrobacter rodentium ICC168]
 gi|282951150|emb|CBG90841.1| putative tight adherence protein B [Citrobacter rodentium ICC168]
          Length = 300

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 81/176 (46%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
              F   F  AL+II  +V AG  +   +     + S  V  EF  + +   +G  +   
Sbjct: 123 RQAFETGFAEALNIIGGAVGAGNSLLHGIEQSGQKVSGIVGEEFTIISQRLEIGEDVESV 182

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
                  +  +E  FF   + +  + GG + E +++L++++ + + M  +  A + E +A
Sbjct: 183 FMDSYERLFYREYFFFVIAVLINMRGGGEVKEIVSHLAKLISNARLMDRQKLAKTAEPRA 242

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           S  I+  +P      + F SP   +VL++DP G MLL    A  L+G+  +  MIN
Sbjct: 243 SIKILMVIPVGFFFFLKFLSPENFDVLLHDPTGQMLLYYCIASELLGLFWVWTMIN 298


>gi|284029667|ref|YP_003379598.1| type II secretion system protein [Kribbella flavida DSM 17836]
 gi|283808960|gb|ADB30799.1| type II secretion system protein [Kribbella flavida DSM 17836]
          Length = 286

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   +KR A+F + +P+ +D I  +VRAGL +S+A+A +  +   P+R  FRR      
Sbjct: 95  LKSRARKRLAEFRELWPDVVDNIASAVRAGLSLSEALAQVGERGPLPLREPFRRFGADYA 154

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
                +ES+ R+   +           + +  +  GG+L   L +LS  LRD    ++++
Sbjct: 155 STGRFAESLDRLKARLADPVGDRVVEALRIAREVGGGDLGRLLRSLSSFLRDDARTRSEL 214

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           ++    +   A +  + P+ V  L+ F          N P G +++G+ AA  ++   VM
Sbjct: 215 ESRQSWSVNGARVAVAAPWLVLGLLSFQGDVIQR--YNSPVGALVIGIGAAVCVLAYRVM 272

Query: 180 RLMINF 185
             +   
Sbjct: 273 LRIGRL 278


>gi|167620220|ref|ZP_02388851.1| hypothetical protein BthaB_28195 [Burkholderia thailandensis Bt4]
          Length = 242

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 57  LASRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTDAPLRGCLDHVSRMLR 116

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 117 SGVEIDRAMVYVAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 176

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 177 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQLVYLAFILQVAGGYWLY 236

Query: 181 LMINFD 186
            +    
Sbjct: 237 RLARLR 242


>gi|221070077|ref|ZP_03546182.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220715100|gb|EED70468.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 322

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    +K  A+     P  LD  VR V  G  V  A  +    + DP++S   +      
Sbjct: 133 LYARAQKFRARLTQQLPGFLDNTVRLVTIGNSVQAAFQMAAASTKDPLQSVMEKAASLAR 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  +++ + R   L E+   + ++ +  + GG +   L  ++  +RDR+  +  + 
Sbjct: 193 AGMDLENAVAHVARQTRLDELHLLAAILRISVRYGGRVDLLLERVANFMRDREQAEQDLS 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SAW++  LP  V  L+   +  Y   + ND  G  ++  AAA  + G++++ 
Sbjct: 253 AMTAEIRMSAWVLSLLPVAVCCLIISFNASYFLNMWNDASGRNIIWAAAALQVFGVLLLY 312

Query: 181 LMINFD 186
            M   D
Sbjct: 313 RMAKLD 318


>gi|153836331|ref|ZP_01988998.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|149750233|gb|EDM60978.1| Flp pilus assembly protein TadB [Vibrio parahaemolyticus AQ3810]
 gi|328470522|gb|EGF41433.1| putative TadB protein [Vibrio parahaemolyticus 10329]
          Length = 304

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 87/175 (49%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            +F D+FP+AL+I+  ++ +G  +  A   +  Q  + V  EF+++ E   +G    + +
Sbjct: 127 QRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQLENEVGEEFKKMSERLLIGEDPDDVL 186

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
           +R     P  E  FF+  I +    GG L + +  ++RI+ + + ++ K  AL+ EA+AS
Sbjct: 187 ARSAASFPYVEYFFFAATIRINLSRGGQLKDVINRINRIMFEARAIEKKKNALTSEARAS 246

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A II +LP     ++  TSP   N ++ +  G  +         IG   + +++ 
Sbjct: 247 AKIIAALPVIFIMILKVTSPENYNFVMFEEGGKPIFYYVLVSEAIGFFFIYMILR 301


>gi|296133932|ref|YP_003641179.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296032510|gb|ADG83278.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 278

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 85/194 (43%), Gaps = 7/194 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFR 53
           ++ LI KR A+    F +AL  +  S+  G  +  A    +          +  +  EF 
Sbjct: 85  VQDLITKRKAELQLQFKDALYSLTSSLGVGRSLESAFKTALNDLRVLYPDENTYIIKEFG 144

Query: 54  RVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRK 113
            +     L   +  ++        L+++  F+ V+ +  + GGNL + + N S IL D+ 
Sbjct: 145 YICRKIELNEPVETALLDFAERSGLEDIKNFAEVMVICKRTGGNLVQVVKNTSAILSDKI 204

Query: 114 NMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFML 173
            +  +++ L  + K    I+  +P     LV F   GYM+ L    +G++L+ +A   ++
Sbjct: 205 EISQEIELLLTKQKYEQKILNIMPIVFIGLVKFGGSGYMDSLYTSIKGYLLMALALGILI 264

Query: 174 IGIMVMRLMINFDV 187
              +V + + +  V
Sbjct: 265 AASVVSKKIFDIKV 278


>gi|119715489|ref|YP_922454.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119536150|gb|ABL80767.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 284

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 78/186 (41%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  +  + +P A+D +  +VRAG+ + DA+A +  +  +P+R  F +      
Sbjct: 93  VSGRARRRQRELAEVWPEAVDNLTSAVRAGMSLPDALAGLGSRGPEPLRDAFDQFALDYQ 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKV 119
           +     E + R+   +           + +  ++GG  L   L NLS  LRD    ++++
Sbjct: 153 VTGRFGECLDRLKERLADPVGDRVVEGLRIAREVGGGELGRLLRNLSSYLRDDARTRSEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A        A +  + P+ V   + F S          P G ++L V A   ++   +M
Sbjct: 213 EARQAWTVNGARLAVASPWLVLLFMSFQSEVIHR--YASPGGVLVLAVGAGACVVAYRLM 270

Query: 180 RLMINF 185
             +   
Sbjct: 271 MRIGRL 276


>gi|67641291|ref|ZP_00440072.1| type II secretion system protein [Burkholderia mallei GB8 horse 4]
 gi|121598780|ref|YP_993095.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124386324|ref|YP_001026128.1| hypothetical protein BMA10229_A0120 [Burkholderia mallei NCTC
           10229]
 gi|126449995|ref|YP_001080600.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|167002478|ref|ZP_02268268.1| type II secretion system protein [Burkholderia mallei PRL-20]
 gi|254178697|ref|ZP_04885352.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|254206226|ref|ZP_04912578.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|121227590|gb|ABM50108.1| type II secretion system protein [Burkholderia mallei SAVP1]
 gi|124294344|gb|ABN03613.1| putative membrane protein [Burkholderia mallei NCTC 10229]
 gi|126242865|gb|ABO05958.1| type II secretion system protein [Burkholderia mallei NCTC 10247]
 gi|147753669|gb|EDK60734.1| type II secretion system protein [Burkholderia mallei JHU]
 gi|160699736|gb|EDP89706.1| type II secretion system protein [Burkholderia mallei ATCC 10399]
 gi|238522200|gb|EEP85646.1| type II secretion system protein [Burkholderia mallei GB8 horse 4]
 gi|243061819|gb|EES44005.1| type II secretion system protein [Burkholderia mallei PRL-20]
          Length = 306

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 121 LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 180

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 181 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 240

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 241 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 300

Query: 181 LMINFD 186
            +    
Sbjct: 301 RLARLR 306


>gi|206559897|ref|YP_002230661.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035938|emb|CAR51830.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 326

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V +   
Sbjct: 141 ITSRISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSALQTAEMPLRRCLDDVSQMLR 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E      V+ +  + GG     L  +S  +RD +  + ++ 
Sbjct: 201 SGVEIDRAMLHIAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEQAERELS 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  V + V  TSP Y   +  D  G  L+ +A A   IG   + 
Sbjct: 261 AMSAETRLSAWVLALLPIAVGSFVIATSPRYFTAMWGDDNGRQLIYLAFALQAIGGFWLY 320

Query: 181 LMINFD 186
            +    
Sbjct: 321 RLARLR 326


>gi|284989774|ref|YP_003408328.1| Type II secretion system F domain-containing protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284063019|gb|ADB73957.1| Type II secretion system F domain protein [Geodermatophilus
           obscurus DSM 43160]
          Length = 285

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 71/186 (38%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++ L  KR A   + +P  +D +  +VRAGL + +A++ +  +  + +R  F R      
Sbjct: 94  VRRLAVKRRADLREVWPEVVDNLASAVRAGLSLPEALSALSTRGPEVLRPPFARFAAEYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                   + R+   +           +   +   G +L   L  LS  LR+    +A++
Sbjct: 154 SSGRFGNGLDRLKDDLADPVGDRIVETLRVAREVGGSDLGRVLRTLSSFLREDARARAEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +        +A +  + P+ V  L+   S        + P G  +L   AA  L    +M
Sbjct: 214 ETRQGWVVQAARLAVAAPWVVLLLLATQSATLEA--YDSPLGTAILLGGAAVCLASYRLM 271

Query: 180 RLMINF 185
             +   
Sbjct: 272 LRIGRL 277


>gi|330873644|gb|EGH07793.1| hypothetical protein PSYMP_04410 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 295

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 95/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 110 VSWRYERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQ 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL +++          E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 170 LGVSLPDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++G LP  ++      +P Y+  + ND  G ++L +A    ++G +++ 
Sbjct: 230 AMTGETRMTAIVLGLLPVSMAGYFLAVNPDYLLHMWNDGSGQIMLSMAFGLQVLGCLMLW 289

Query: 181 LMIN 184
            M+ 
Sbjct: 290 RMLR 293


>gi|257790637|ref|YP_003181243.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257474534|gb|ACV54854.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 296

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 90/187 (48%), Gaps = 4/187 (2%)

Query: 3   HLIKKR---TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ 59
           +L  +R     KF +    A+ +I  ++RAG  V+ A+  +    SDP++SEFRR+    
Sbjct: 109 YLKVRRDSGKKKFEEQLGQAMPLIASNLRAGSSVAQAIGPVAENMSDPIKSEFRRLTSDI 168

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G  + E++ ++      +++  F+T + +  Q GG+L++   N+ + +R R   +  +
Sbjct: 169 RAGTPVPEALDKVADRTGSRDLRLFATAVDISQQTGGSLADITENVGQTVRARVEARKAI 228

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           ++ +   +  + I+  LP  +   +   SP +     + P G  L+ +A     +  ++M
Sbjct: 229 RSKTSLNRIESQIMVGLPVFMMAALLAISPSH-REFYSQPSGWALIALAVVLDTLAYLMM 287

Query: 180 RLMINFD 186
           R M +  
Sbjct: 288 RKMGDVK 294


>gi|310822672|ref|YP_003955030.1| type II secretion system protein f domain-containing protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395744|gb|ADO73203.1| type II secretion system protein F domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 281

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 100/187 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+  K+R  KF     +AL  +  + +AGL    A+  +  ++  P+  EF   ++   
Sbjct: 95  VKYYRKRRIKKFNVQLVDALQAMANAFKAGLTFPQAIEHVAREALPPLSQEFGLFVKEVK 154

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  M + +   ++       ++  QLGGN++E    +S ++R+R  ++ K+ 
Sbjct: 155 LGVPLEEALINMGKRVGSDDLELVVVSTNIARQLGGNMAEMFETISMVIRERFRLEGKID 214

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + K   WI+ S+P  +  ++    P  M  +++   G++L+ V A   ++GI+++R
Sbjct: 215 ALTSQGKLQGWIVASMPAVLGMVLNSMRPDLMEPMMDHMFGYVLVTVIAIMEILGILIIR 274

Query: 181 LMINFDV 187
            ++N D+
Sbjct: 275 RIVNIDI 281


>gi|148976303|ref|ZP_01813027.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrionales bacterium SWAT-3]
 gi|145964397|gb|EDK29652.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrionales bacterium SWAT-3]
          Length = 302

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 83/182 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  K +  +F     + L +I R+V AGL V  A+  +       +  EF  + +   LG
Sbjct: 115 YRRKLQVEEFEKSIISVLGLISRAVSAGLSVPQAIDQVAQNEQGLLGREFSYIRDNLALG 174

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LSL +++      +P     +FS  + +    GG L + L  LSR + D + M+ KV++L
Sbjct: 175 LSLRDTLEDACIRLPYHSFRYFSVALILNQSNGGQLRDILQGLSRTMHDNRAMRKKVKSL 234

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A  +  LP  +   + +  P   + LIN   G  +L    + +  G +++  +
Sbjct: 235 TSEPRMTALFLSLLPIGLIGSIAWIEPTMADRLINTESGQNVLIYVLSSICFGTLILNSL 294

Query: 183 IN 184
             
Sbjct: 295 TR 296


>gi|330963435|gb|EGH63695.1| hypothetical protein PSYAC_02057 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 295

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 95/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 110 VSWRYERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQ 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL +++          E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 170 LGVSLPDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++G LP  ++      +P Y+  + ND  G ++L +A    ++G +++ 
Sbjct: 230 AMTGETRMTAIVLGLLPVSMAGYFLAVNPDYLLHMWNDGSGQIMLSMAFGLQVLGCLMLW 289

Query: 181 LMIN 184
            M+ 
Sbjct: 290 RMLR 293


>gi|84386793|ref|ZP_00989818.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio splendidus 12B01]
 gi|84378321|gb|EAP95179.1| TadB-like protein involved in pilus formation and/or protein
           secretion [Vibrio splendidus 12B01]
          Length = 304

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 83/182 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  K +  +F     N L +I R+V AGL V  A+  +       +  EF  + +   LG
Sbjct: 117 YRRKMQVEEFEQGIINVLGLISRAVAAGLSVPQAIEQVSETQPGLLGREFSYIRDNLTLG 176

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           LSL +S+      +P     +FS  + +    GG L + L +LSR + D + M+ KV++L
Sbjct: 177 LSLRQSLDDACVRLPYSSFRYFSVALILNQSNGGQLRDILQSLSRTMHDNRAMRKKVKSL 236

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A  +  LP  +   +Y   P  +  L N   G  +L  A   +  G +++  +
Sbjct: 237 TSEPRMTALFLSILPLGLLGGIYLMEPAMIVQLFNTESGQRVLTYAIISISSGTLILNAL 296

Query: 183 IN 184
             
Sbjct: 297 TR 298


>gi|167902895|ref|ZP_02490100.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 264

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 79  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 138

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 139 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 198

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 199 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 258

Query: 181 LMINFD 186
            +    
Sbjct: 259 RLARLR 264


>gi|209545601|ref|YP_002277830.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533278|gb|ACI53215.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 317

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 59/179 (32%), Positives = 108/179 (60%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++  AK     P+AL +IVRS+R G+P+S A+ ++  ++  P   EFR + +   +G SL
Sbjct: 135 RRYAAKLFQQLPDALGMIVRSLRVGIPLSRALIIVGQEAEYPTADEFRMISQDVAVGKSL 194

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +     LQE  FF+T++++Q+Q GG L++ LA+ + ++R R   + +  AL+ E
Sbjct: 195 GDTLHNLAERTGLQEYRFFATIMALQAQTGGTLADVLASFADMIRQRIAARKRGHALASE 254

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ S +++G +PF +  ++   +P YM V +    GHMLLGV+A  + +G   MR ++ 
Sbjct: 255 ARMSCYVLGGIPFAIGGIMSIINPDYMAVFLTTHMGHMLLGVSALMLGLGFGSMRFIMK 313


>gi|294139874|ref|YP_003555852.1| Flp pilus assembly protein TadB [Shewanella violacea DSS12]
 gi|293326343|dbj|BAJ01074.1| Flp pilus assembly protein TadB, putative [Shewanella violacea
           DSS12]
          Length = 311

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 90/178 (50%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
             +F   FP  L  I R+V AG+ V  A+A +       +  EF  + +   +G+SL ++
Sbjct: 133 MKQFDHAFPQVLGQISRAVAAGISVPQAIAQVSEYQQGFLGREFELIRDRLAIGISLKQT 192

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           + +    +P     FF+  + +  + GG L E L +L R L D   +K K+++L+ E + 
Sbjct: 193 LEQACYRLPYASFHFFTVALILNQENGGQLREVLHSLGRTLHDNGAIKMKIKSLTAEPRM 252

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +A I+ SLP  + ++++F +P    VL N   GH +L    + + +G+ ++ ++    
Sbjct: 253 TALILASLPLILISIMFFKNPTSFAVLTNTQTGHHVLVYVVSSIALGLGIINMLTKVR 310


>gi|226196404|ref|ZP_03791986.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225931621|gb|EEH27626.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 316

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 131 LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 190

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 191 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 250

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 251 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 310

Query: 181 LMINFD 186
            +    
Sbjct: 311 RLARLR 316


>gi|317403409|gb|EFV83922.1| hypothetical protein HMPREF0005_02048 [Achromobacter xylosoxidans
           C54]
          Length = 281

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 92/176 (52%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F    P AL ++  ++RAG+ +  A+  +V Q   P+  EF  ++  Q LG+   E+++R
Sbjct: 106 FEQQLPMALLMLASALRAGVALMPALRQVVAQGGAPLAQEFGLMLREQRLGVPWDEALAR 165

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           +   M  +  +     +    Q GGNL+EAL ++++ L  R  ++A+++ L+ + +  AW
Sbjct: 166 LNTRMTAESTTLMVAAMRTAVQTGGNLAEALDSIAQTLFARLQLQARLRTLTAQGRMQAW 225

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           I+G+LP  +   +    P  M  L + P G  +L V       G++++R ++  D+
Sbjct: 226 IVGALPVLLLIALDRLEPDIMMPLWHTPAGWTVLAVLGGLETAGVLLIRRIVRIDI 281


>gi|318604218|emb|CBY25716.1| flp pilus assembly protein TadB [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 293

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/183 (24%), Positives = 82/183 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K+    F  +FP +L +I  +  +G  ++  +     + S P+  EF  V    +
Sbjct: 107 LRLSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLN 166

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S         R     E  F  T+I +  Q GG L E  + LS ++   K  + K  
Sbjct: 167 VGESPESVFYDSYRRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKA 226

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R
Sbjct: 227 VMTAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIR 286

Query: 181 LMI 183
            M+
Sbjct: 287 KML 289


>gi|330862290|emb|CBX72451.1| hypothetical protein YEW_HH31830 [Yersinia enterocolitica W22703]
          Length = 293

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/183 (23%), Positives = 82/183 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K+    F  +FP +L +I  +  +G  ++  +     + S P+  EF  V    +
Sbjct: 107 LRLSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLN 166

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K  
Sbjct: 167 VGESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKA 226

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R
Sbjct: 227 VMTAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIR 286

Query: 181 LMI 183
            M+
Sbjct: 287 KML 289


>gi|89100215|ref|ZP_01173082.1| putative integral membrane protein [Bacillus sp. NRRL B-14911]
 gi|89085065|gb|EAR64199.1| putative integral membrane protein [Bacillus sp. NRRL B-14911]
          Length = 308

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 96/184 (52%), Gaps = 1/184 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              K T +  +    A  ++  + ++G+ ++  + V+  + + P R EF+ + +   LGL
Sbjct: 126 RKNKYTEQLNNQLSEACRLLGNATKSGMTITQGLEVVASEINSPAREEFKVLTQNLRLGL 185

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
               +++ M + +  +E   F + + +Q + GGNL++ L  +++ L +RK ++  ++  +
Sbjct: 186 DFERALAEMEKRIKTREYKLFISALMIQKRSGGNLTKVLYEMAQTLEERKILRQTIKTAT 245

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E +  ++I+ ++P  +  ++     G+++++   P G +L+ +    M + ++++R + 
Sbjct: 246 AEQRFVSYILPAMPIFLLFMLNNIMDGFIDLIFTVP-GAILMTIFIIGMAVALILVRAVT 304

Query: 184 NFDV 187
           N  V
Sbjct: 305 NIKV 308


>gi|167919155|ref|ZP_02506246.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
          Length = 256

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 71  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 130

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 131 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 190

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 191 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 250

Query: 181 LMINFD 186
            +    
Sbjct: 251 RLARLR 256


>gi|325275752|ref|ZP_08141630.1| type II secretion system protein [Pseudomonas sp. TJI-51]
 gi|324099112|gb|EGB97080.1| type II secretion system protein [Pseudomonas sp. TJI-51]
          Length = 293

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 98/184 (53%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++     ++  P  LD  VRS++AG  ++DAV   +  S +P+R+   RV     
Sbjct: 108 ISWQSRRHMRHVVEQLPGLLDYSVRSLKAGRTLNDAVLGAIDSSREPLRTTLARVRRNVQ 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L ++++ +       E+  F+  + +  + GGN SE + NL +++R+R+    +++
Sbjct: 168 LGVPLEDAMTELAELHQQDELRLFALGLRINQRHGGNASELMENLIKLIREREQGARQLK 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A I+G+LP  +       +P Y+  +  D  G ++L +A A  ++G +V+ 
Sbjct: 228 AMTGETRITAIILGALPLAMVGYFLLANPHYLLAMWRDSSGQLMLLLAFALQVLGCLVLW 287

Query: 181 LMIN 184
            M+ 
Sbjct: 288 RMMR 291


>gi|167587312|ref|ZP_02379700.1| type II secretion system protein [Burkholderia ubonensis Bu]
          Length = 261

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 76  LVSRIHRRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQAALLTTEAPLRGCLDVVSRMLR 135

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 136 TGVEIDRAMVHIAKVYHTREFELVGSVLRLSVRYGGRADVMLERMAVFMRDLEQAERELV 195

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  +   V  T+P Y++ + ND  G   L +A    + G   + 
Sbjct: 196 AMSSETRLSAWVLVMLPIAIGGFVIATNPSYLSSMWNDDSGRAYLYLAFIMQIAGGAWLY 255

Query: 181 LMINFD 186
            M    
Sbjct: 256 RMSRLR 261


>gi|317124420|ref|YP_004098532.1| type II secretion system F domain [Intrasporangium calvum DSM
           43043]
 gi|315588508|gb|ADU47805.1| Type II secretion system F domain [Intrasporangium calvum DSM
           43043]
          Length = 291

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 75/186 (40%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   +KR  K  D +P+A+D I   VRAGL + +A+A +  +  + +R  F R  E   
Sbjct: 100 IRMRARKRRGKLRDLWPDAVDNITSGVRAGLALPEALAQLAVRGPEELRPPFARFAEDYR 159

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
                 + + R+   M           + +  +  G +L   L  LS  LR+    +A++
Sbjct: 160 ATGRFHDCLDRLKDAMSDPVADRLIESLRIAREVGGSDLGRLLRTLSAFLREDARTRAEL 219

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  ++              P G ++L   A   ++   +M
Sbjct: 220 EARQSWTINAARLAVAAPWVVLAMLALRGGSLQA--YATPTGWLVLAFGAGLCIVAYRLM 277

Query: 180 RLMINF 185
             +   
Sbjct: 278 VWIGRL 283


>gi|226310158|ref|YP_002770052.1| hypothetical protein BBR47_05710 [Brevibacillus brevis NBRC 100599]
 gi|226093106|dbj|BAH41548.1| conserved hypothetical membrane protein [Brevibacillus brevis NBRC
           100599]
          Length = 306

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 90/184 (48%), Gaps = 1/184 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              K   +  +       ++  S+RAGL +S  ++++  + + P   EF R+     LG+
Sbjct: 124 RRNKYQERLNEQLSEVCRLLANSLRAGLTLSQGISLVAKEMNYPAGDEFSRMARELQLGV 183

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S   ++S M + +P +E   F+  + +Q + GGNLS+ L  ++  L DR+ +  +++ ++
Sbjct: 184 SFDRALSDMEKRIPTREFRIFTATLLIQRRAGGNLSQVLQEMAETLEDRRIVNQEIKTMT 243

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E +  + ++  +P  +  ++   + G+++ L +     +L        L+  ++++ + 
Sbjct: 244 AEQRYVSILVPIMPVALVLMMNTMNKGFIDPLFSGFGLFLLGLFVIG-TLLSYILVKKVT 302

Query: 184 NFDV 187
           N  V
Sbjct: 303 NIKV 306


>gi|117620900|ref|YP_855995.1| Flp pilus assembly protein TadB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562307|gb|ABK39255.1| Flp pilus assembly protein TadB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 294

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 95/184 (51%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           + L ++   +F    P  +D ++R++R G P++D   ++  Q    +   F ++ +   +
Sbjct: 109 QQLQQRALEQFRTRLPEVIDGMIRALRVGAPLADIFLLVARQQRGLMSRLFAQMHDELQV 168

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  +++ + +    + + E  F + V+S+Q + GG LSE LA L   LR R+ + A +Q 
Sbjct: 169 GQPVAQVMQQAAGRVAVAEFQFLTIVLSLQQETGGRLSEVLAQLVETLRARQTLAASIQT 228

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ E++ +A ++ +LP  +  +++ T   +   L+    G  +LG  +  + +G+ ++R 
Sbjct: 229 ITAESRNAAKVLAALPVIILLVLFTTGREHFTYLMTTTSGQWVLGYVSISVAVGLWLIRR 288

Query: 182 MINF 185
           +   
Sbjct: 289 LTRL 292


>gi|260778158|ref|ZP_05887051.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606171|gb|EEX32456.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 301

 Score = 94.8 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 83/181 (45%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             KK+  +F  +    L ++ R+V AGL V  A+  +    +  +  EF  + +   LG+
Sbjct: 116 RRKKQIEEFDTNIVQVLGLVSRAVSAGLSVPQAIEQVANSQTGLLGREFALITDNLALGI 175

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           SL +++      +P +   +FS  + +    GG L E L NLSR + D + M  KV++++
Sbjct: 176 SLRQTLDEACTRLPYRTFRYFSVALILNQSNGGQLREILHNLSRTMHDNRAMLKKVKSMT 235

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +A  +  LP  +  +V +       +L+    G  +L   AA +  G   +  + 
Sbjct: 236 AEPRMTAKFLSLLPLILVAVVAWIDVSLFELLVYTESGQSILIYCAASIAFGGFTLHSLT 295

Query: 184 N 184
            
Sbjct: 296 K 296


>gi|225386975|ref|ZP_03756739.1| hypothetical protein CLOSTASPAR_00725 [Clostridium asparagiforme
           DSM 15981]
 gi|225046987|gb|EEG57233.1| hypothetical protein CLOSTASPAR_00725 [Clostridium asparagiforme
           DSM 15981]
          Length = 308

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 87/190 (45%), Gaps = 6/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRRVIE 57
           L ++R  +   +F + + ++   + AG  + +AVA    +      +   +  EF  +  
Sbjct: 119 LKRQRLCRLNLEFKDGILVLASFLSAGYSIENAVAASGRELTLLYGADGLMAGEFEEMAR 178

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              L  ++      +     L++V+ F+ V +   + GG+L E +++ + ++RD+  ++ 
Sbjct: 179 GLRLNRTVESVFLDLGGRSGLEDVNNFAQVFAAAKRSGGDLVEIISHTAGVIRDKVQVQE 238

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++  ++        I+  +P  +   +  TSPG+ +++     G +++    A   I ++
Sbjct: 239 EIHTMTASKAFEQKIMSLVPVLIVLYIDLTSPGFFDIMYRTMAGRLVMSGCLAVYGISLL 298

Query: 178 VMRLMINFDV 187
           + R ++  ++
Sbjct: 299 LARRILQVEI 308


>gi|320158387|ref|YP_004190765.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|319933699|gb|ADV88562.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 305

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G
Sbjct: 120 KLQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL
Sbjct: 180 EDPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  +
Sbjct: 240 TSEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFICIWFI 299

Query: 183 IN 184
           + 
Sbjct: 300 LR 301


>gi|170701755|ref|ZP_02892691.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
 gi|170133338|gb|EDT01730.1| type II secretion system protein [Burkholderia ambifaria IOP40-10]
          Length = 327

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R    +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 142 LVSRIHRRRQMIVRQLPSFLDGIVRLVTLGNSVPAAFQAALQTTEAPLRGCLDHVSRMLR 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +      +E     +V+ +  + GG     L  +S  +RD +  + +++
Sbjct: 202 TGVEIDRAMMHIANVYHTKEFELVGSVLRLSVRYGGRADIMLDRMSTFMRDLEQAERELE 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  + + V  T+P Y+  + ND  G  LL +A      G + + 
Sbjct: 262 AMSSETRLSAWVLVMLPIAIGSFVIATNPLYLQSMWNDYTGRQLLVLAFMLQAAGGIWLY 321

Query: 181 LMINFD 186
            M    
Sbjct: 322 HMAKLR 327


>gi|115351459|ref|YP_773298.1| type II secretion system protein [Burkholderia ambifaria AMMD]
 gi|115281447|gb|ABI86964.1| type II secretion system protein [Burkholderia ambifaria AMMD]
          Length = 322

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 80/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R    +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 137 LVSRIHRRRQMIVRQLPSFLDGIVRLVTLGNSVPAAFQAALQTTEAPLRGCLDHVSRMLR 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +      +E     +V+ +  + GG     L  +S  +RD +  + +++
Sbjct: 197 TGVEIDRAMMHIANVYHTKEFELVGSVLRLSVRYGGRADIMLDRMSTFMRDLEQAERELE 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  LP  + + V  T+P Y+  + ND  G  LL +A      G + + 
Sbjct: 257 AMSSETRLSAWVLVMLPIAIGSFVIATNPLYLQSMWNDYTGRQLLVLAFMLQAAGGIWLY 316

Query: 181 LMINFD 186
            M    
Sbjct: 317 HMAKLR 322


>gi|162147494|ref|YP_001601955.1| type II secretion system protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786071|emb|CAP55653.1| putative type II secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 319

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 58/179 (32%), Positives = 108/179 (60%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++  AK     P+AL +IVRS+R G+P+S A+ ++  ++  P   EFR + +   +G +L
Sbjct: 137 RRYAAKLFQQLPDALGMIVRSLRVGIPLSRALIIVGQEAEYPTADEFRMISQDVAVGKNL 196

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            +++  +     LQE  FF+T++++Q+Q GG L++ LA+ + ++R R   + +  AL+ E
Sbjct: 197 GDTLHNLAERTGLQEYRFFATIMALQAQTGGTLADVLASFADMIRQRIAARKRGHALASE 256

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           A+ S +++G +PF +  ++   +P YM V +    GHMLLGV+A  + +G   MR ++ 
Sbjct: 257 ARMSCYVLGGIPFAIGGIMSIINPDYMAVFLTTHMGHMLLGVSALMLGLGFGSMRFIMK 315


>gi|323486496|ref|ZP_08091819.1| hypothetical protein HMPREF9474_03570 [Clostridium symbiosum
           WAL-14163]
 gi|323400199|gb|EGA92574.1| hypothetical protein HMPREF9474_03570 [Clostridium symbiosum
           WAL-14163]
          Length = 257

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 79/191 (41%), Gaps = 6/191 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
           K L  +R  +    F  A+ I+  S+ AG  V +A A  + +          +  EF  +
Sbjct: 66  KELALQRQEELRRQFKEAVLILSSSLGAGYSVENAFAGSLRELEELYGREGMITKEFSYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                +  ++   ++       L+E+  FS + +V  +  G L   + +   ++ DR  +
Sbjct: 126 AHQLRMNRTVETLLAEFADRSGLEEIKNFSDIFAVSKRSRGELVSVVNHTVHVISDRLQV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  ++ E +    I+  +P+C+   + F+SPG+   +     G +++          
Sbjct: 186 REEILTMTAEKQFEQKIMNLVPYCIVIYIEFSSPGFFRQMYGTAAGRVVMTGCLLIYCAS 245

Query: 176 IMVMRLMINFD 186
             +   +++ +
Sbjct: 246 CFLAFKILDIE 256


>gi|323694363|ref|ZP_08108536.1| hypothetical protein HMPREF9475_03400 [Clostridium symbiosum
           WAL-14673]
 gi|323501603|gb|EGB17492.1| hypothetical protein HMPREF9475_03400 [Clostridium symbiosum
           WAL-14673]
          Length = 257

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 79/191 (41%), Gaps = 6/191 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
           K L  +R  +    F  A+ I+  S+ AG  V +A A  + +          +  EF  +
Sbjct: 66  KELALQRQEELRRQFKEAVLILSSSLGAGYSVENAFAGSLRELEELYGREGMITKEFSYI 125

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                +  ++   ++       L+E+  FS + +V  +  G L   + +   ++ DR  +
Sbjct: 126 AHQLRMNRTVETLLAEFADRSGLEEIKNFSDIFAVSKRSRGELVSVVNHTVHVISDRLQV 185

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  ++ E +    I+  +P+C+   + F+SPG+   +     G +++          
Sbjct: 186 REEILTMTAEKQFEQKIMNLVPYCIVIYIEFSSPGFFRQMYGTAAGRVVMTGCLLIYCAS 245

Query: 176 IMVMRLMINFD 186
             +   +++ +
Sbjct: 246 CFLSFKILDIE 256


>gi|37676257|ref|NP_936653.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|37200798|dbj|BAC96623.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
          Length = 305

 Score = 94.8 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G
Sbjct: 120 KLQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL
Sbjct: 180 EDPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  +
Sbjct: 240 TSEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFVCIWFI 299

Query: 183 IN 184
           + 
Sbjct: 300 LR 301


>gi|326424176|ref|NP_762075.2| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|319999559|gb|AAO07065.2| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
          Length = 305

 Score = 94.8 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 90/182 (49%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
            L + + AKF +DFP+AL+I+  ++ +G  +  A   +  Q  + V  +F+ + E   +G
Sbjct: 120 KLQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMG 179

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
               + +SR     P  E  FF+  I +    GG L E ++ ++RI+ + + +  K  AL
Sbjct: 180 EDPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNAL 239

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + EA+ SA II  LP     ++ FTSP   N ++ +  G  +        +IG + +  +
Sbjct: 240 TSEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFICIWFI 299

Query: 183 IN 184
           + 
Sbjct: 300 LR 301


>gi|134295598|ref|YP_001119333.1| type II secretion system protein [Burkholderia vietnamiensis G4]
 gi|134138755|gb|ABO54498.1| type II secretion system protein [Burkholderia vietnamiensis G4]
          Length = 324

 Score = 94.8 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +    +P+R     V     
Sbjct: 139 LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTCEEPLRGCLDHVSRMLR 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 199 SGVEIDRAMLHVAKVYRTKEFELLGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y+  + NDP G  LL +A    + G + + 
Sbjct: 259 AMSAETRLSAFVLVMLPIAIGSFVVMTNPRYLEGMWNDPSGRTLLMLAFLAQVAGSLWLY 318

Query: 181 LMINFD 186
            M    
Sbjct: 319 RMARLR 324


>gi|33601082|ref|NP_888642.1| hypothetical protein BB2099 [Bordetella bronchiseptica RB50]
 gi|33575517|emb|CAE32595.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 281

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 88/171 (51%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R +
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRV 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           P  +  ++    P  M  L +   G   L +       GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALWHTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|15602713|ref|NP_245785.1| hypothetical protein PM0848 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721157|gb|AAK02932.1| TadB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 291

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 76/178 (42%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +    F   FP  + I+  +   G  +  ++       +  +  EF+ + +   LG    
Sbjct: 111 RNQKMFNAMFPEVIQIMNAAATGGAGLLQSLERCGKDLTGQLGEEFKAIHKRLALGEDPM 170

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
                     P +E  FF T+I      GG + E +  L R++ D K M+ K +A++ EA
Sbjct: 171 SVFEDSYSRYPYKEFYFFITIIRTNLSKGGQIREVITRLGRVIADSKKMEQKKKAMTSEA 230

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           + SA+I+ S P      + F  P   + L+NDP G  +L         G++++  ++ 
Sbjct: 231 RMSAFIVASFPIAFFLFMQFAMPENFDFLLNDPSGRYVLYYVFGSEAFGMLIIWWLMR 288


>gi|187923648|ref|YP_001895290.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
 gi|187714842|gb|ACD16066.1| type II secretion system protein [Burkholderia phytofirmans PsJN]
          Length = 342

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   + KR  + +   P  LD IVR +  G  V  A    +  +  P+R     V     
Sbjct: 156 LTMRVNKRRQQIVRQLPLFLDGIVRLITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLR 215

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++S++ +   ++E+     V+ +  + GG     L  ++  +RD ++ + ++ 
Sbjct: 216 TGVEIDRALSQVAQIYGVRELELVGAVLRLSVKYGGRADVMLERMASFMRDLEHAERELV 275

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + S+W++  LP  +   +  ++P Y   +  DP G  L+ +A    ++G  ++ 
Sbjct: 276 AMSSETRLSSWVLAMLPIGIGGFLILSNPKYFASMWFDPTGRQLVYLAFVLQVLGAYLLY 335

Query: 181 LMINFD 186
            + N  
Sbjct: 336 RLANLR 341


>gi|153950598|ref|YP_001399591.1| type II secretion system protein F domain [Yersinia
           pseudotuberculosis IP 31758]
 gi|152962093|gb|ABS49554.1| type II secretion system protein F domain protein [Yersinia
           pseudotuberculosis IP 31758]
          Length = 291

 Score = 94.4 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 76/183 (41%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI ++R
Sbjct: 225 VMTAQIRMSVNIISIMPILFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGIFIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|262275465|ref|ZP_06053275.1| flp pilus assembly protein TadB [Grimontia hollisae CIP 101886]
 gi|262220710|gb|EEY72025.1| flp pilus assembly protein TadB [Grimontia hollisae CIP 101886]
          Length = 308

 Score = 94.4 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 93/185 (50%), Gaps = 1/185 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++++  +    F  +FP+AL+++  SV AG  +  A+  +     + V  EF+R+ E  +
Sbjct: 121 IRYMDIRTQNAFERNFPDALNMVASSVTAGESLLHAIQYVGSHLDNIVGREFKRMGERLN 180

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S      +  +  P     FF   + V    GG L   +  L+R+L + ++++ K +
Sbjct: 181 IGESTDAVFRKACQRFPTPAFQFFVIAMRVNVNRGGQLRHVIGRLNRVLFNARSIEMKKR 240

Query: 121 ALSMEAKASAWIIGSLPFCVST-LVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           A++ EA+ S++I+ ++PF     ++   SP   + ++NDP G  LL        IG+ ++
Sbjct: 241 AMTAEARMSSYIVCAIPFIFLFGVLRVLSPENYDFVMNDPGGRYLLYYMLTSEAIGMGIV 300

Query: 180 RLMIN 184
             ++ 
Sbjct: 301 FWLMR 305


>gi|257483344|ref|ZP_05637385.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298488956|ref|ZP_07006979.1| Flp pilus assembly protein TadB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156454|gb|EFH97551.1| Flp pilus assembly protein TadB [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322733|gb|EFW78826.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330482|gb|EFW86461.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330887978|gb|EGH20639.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330989173|gb|EGH87276.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012563|gb|EGH92619.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 294

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+ 
Sbjct: 229 AMTGETRMTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|303238718|ref|ZP_07325251.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302593837|gb|EFL63552.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 264

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 86/193 (44%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ-------SSDPVRSEFRR 54
           K +I+KR  +    F + L  +  S+ AG  +  +   ++         S+  +  E   
Sbjct: 72  KEIIEKRKNELNLQFRDMLYSLSSSLSAGKSIESSFKEVLKDLSIIYPDSNSFIIKEVEY 131

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    +  ++  ++        L+++  F  V+    + GGN+ + + N S I+ D+  
Sbjct: 132 IVRKIEMNETIESALEDFAARSHLEDIENFVDVLQTSKRTGGNIVDIIKNSSNIISDKIE 191

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  L    K    I+  +P  +   +  ++  YM  + +D RG +++ ++ A ++I
Sbjct: 192 VKEEIDTLLASRKFEQKILALMPVMLILFLSLSTGDYMYPVFHDLRGRLVMTLSLALIII 251

Query: 175 GIMVMRLMINFDV 187
              + + ++N  V
Sbjct: 252 AYFISKKIMNIKV 264


>gi|315650391|ref|ZP_07903462.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315487318|gb|EFU77629.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 269

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 89/192 (46%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K LI ++  + L +F  A+ I+   + AG  + ++V   + +        + +  EF  +
Sbjct: 78  KELIVEKKRRLLIEFKEAVMILSSLLNAGYSLENSVKEALVELRLLYVKDNLIIKEFEYI 137

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +  ++ +S+  +   +      +++  F+ V+ +  + GG L   +A+   ++ D+  +
Sbjct: 138 CQLIYMNISVERAFDDLAYRSHCEDIRSFAKVLRIAKRSGGELESIIAHTVSVIGDKVRI 197

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  ++   +    ++  LP  +   + F+SPG+ N++     G M + V     L  
Sbjct: 198 KEEIITMTAAKRFEQKVMNILPLLIVLYIDFSSPGFFNIMYTTIIGRMCMSVGLTVYLFA 257

Query: 176 IMVMRLMINFDV 187
           I + + ++N +V
Sbjct: 258 IYISKRLLNIEV 269


>gi|331014705|gb|EGH94761.1| hypothetical protein PLA106_02335 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 295

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 95/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 110 VSWRYERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQ 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL +++          E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 170 LGVSLPDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++G LP  ++      +P Y+  + +D  G ++L +A    ++G +++ 
Sbjct: 230 AMTGETRMTAIVLGLLPVSMAGYFLAVNPDYLLQMWSDDSGRIMLSMAFGLQILGCLMLW 289

Query: 181 LMIN 184
            M+ 
Sbjct: 290 RMLR 293


>gi|210614118|ref|ZP_03290054.1| hypothetical protein CLONEX_02267 [Clostridium nexile DSM 1787]
 gi|210150819|gb|EEA81827.1| hypothetical protein CLONEX_02267 [Clostridium nexile DSM 1787]
          Length = 220

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 86/192 (44%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K  I+KR   F   F  A+  +  ++  G  V +A+   +          + +  EFR +
Sbjct: 29  KQWIEKRKNVFQLQFKEAVQSLATALNVGYSVENAMREALKDLQIIYKKDELIVREFRYM 88

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           +    + +++ + +    +    ++V  F TV  +  + GG++   + N  + + ++ ++
Sbjct: 89  VRQLDVNVTMEKVLQEFSQRTGEEDVQTFVTVFVMAKRSGGDMIAIIRNTVQQMSEKADI 148

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  +    K    ++ ++PF +   + F+ P +M VL  +  G +++ +     +I 
Sbjct: 149 RREIGTIIASKKLEFKVMSAIPFGMICYMKFSFPEFMGVLYGNAAGVVIMTICFLGYVIA 208

Query: 176 IMVMRLMINFDV 187
             + + ++  +V
Sbjct: 209 YEIGKRIVEIEV 220


>gi|330969403|gb|EGH69469.1| type II secretion system protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 294

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+ 
Sbjct: 229 AMTGETRMTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|283777929|ref|YP_003368684.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283436382|gb|ADB14824.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 318

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 52/175 (29%), Positives = 92/175 (52%), Gaps = 3/175 (1%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
                P+A D++ R++RAG  V  A  VI    + P++ EF    E QHLG+    ++  
Sbjct: 146 LARQLPDAFDVMSRALRAGQTVPAAFQVIATDFNSPLKEEFAHCYEQQHLGIERDVALRD 205

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           + R   + E+  F   + +  + GGNL+E L NL+ +LR R  +  +++AL+ E +  A 
Sbjct: 206 LARRTSVMELQIFVVALIMHGKTGGNLAELLGNLALLLRKRGKLHDRIRALTGEGRMQAV 265

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           ++ +LP  +  ++Y  +  Y  VL++ P   MLL       LIG + +R +I+ +
Sbjct: 266 VLIALPAVIFGVMYVMNREYAQVLLDRP---MLLIGCGISQLIGALCIRKIIDIE 317


>gi|302185192|ref|ZP_07261865.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           642]
          Length = 294

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+ 
Sbjct: 229 AMTGETRMTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|167816006|ref|ZP_02447686.1| type II secretion system protein [Burkholderia pseudomallei 91]
          Length = 206

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 21  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 80

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 81  SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 140

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 141 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 200

Query: 181 LMINFD 186
            +    
Sbjct: 201 RLARLR 206


>gi|325518468|gb|EGC98167.1| type II secretion system protein [Burkholderia sp. TJI49]
          Length = 257

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 72  LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQAALLTTEEPLRGCLDHVSRMLR 131

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 132 TGVEIDRAMLHIAKIYRTEEFELLGSVLRLSVKYGGRADVMLERMAIFMRDLEQAERELT 191

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y+  + ND  G +LL  A    L G + + 
Sbjct: 192 AMSAETRLSAFVLVMLPIAIGSFVVMTNPTYLQGMWNDSLGRLLLMFAFLMQLAGSVWLY 251

Query: 181 LMINFD 186
            M    
Sbjct: 252 RMARLR 257


>gi|71733377|ref|YP_276553.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71553930|gb|AAZ33141.1| type II secretion system protein F domain protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 294

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLQGIEATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+ 
Sbjct: 229 AMTGETRMTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|330895622|gb|EGH27929.1| type II secretion system protein [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 293

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 108 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 167

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 168 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 227

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + +D  G ++L  A A    G +V+ 
Sbjct: 228 AMTGETRMTAVVLALLPISMAGYFLAVNPNYLLHMWDDESGKIMLSAAFALQATGCVVLW 287

Query: 181 LMIN 184
            M+ 
Sbjct: 288 RMLR 291


>gi|331086802|ref|ZP_08335879.1| hypothetical protein HMPREF0987_02182 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330409968|gb|EGG89403.1| hypothetical protein HMPREF0987_02182 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 251

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 76/192 (39%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K  IKK+  +F   F  +L  +  ++  G    +A+                +  E+  +
Sbjct: 60  KQYIKKQQQEFCAQFKMSLQSMSSALNVGYSAENALKETAKDLSLIYKKDTRIMREYTYM 119

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           I   ++ + L +        +  ++VS F +V     + GG+  E + N  + + ++  +
Sbjct: 120 IHQLNMNVPLEQIWKEFADRVGQEDVSNFVSVFVAAKRAGGDSIEMIRNAVKQICEKIEV 179

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +++      K    ++  +PF +   +    P ++ VL  +  G  ++ V  A     
Sbjct: 180 KREIEMTMSAKKLEFQVMSVVPFGIIFYMRIAFPDFVEVLYRNFLGIFVMTVCLAVYAGA 239

Query: 176 IMVMRLMINFDV 187
             + + MI  +V
Sbjct: 240 FYMGKRMIEIEV 251


>gi|167719784|ref|ZP_02403020.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 220

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 35  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 94

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 95  SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 154

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 155 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 214

Query: 181 LMINFD 186
            +    
Sbjct: 215 RLARLR 220


>gi|283778865|ref|YP_003369620.1| type II secretion system protein [Pirellula staleyi DSM 6068]
 gi|283437318|gb|ADB15760.1| type II secretion system protein [Pirellula staleyi DSM 6068]
          Length = 300

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 84/178 (47%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R        P AL  +  +VR+G  +S+A  ++  +   P+  EF    +   LG +   
Sbjct: 121 RVGTMQKQMPQALQAVADAVRSGQTLSEACQLVSKEIKGPLGQEFAYAHQQLELGHAPVS 180

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
            ++RM   +PL E   F+T + V  + GGNLS     +S   RDR++++  + A++  ++
Sbjct: 181 VMNRMATRVPLTEFRVFATAVVVHRRAGGNLSLLTERMSHSARDRQDVRNHLMAVTSGSR 240

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            SA+ +          + +  P Y+   + +P+G  LL +A    ++G + +  ++  
Sbjct: 241 LSAFGMVLGGIIAVAFLTWLEPDYVRAFLENPKGPWLLFIAFMLQVVGAIWVWRILKV 298


>gi|325963897|ref|YP_004241803.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469984|gb|ADX73669.1| Flp pilus assembly protein TadB [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 285

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 78/183 (42%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   KKR+A     +P+ +D +  ++RAGLP+ +A+  +  +  + +R  FR       
Sbjct: 94  LRWRAKKRSALLRQLWPDVVDHLRSAIRAGLPLPEALIQLGDKGPEELRHVFRDFGADYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G     S++++   +           + +  +  G +L + L  L+  LR+    ++++
Sbjct: 154 AGGQFDASLNKLKHRLADPVADRIVEALRLTREVGGSDLGKLLGTLAEFLRESARTRSEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  L+  T P  +    N   G  +L       L+   +M
Sbjct: 214 EARQSWTINAARLAVAAPWIVMILL-ATRPEAVQA-YNTAAGAAVLVGGLVVSLVCYSIM 271

Query: 180 RLM 182
             +
Sbjct: 272 LRI 274


>gi|22127362|ref|NP_670785.1| hypothetical protein y3488 [Yersinia pestis KIM 10]
 gi|21960447|gb|AAM87036.1|AE013952_3 hypothetical [Yersinia pestis KIM 10]
          Length = 270

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 84  LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 143

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 144 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 203

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 204 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 263

Query: 181 LMI 183
            M+
Sbjct: 264 KML 266


>gi|217423568|ref|ZP_03455069.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|217393426|gb|EEC33447.1| type II secretion system protein [Burkholderia pseudomallei 576]
          Length = 237

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 52  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 111

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 112 SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 171

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 172 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 231

Query: 181 LMINFD 186
            +    
Sbjct: 232 RLARLR 237


>gi|167738782|ref|ZP_02411556.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167824381|ref|ZP_02455852.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167911132|ref|ZP_02498223.1| type II secretion system protein [Burkholderia pseudomallei 112]
          Length = 211

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 26  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 85

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 86  SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 145

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 146 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 205

Query: 181 LMINFD 186
            +    
Sbjct: 206 RLARLR 211


>gi|149909166|ref|ZP_01897823.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
 gi|149807690|gb|EDM67636.1| TadB-like protein involved in pilus formation and/or
           proteinsecretion [Moritella sp. PE36]
          Length = 311

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 93/183 (50%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           +  ++  +F   F   L  + R+V AG+ V  A+A I       +  EF  + +   +G+
Sbjct: 128 MRTRQHREFDAAFTQVLGQMSRAVSAGISVPQAIAQIADYQQGMLGREFSLIRDKLEIGI 187

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L +++++    +P     FFS  + +  + GG L E L +LSR + D   +K K+++L+
Sbjct: 188 GLKQALNQASIRLPYVSFHFFSVALILNEENGGQLREVLHSLSRTVHDNAAIKMKIRSLT 247

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +A I+ SLP  +  ++YF +P     L   PRGH++LG     M +G+ ++ L+ 
Sbjct: 248 AEPRMTAAILASLPILLIGVMYFKNPSAFITLTQSPRGHLVLGYVVTSMALGMAIIHLLT 307

Query: 184 NFD 186
              
Sbjct: 308 KVR 310


>gi|167836790|ref|ZP_02463673.1| hypothetical protein Bpse38_09905 [Burkholderia thailandensis
           MSMB43]
          Length = 221

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 36  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 95

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 96  SGVEIDRAMVYVATLYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 155

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 156 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPMGRQLVYLAFILQVAGGYWLY 215

Query: 181 LMINFD 186
            +    
Sbjct: 216 RLARLR 221


>gi|167894488|ref|ZP_02481890.1| type II secretion system protein [Burkholderia pseudomallei 7894]
          Length = 215

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 30  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 89

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 90  SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 149

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 150 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 209

Query: 181 LMINFD 186
            +    
Sbjct: 210 RLARLR 215


>gi|166033070|ref|ZP_02235899.1| hypothetical protein DORFOR_02792 [Dorea formicigenerans ATCC
           27755]
 gi|166027427|gb|EDR46184.1| hypothetical protein DORFOR_02792 [Dorea formicigenerans ATCC
           27755]
          Length = 230

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 76/193 (39%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRR 54
           +   IK++  +FL  F   +      +  G  V +AV   + +          +  E   
Sbjct: 38  LDECIKRKEQEFLVQFKELIQTFSSLLNTGYSVENAVKESLKEMQIFYSDDAAILRELEI 97

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + + + +++  +     L +V  F+ V     + GGNL   + N +  + D+ +
Sbjct: 98  MVRQIRVQVPVEQAVEELSERTKLPDVESFAGVFVTAKRSGGNLMSIIRNTADQIGDKID 157

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  +    K    ++  +PF +   +  + P +M  L  +  G  ++       L 
Sbjct: 158 VKREIDTMLAAKKYEFQVMSVIPFGIVLYMTVSFPEFMGNLYGNIAGRGVMTGCLIIYLG 217

Query: 175 GIMVMRLMINFDV 187
              + R +I  +V
Sbjct: 218 AYGLGRKIIEIEV 230


>gi|325663220|ref|ZP_08151670.1| hypothetical protein HMPREF0490_02411 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470674|gb|EGC73904.1| hypothetical protein HMPREF0490_02411 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 251

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 76/192 (39%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K  IKK+  +F   F  +L  +  ++  G    +A+                +  E+  +
Sbjct: 60  KQYIKKQQQEFCAQFKMSLQSMSSALNVGYSAENALKETAKDLSLIYKKDTRIMREYTYM 119

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           I   ++ + L +        +  ++VS F +V     + GG+  E + N  + + ++  +
Sbjct: 120 IHQLNMNVPLEQIWKEFADRVGQEDVSNFVSVFVAAKRAGGDSIEMIRNAVKQICEKIEV 179

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +++      K    ++  +PF +   +    P ++ VL  +  G  ++ V  A     
Sbjct: 180 KREIEMTMSAKKLEFQVMSVVPFGIIFYMRIAFPDFVEVLYRNFLGIFVMTVCLAVYAGA 239

Query: 176 IMVMRLMINFDV 187
             + + MI  +V
Sbjct: 240 FYMGKKMIEIEV 251


>gi|289625309|ref|ZP_06458263.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647834|ref|ZP_06479177.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330867143|gb|EGH01852.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330871031|gb|EGH05740.1| type II secretion system, protein F domain [Pseudomonas syringae
           pv. aesculi str. 0893_23]
          Length = 294

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 90/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+ 
Sbjct: 229 AMTGETRMTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|168699470|ref|ZP_02731747.1| hypothetical protein GobsU_08112 [Gemmata obscuriglobus UQM 2246]
          Length = 330

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 3/177 (1%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            K+L     A +++ R +R G  V++A    VG   DP+  EF R +     G+    + 
Sbjct: 156 EKYLRQIAGAFELMARVIRTGQSVTEAFRAAVGAFDDPLAEEFGRCVHQIEHGIRPEAAF 215

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
             M     + E+  F   +++Q Q GGNLSE L  L+ ++R R  ++ K++AL+ E +  
Sbjct: 216 REMSDRADVLELRIFVVAMTIQRQTGGNLSEVLDRLAGVVRARLRVRQKIRALTAEGRMQ 275

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           +  +  LP  V  ++YF +  Y   L+       LL      + +G + +R ++NF+
Sbjct: 276 SRTLTVLPVVVFAMMYFLNRPYAEGLLAQ---WRLLLGTVTCVAVGTLWIRNIMNFE 329


>gi|167845913|ref|ZP_02471421.1| type II secretion system protein [Burkholderia pseudomallei B7210]
          Length = 216

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 84/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++KR  + +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 31  LVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQTTEAPLRGCLDHVSRMLR 90

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 91  SGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVMLDRMAVFMRDLEQAERELV 150

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++G+LP  + + V  T+P Y + +  DP G  L+ +A    + G   + 
Sbjct: 151 AMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTGRQLVYLAFILQIAGGYWLY 210

Query: 181 LMINFD 186
            +    
Sbjct: 211 RLARLR 216


>gi|123443824|ref|YP_001007795.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090785|emb|CAL13667.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 280

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 81/182 (44%), Gaps = 1/182 (0%)

Query: 3   HLIKKRTAKFLDD-FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            L +KR  +F    FP +L +I  +  +G  ++  +     + S P+  EF  V    ++
Sbjct: 95  RLSRKRYHRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGIEFNLVCRRLNV 154

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K   
Sbjct: 155 GESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKAV 214

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ + + S  II  +P   S L+YF  P  +  + + P G ++        LIG++V+R 
Sbjct: 215 MTAQIRMSVNIISIMPIAFSLLLYFLDPITIESMWHHPIGKIVYYYIITSELIGMIVIRK 274

Query: 182 MI 183
           M+
Sbjct: 275 ML 276


>gi|225570081|ref|ZP_03779106.1| hypothetical protein CLOHYLEM_06177 [Clostridium hylemonae DSM
           15053]
 gi|225161551|gb|EEG74170.1| hypothetical protein CLOHYLEM_06177 [Clostridium hylemonae DSM
           15053]
          Length = 251

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K  ++++++ F   F +A+  +  ++  G  V +A      +       +D +R E   +
Sbjct: 60  KECLRRKSSSFQLQFKDAIQSLSSALSTGYSVENAWKEAEKELKLLYRENDRIRKELHII 119

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           +    + + + + +      +  ++V  F+ V +   + GG++   + N +  + D+  +
Sbjct: 120 VSQIRVNVPMEQIMEEFAERVRQEDVRNFTAVFAAAKKSGGDMVAIIRNTAGQIGDKVEV 179

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  +    +    ++ ++P+ +   +  + P +M  L  +  G  ++ V  A  +  
Sbjct: 180 KREIDTILASREYEFKVMSAVPYVIIGYMSLSFPEFMQNLYGNVLGTGVMTVCLAAYIGA 239

Query: 176 IMVMRLMINFDV 187
             + + +I  +V
Sbjct: 240 CCLGQKIIRIEV 251


>gi|257064724|ref|YP_003144396.1| Flp pilus assembly protein TadB [Slackia heliotrinireducens DSM
           20476]
 gi|256792377|gb|ACV23047.1| Flp pilus assembly protein TadB [Slackia heliotrinireducens DSM
           20476]
          Length = 332

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 84/185 (45%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            H   +   +  +  P+AL  +    +AGL +    A    ++  P+   F +V     L
Sbjct: 146 SHAADEEQNRLRELVPDALRCMESCFQAGLSLPQTFAETARETEPPLSQTFAQVSHDIEL 205

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S+ E++ R      L E++F +  + VQ   GG+ +  L      +     ++  ++ 
Sbjct: 206 GHSVDEALDRFRLGSGLPELAFVAVALDVQYVSGGDATSVLRIAQDSVDHALELRRTLRV 265

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + +AK SA I+ ++P  +  ++   SP + N       G  LL +AA+ +  GI+++R 
Sbjct: 266 QTAQAKLSAQIVSAMPLVLVGVLSLVSPHFFNPFFETGTGLALLAMAASMLAGGILIVRR 325

Query: 182 MINFD 186
           M+  D
Sbjct: 326 MLAVD 330


>gi|78066134|ref|YP_368903.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
 gi|77966879|gb|ABB08259.1| Flp pilus assembly protein TadB [Burkholderia sp. 383]
          Length = 326

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 81/186 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K +   P+ LD IVR V  G  V  A    +  +  P+R     V     
Sbjct: 141 ITSRISRRRLKIVRQLPSFLDGIVRLVTLGNSVPAAFQSTLQTAEMPLRRCLDDVSRMLR 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  +     ++E      V+ +  + GG     L  +S  +RD ++ + ++ 
Sbjct: 201 SGVEIDRAMLHVAHTYRIREFELVGAVLRLSVRYGGRADVMLDRMSTFMRDLEHAERELS 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAW++  +P  V + V  TSP Y   + ND  G  L+ +A A   +G   + 
Sbjct: 261 AMSAETRMSAWVLALMPIAVGSFVIATSPHYFTAMWNDDSGRQLVYLAFALQTMGGFWLY 320

Query: 181 LMINFD 186
            +    
Sbjct: 321 RLARLR 326


>gi|28871969|ref|NP_794588.1| hypothetical protein PSPTO_4854 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968013|ref|ZP_03396159.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301383671|ref|ZP_07232089.1| hypothetical protein PsyrptM_13603 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059960|ref|ZP_07251501.1| hypothetical protein PsyrptK_08210 [Pseudomonas syringae pv. tomato
           K40]
 gi|302131626|ref|ZP_07257616.1| hypothetical protein PsyrptN_09547 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855222|gb|AAO58283.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927356|gb|EEB60905.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 295

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 95/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 110 VSWRYERRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIELNVQ 169

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL +++          E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 170 LGVSLPDAVRDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 229

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++G LP  ++      +P Y+  + +D  G ++L +A    ++G +++ 
Sbjct: 230 AMTGETRMTAIVLGLLPVSMAGYFLAVNPDYLLQMWSDDSGRIMLSMAFGLQMLGCLMLW 289

Query: 181 LMIN 184
            M+ 
Sbjct: 290 RMLR 293


>gi|330976794|gb|EGH76830.1| type II secretion system protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 294

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 89/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP   +      +P Y+  + +D  G ++L  A A    G +V+ 
Sbjct: 229 AMTGETRMTAVVLALLPISTAGYFLAVNPNYLLHMWDDESGKIMLSAAFALQATGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|291546643|emb|CBL19751.1| Flp pilus assembly protein TadB [Ruminococcus sp. SR1/5]
          Length = 260

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 87/192 (45%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG------QSSDPVRSEFRRV 55
           K    ++  +    F +AL  +  +V+AG    +AV   V       +    +  EFR +
Sbjct: 69  KKCTARQQRELNYQFRDALTAMNVAVQAGYSAENAVRASVKDLGRLYEKGSDILDEFRYI 128

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                L + + E    + +   ++++  F+ V     + GG++++ +  ++R+L D+  +
Sbjct: 129 ESQLRLSVPVEELFLDLGKRSGVEDIENFAAVFYTAKRTGGDMTQVIQKVARMLSDKIEV 188

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K +++A     K+   ++  +P  +   +  TSPG+++VL  +P G   + V      + 
Sbjct: 189 KKEIEATLAAKKSEQMVMSIMPAGIICYLKLTSPGFLDVLYGNPFGICAMTVCMVIYGLS 248

Query: 176 IMVMRLMINFDV 187
             +   +++ +V
Sbjct: 249 YWLGVKIVDIEV 260


>gi|238782878|ref|ZP_04626907.1| Type II secretion system protein F domain protein [Yersinia
           bercovieri ATCC 43970]
 gi|238716301|gb|EEQ08284.1| Type II secretion system protein F domain protein [Yersinia
           bercovieri ATCC 43970]
          Length = 181

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 73/173 (42%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F  DFP  + +I  +  +G  ++  +     + + P+  E   +    +LG S       
Sbjct: 6   FHQDFPEVILMITMAASSGASINQILERCGYEINGPLGDELTLICRKLNLGESPETVFYD 65

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
             +     E  F  T+I +  Q GG L E    LS ++   K  + K   ++ + + S  
Sbjct: 66  AYQRFHYPEFYFLITIILLNLQQGGQLRELTNRLSSVIAKNKTSEQKKAVMTAQTRMSVN 125

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           II  +P   S L+YF  P  +  + N   G ++     A  LIG+ ++R M+ 
Sbjct: 126 IISLMPLAFSLLLYFIDPTTIESMWNHSIGKLIFYYIIASELIGLALIRKMLR 178


>gi|110626526|gb|ABG79010.1| TadB [Yersinia ruckeri]
          Length = 296

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 79/178 (44%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K++   F + FP  L I+  +  +G  ++  +     +    + +EF  +    +LG + 
Sbjct: 115 KQKNKHFNESFPEVLTIMNMAASSGANLNQILERCGKEIQGELGNEFNLIYRRLNLGEAP 174

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
               +   R     E  FF++VI +  + GG LS+ +  + + + +   +K +   ++ +
Sbjct: 175 EIVFNDAYRKFNYAEFHFFTSVILLNIKQGGQLSDLIKKMHKGITESNKLKQRKAIMTAQ 234

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +  ++  +P   +  +Y+  P  +  L +   G  ++       ++GI ++R MI
Sbjct: 235 IRMTTNVVSLIPIVFTAFLYYIDPNSIETLWSQDVGKEIISYIVISEILGIFIIRNMI 292


>gi|297568750|ref|YP_003690094.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924665|gb|ADH85475.1| Type II secretion system F domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 305

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 88/185 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  ++R    +   P  +D ++R+V AG  +  A+      S  P+     +V     
Sbjct: 120 LYYRSQRRRRLMVAQIPTFIDQLLRAVAAGHTLDAALLTATADSRLPLGEVLEQVTREIK 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  +  ++S  +R   L+E+   +  I V  + G ++ E L +L  +++  +  + + +
Sbjct: 180 LGGEIDTALSEAIRLYDLEELRLLALAIRVNRRYGSSIQELLRSLVTLIQQEETSRQEFR 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ E++ +AW++G +P  +   +  T+P Y   L +DP G  +L +A      G++ + 
Sbjct: 240 ALTGESRLTAWVLGLMPLLLVGFLLLTNPEYPAHLWHDPAGRTILLIALLLQSGGVLALW 299

Query: 181 LMINF 185
            +   
Sbjct: 300 RLTRV 304


>gi|288919649|ref|ZP_06413977.1| type II secretion system protein [Frankia sp. EUN1f]
 gi|288348938|gb|EFC83187.1| type II secretion system protein [Frankia sp. EUN1f]
          Length = 286

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 72/184 (39%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              + R     + +P+ +D +  +VRAGL + +A+A +  +    +R  F R  E     
Sbjct: 96  RRRRGRMHDLREVWPDVVDNLASAVRAGLSLPEALAAVGVRGPVALRPAFTRFGEDYRAT 155

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQA 121
            S S  + R+   +           + +  +  G +L   L  LS  LR+    +A+++ 
Sbjct: 156 GSFSTCLDRLADELADPVADRIIESLRMAREVGGTDLGRLLRTLSTFLREDARTRAELET 215

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
                  +A +  + P+ V  L+            + P G  +L   A   ++  ++M+ 
Sbjct: 216 RQTWTVNAARLAMAAPWIVLLLLASRGENVRA--YDSPTGVAVLAGGAGVSVLAYLIMKR 273

Query: 182 MINF 185
           +   
Sbjct: 274 IGRL 277


>gi|66047621|ref|YP_237462.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258328|gb|AAY39424.1| type II secretion system protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 294

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + +D  G ++L VA A  + G +V+ 
Sbjct: 229 AMTGETRMTAVVLALLPISMAGYFLAVNPSYLLHMWDDESGKIMLSVAFALQVTGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|158317569|ref|YP_001510077.1| type II secretion system protein [Frankia sp. EAN1pec]
 gi|158112974|gb|ABW15171.1| type II secretion system protein [Frankia sp. EAN1pec]
          Length = 286

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 73/184 (39%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              + R     + +P+ +D +  +VRAG+ + + +A +  +   P+R  F R  E     
Sbjct: 96  RRRRARIHDLRELWPDVVDNLASAVRAGMSLPEGLAAVGVRGPAPLRPAFTRFGEDYRAT 155

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQA 121
            S S  + R+   +           + +  +  G +L   L  LS  LR+    +A+++ 
Sbjct: 156 GSFSTCLDRLADDLADPVADRIIESLRMAREVGGTDLGRLLRTLSAFLREDARTRAELET 215

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
                  +A +  + P+ V  L+            + P G ++L   A   ++  ++M+ 
Sbjct: 216 RQAWTVNAARLAMAAPWIVLLLLASRGENIQA--YDSPTGVLVLLGGAGVSVLAYVLMKR 273

Query: 182 MINF 185
           +   
Sbjct: 274 IGRL 277


>gi|332162958|ref|YP_004299535.1| type II secretion system protein F domain protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667188|gb|ADZ43832.1| Type II secretion system protein F domain protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 223

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/183 (23%), Positives = 82/183 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K+    F  +FP +L +I  +  +G  ++  +     + S P+  EF  V    +
Sbjct: 37  LRLSRKRYYRFFKQNFPESLLMINMAASSGASINQILERCGQEISGPLGVEFNLVCRRLN 96

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S         +     E  F  T+I +  Q GG L E  + LS ++   K  + K  
Sbjct: 97  VGESPESVFYDSYQRFKYPEFYFLITIILLNLQQGGQLRELTSRLSEVVNKNKATEQKKA 156

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+YF  P  +  + + P G ++    +   +IG++V+R
Sbjct: 157 VMTAQIRMSVNIISIMPIAFSLLLYFLDPTTIESMWHHPIGKIVYYYISISEIIGMIVIR 216

Query: 181 LMI 183
            M+
Sbjct: 217 KML 219


>gi|260587080|ref|ZP_05852993.1| putative bacterial type II secretion system protein F domain
           protein [Blautia hansenii DSM 20583]
 gi|260542570|gb|EEX23139.1| putative bacterial type II secretion system protein F domain
           protein [Blautia hansenii DSM 20583]
          Length = 248

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 73/192 (38%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
           K  I+ R  +    F +AL+ +   + AG  + + +                +  EF  +
Sbjct: 57  KQQIRLRKKRLNYQFKDALNAMQVGISAGYSLDNTIREARKDLERLYGEKAEMAREFAYI 116

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                  + L E +  +     ++++  F+ V+    ++GGN+   L      + +R  +
Sbjct: 117 ERQLGHSIPLEELLYDLGIRSRVEDILNFTDVLIQAKKMGGNMRGILNRCISSIEERIQV 176

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++ A+    K    I+  +P  +   +  TSP +++VL  +P G  ++          
Sbjct: 177 KKEIDAVLASRKMEQKIMSFIPLGIILYMQITSPEFLSVLYGNPVGICVMTACLLLYTAA 236

Query: 176 IMVMRLMINFDV 187
                 +   DV
Sbjct: 237 FQWGVRLTQIDV 248


>gi|266621096|ref|ZP_06114031.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288867252|gb|EFC99550.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 245

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 79/190 (41%), Gaps = 6/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRRVIE 57
           L  +R  +   +F   + I+   + AG  V +A +  + +      +S  +  EF  +  
Sbjct: 56  LKDQRLKRLNLEFKEGILILSSFLSAGYSVENAFSASIRELAVMYGASGMMVLEFSHMEG 115

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              +   + + +        L +V  F+ V +   + GG L   + + S ++RD+  ++ 
Sbjct: 116 QIRMNRPVEQVLMEFGDRSGLDDVRNFAEVFAAAKRSGGELVSIINHTSGVIRDKIQIQE 175

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++  ++   +    I+  +PF +   V  +SPG+ +++     G  ++    A      +
Sbjct: 176 EIATMTAAKQFEQKIMNLIPFFLVLYVDVSSPGFFDMMYQTGAGRWIMTGCLAIYAAAYV 235

Query: 178 VMRLMINFDV 187
           +   ++  +V
Sbjct: 236 LAGRILRIEV 245


>gi|171321819|ref|ZP_02910722.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
 gi|171092890|gb|EDT38140.1| type II secretion system protein [Burkholderia ambifaria MEX-5]
          Length = 224

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 87/186 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  + +   P+ LD IVR V  G  V  A    +  + +P+RS    V     
Sbjct: 39  LASRIQRRRLRIVRQIPSFLDGIVRLVTLGNSVPAAFQSALLTTEEPLRSCLDHVSRMLR 98

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 99  GGVEIDRAMMHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 158

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y++ + NDP G  LL VA    L G + + 
Sbjct: 159 AMSSETRLSAFVLVMLPIGIGSFVVMTNPKYLHGMWNDPSGRTLLMVAFLLQLGGSVWLY 218

Query: 181 LMINFD 186
            M    
Sbjct: 219 RMARLR 224


>gi|33600814|ref|NP_888374.1| hypothetical protein BB1829 [Bordetella bronchiseptica RB50]
 gi|33568414|emb|CAE32326.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 308

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 79/184 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  + +   P  LD +VR +  G  V+ A    +G    P+    +R      
Sbjct: 123 LWLKADRRRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVR 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ 
Sbjct: 183 SGKDLDAALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELT 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWI+  LP  ++  +   +      + +DP G  LL  A      G   + 
Sbjct: 243 ALSAEVRLSAWILALLPIGLALFIIIFNNQLFMGMWHDPMGFRLLVFAMLLQAGGSYWLY 302

Query: 181 LMIN 184
            M  
Sbjct: 303 RMAR 306


>gi|45442766|ref|NP_994305.1| hypothetical protein YP_3004 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597674|ref|YP_071865.1| integral membrane protein. [Yersinia pseudotuberculosis IP 32953]
 gi|108809094|ref|YP_653010.1| hypothetical protein YPA_3103 [Yersinia pestis Antiqua]
 gi|108810711|ref|YP_646478.1| hypothetical protein YPN_0546 [Yersinia pestis Nepal516]
 gi|145597783|ref|YP_001161859.1| hypothetical protein YPDSF_0473 [Yersinia pestis Pestoides F]
 gi|150260281|ref|ZP_01917009.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162418856|ref|YP_001604879.1| type II secretion system protein F domain [Yersinia pestis Angola]
 gi|165924990|ref|ZP_02220822.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165939873|ref|ZP_02228412.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008715|ref|ZP_02229613.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212189|ref|ZP_02238224.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399582|ref|ZP_02305106.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419108|ref|ZP_02310861.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167425112|ref|ZP_02316865.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167466379|ref|ZP_02331083.1| type II secretion system protein F domain protein [Yersinia pestis
           FV-1]
 gi|186896812|ref|YP_001873924.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927880|ref|YP_002345755.1| hypothetical protein YPO0689 [Yersinia pestis CO92]
 gi|229837371|ref|ZP_04457534.1| Flp pilus assembly protein TadB [Yersinia pestis Pestoides A]
 gi|229840583|ref|ZP_04460742.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842867|ref|ZP_04463019.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900908|ref|ZP_04516032.1| Flp pilus assembly protein TadB [Yersinia pestis Nepal516]
 gi|294502755|ref|YP_003566817.1| hypothetical protein YPZ3_0645 [Yersinia pestis Z176003]
 gi|45437632|gb|AAS63182.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590956|emb|CAH22614.1| Putative integral membrane protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108774359|gb|ABG16878.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781007|gb|ABG15065.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115346491|emb|CAL19365.1| putative membrane protein [Yersinia pestis CO92]
 gi|145209479|gb|ABP38886.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149289689|gb|EDM39766.1| putative type II secretion system integral membrane protein
           [Yersinia pestis CA88-4125]
 gi|162351671|gb|ABX85619.1| type II secretion system protein F domain protein [Yersinia pestis
           Angola]
 gi|165912184|gb|EDR30822.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923190|gb|EDR40341.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992054|gb|EDR44355.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206935|gb|EDR51415.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166963102|gb|EDR59123.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167052086|gb|EDR63494.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167055875|gb|EDR65656.1| type II secretion system protein F domain protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|186699838|gb|ACC90467.1| type II secretion system protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682247|gb|EEO78339.1| Flp pilus assembly protein TadB [Yersinia pestis Nepal516]
 gi|229690134|gb|EEO82191.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696949|gb|EEO86996.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705494|gb|EEO91504.1| Flp pilus assembly protein TadB [Yersinia pestis Pestoides A]
 gi|262360787|gb|ACY57508.1| hypothetical protein YPD4_0599 [Yersinia pestis D106004]
 gi|262364732|gb|ACY61289.1| hypothetical protein YPD8_0599 [Yersinia pestis D182038]
 gi|294353214|gb|ADE63555.1| hypothetical protein YPZ3_0645 [Yersinia pestis Z176003]
 gi|320016748|gb|ADW00320.1| Flp pilus assembly protein TadB [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 291

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 225 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|323493499|ref|ZP_08098621.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
 gi|323312322|gb|EGA65464.1| Flp pilus assembly protein TadB [Vibrio brasiliensis LMG 20546]
          Length = 302

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/181 (25%), Positives = 88/181 (48%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             +++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG 
Sbjct: 117 RKRQQVEEFEQSIVQVLGLISRAVSAGLSVPQAISQVAEAQDGLLGREFSRIEDQLALGH 176

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            +  +++     +P +   +F+  + +    GG L + L +LSR L D + M+ KV++L+
Sbjct: 177 GMKHTLNEACVRLPYKAFRYFTIALVLNQNSGGQLRDILHSLSRTLHDNRTMQKKVKSLT 236

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +A  +  LP  +  +V + +P    VLI    G  +L   A  ++IG + ++LM 
Sbjct: 237 AEPRMAARFLSLLPLGLLAVVAWVNPSLFGVLIETESGQSVLVYCAVSIVIGALSLQLMT 296

Query: 184 N 184
            
Sbjct: 297 R 297


>gi|317491687|ref|ZP_07950122.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920121|gb|EFV41445.1| type II secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 290

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 81/176 (46%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
              F D FP  L ++  +V AG  +  A+          +   F R+    +LG      
Sbjct: 112 RRYFEDRFPEILSVVNAAVSAGNSIHQALHRCGEGIDGDLGVTFHRIDRRLNLGEDPERV 171

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
            +        +E  FF  V+ V  Q GG L   +  LSRI+ + KNM  +  A++ EA+ 
Sbjct: 172 FNDAWENYRYREFYFFVVVMLVSLQHGGQLRTLMGRLSRIVNNSKNMARRKSAMTSEART 231

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           SA I+ SLP      + + SP   + +++DP G ++L    A   IG++++ +++ 
Sbjct: 232 SAKIVASLPLLFFCGMKYFSPENFDFVVHDPVGRLILYYVIASEAIGMIIIWILLR 287


>gi|330959998|gb|EGH60258.1| hypothetical protein PMA4326_15684 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 294

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 94/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + ++  P  LD  VRS+++G  +SDAV   +  +  P++    R+     
Sbjct: 109 VSWRYRVRVRRMIEQLPQLLDHSVRSLKSGRTLSDAVLYGIAAADQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL R++R+R+    +++
Sbjct: 169 LGVSLPDAARDFAELYESDEFHLFALGLRVNHRYGGNASELMENLIRLIREREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++G LP  ++      +P Y+  + ND  G ++L +A    L+G +++ 
Sbjct: 229 AMTGETRMTALVLGLLPVGMAGYFMVVNPDYLLHMWNDGSGRIMLSMAFGLQLLGCLMLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|270487716|ref|ZP_06204790.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
 gi|270336220|gb|EFA46997.1| type II secretion system F domain protein [Yersinia pestis KIM D27]
          Length = 217

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 77/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 31  LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 90

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 91  LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 150

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  +   P G  ++       +IGI+++R
Sbjct: 151 VMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGILIIR 210

Query: 181 LMI 183
            M+
Sbjct: 211 KML 213


>gi|56460010|ref|YP_155291.1| Flp pilus assembly protein TadB [Idiomarina loihiensis L2TR]
 gi|56179020|gb|AAV81742.1| Flp pilus assembly protein TadB [Idiomarina loihiensis L2TR]
          Length = 233

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 83/182 (45%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +HL K+R  K     P  L  +   +R+G  V  A+  + G    P+  E   ++  + +
Sbjct: 46  RHLKKQRYIKIEKQLPGMLIGLSNQLRSGTSVGAALKNLKGTLLAPLGQEVDELLRQEKV 105

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L++ +    R +P+  +      + +  + GG  S+    L+  L+ ++++K +   
Sbjct: 106 GKPLTDCLEDWQRRVPVFSIKLVVQSLVLGLKSGGQQSDLFLRLADNLQQQQHIKERQIT 165

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           L+ +A+  A I+  +P  +  L+ +    +  +      G  +L VA   M+IG  +++ 
Sbjct: 166 LTSQARMQAKILVMMPVGLYFLLSWMKSEHTALFTESRVGIFMLIVALILMIIGGWMVKR 225

Query: 182 MI 183
           ++
Sbjct: 226 IM 227


>gi|258651873|ref|YP_003201029.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
 gi|258555098|gb|ACV78040.1| type II secretion system protein [Nakamurella multipartita DSM
           44233]
          Length = 284

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 74/186 (39%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L  KR A   + +P  +D +   VRAGL + +A+A I  +  + +R  F++      
Sbjct: 93  VSRLRHKRQADLRELWPEVVDNLTSGVRAGLSLPEALAAIGDRGPEQLRDPFKQFGADYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                ++S+ R+   +           +   +   G +L   L+ LS  LRD    +A++
Sbjct: 153 TTGRFNDSLDRLKATLADPVGDRVIESLRVAREVGGTDLGRLLSTLSGFLRDDARTRAEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A    +  +A +  + P+ V  L+            + P G ++L   A    I   +M
Sbjct: 213 LARQSWSVNAARMAVAAPWLVLILLATQRETLQA--YDTPTGTVILIAGAVLSFIAYRLM 270

Query: 180 RLMINF 185
             +   
Sbjct: 271 IRIGRL 276


>gi|33593508|ref|NP_881152.1| hypothetical protein BP2525 [Bordetella pertussis Tohama I]
 gi|33572864|emb|CAE42798.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382916|gb|AEE67763.1| hypothetical protein BPTD_2483 [Bordetella pertussis CS]
          Length = 281

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 87/171 (50%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R  
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRA 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           P  +  ++    P  M  L +   G   L +       GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALWHTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|33596529|ref|NP_884172.1| hypothetical protein BPP1911 [Bordetella parapertussis 12822]
 gi|33566298|emb|CAE37211.1| putative membrane protein [Bordetella parapertussis]
          Length = 281

 Score = 92.1 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 87/171 (50%)

Query: 17  PNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYM 76
           P AL  +  ++RAG  ++ A+  +V     P+  EF  ++  Q +G+S   +++R+ R  
Sbjct: 111 PGALVAMACALRAGAGIAAALRQLVEHGEAPLAQEFGLLLREQRMGVSFDAALARLARRA 170

Query: 77  PLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136
             + ++  +  + V +  GGNL+E L  +++ +  R  ++ +V+AL  + +  AWI+G+L
Sbjct: 171 SFESMALVAAALRVAAHTGGNLAETLEGIAQTVSARLQLQDRVRALCAQGRMQAWIVGAL 230

Query: 137 PFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           P  +  ++    P  M  L +   G   L +       GI ++R ++  DV
Sbjct: 231 PPVLMGVLGRLQPEAMAALWHTLYGWAALALIVVLEGTGIWLIRRIVAIDV 281


>gi|149927030|ref|ZP_01915288.1| type II secretion system protein [Limnobacter sp. MED105]
 gi|149824251|gb|EDM83471.1| type II secretion system protein [Limnobacter sp. MED105]
          Length = 302

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 89/182 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  +KR  + L   PN LD +VR    G  ++ +    +  +  P++      ++ Q+ G
Sbjct: 119 YRQRKRRLQMLGQLPNFLDGVVRVSAVGYSLTVSFNTALENAEQPLKEALGLAVQMQYAG 178

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           L L +++ R+ R   L E    ++V+++    GG     L  L++ LRDR+    ++ A+
Sbjct: 179 LELDQAMHRLARVYGLSEFKLIASVVALALNYGGKSDILLGRLAQYLRDREQHHQEMLAM 238

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S EA+ SA  +  L   ++ ++   +P Y+  + ND  G MLL VA    + G  ++  M
Sbjct: 239 SSEARMSAVFMCCLTPALAGIILTLNPAYLGTMWNDDTGRMLLFVAGILQIAGAAIIYRM 298

Query: 183 IN 184
           + 
Sbjct: 299 VK 300


>gi|303241928|ref|ZP_07328421.1| Flp pilus assembly protein TadB-like protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590483|gb|EFL60238.1| Flp pilus assembly protein TadB-like protein [Acetivibrio
           cellulolyticus CD2]
          Length = 305

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 79/186 (42%), Gaps = 1/186 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K  I KR     +     LD +     AG  +  A+   + +S DP++S   +V     
Sbjct: 112 LKQRISKRKDLMTEQLIEWLDYMSSMGTAGKALLTALDYSIEKSRDPLKSVLEKVSANIK 171

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
              SLSE+   + + +P+ E    S  I                N+S  +++  ++   +
Sbjct: 172 KSQSLSEAFENVTKQIPIPEFKMVSMAISVHSEITNEGWPRTFENISSQMKENGDLFNTI 231

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A + E+K +++IIG +P  +  ++    P Y+   +  P G +   +A    L G+ ++
Sbjct: 232 DASNTESKINSYIIGLMPLAMFIVIRLMQPEYVANSLESPIGKISYVIAGLLSLSGMYLV 291

Query: 180 RLMINF 185
           R + N 
Sbjct: 292 RRISNV 297


>gi|296130403|ref|YP_003637653.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
 gi|296022218|gb|ADG75454.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
          Length = 306

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 91/186 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R   F+   P    ++  +  AGL ++ A+A+   +   P   E  RV     
Sbjct: 120 LSRAQQRRNEAFIGQMPELARLLSNATSAGLSIASALALAANELDAPAGPEMARVASRMR 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  +I  +   +P +EV+  ++ + V ++ GG+L  AL +++  L +RK ++ +V+
Sbjct: 180 FGEDLDTAIGELTARLPSREVAVLASTLLVSARSGGSLVTALRDIADTLEERKEIRREVR 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            +  ++ ++ +++  + F +  L+    PG +  +  D  G   L V ++  + G +++R
Sbjct: 240 TVLAQSTSTGYLVIGMGFALLFLLNIIRPGTVEAMTEDWLGRGALVVGSSLFVGGFLLIR 299

Query: 181 LMINFD 186
            M  FD
Sbjct: 300 RMTRFD 305


>gi|330830428|ref|YP_004393380.1| Flp pilus assembly protein TadB [Aeromonas veronii B565]
 gi|328805564|gb|AEB50763.1| Flp pilus assembly protein TadB [Aeromonas veronii B565]
          Length = 294

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 90/176 (51%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
            +F    P  +D ++R++R G P++D    +  Q    +   F ++ +   +G  +++ +
Sbjct: 117 EQFRTGLPEVIDGMIRALRVGAPLADIFQQVARQQRGLMSRLFAQMHDELQVGQPVAQVM 176

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
            +    + + E  F + V+S+Q + GG LS+ LA L   LR R+ + A +Q ++ E++ S
Sbjct: 177 RQAANRVTVAEFQFLTIVLSLQQETGGRLSDVLAQLVETLRARQTLAASIQTITAESRNS 236

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A ++ +LP  +  +++ T   +   L+    G  ++G  +  + +G+ ++R +   
Sbjct: 237 AKVLAALPVIILLVLFSTGREHFTYLMTTASGQWVMGYVSISVAVGLWLIRRLTRL 292


>gi|330819178|ref|YP_004348040.1| type II secretion system protein [Burkholderia gladioli BSR3]
 gi|327371173|gb|AEA62528.1| type II secretion system protein [Burkholderia gladioli BSR3]
          Length = 282

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 94/187 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K+R A      P+ L +   ++RAG   + A+  +V ++  P+  E   ++    
Sbjct: 96  LAIMRKRRIAMLERQLPDVLLMTAGALRAGASFAVAMESVVSEAPAPISGELELLMRELR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L  ++  + R +P+ +    +  +++  ++GGNL+EAL +++R L  +  M+ K++
Sbjct: 156 LGIDLDIAMQNIERRIPVPDFLMVTAAVTISREVGGNLAEALESVARTLGAKLQMEGKIR 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +    ++  LP  +  ++ F  P  M  L ++  G + L V A    +G   + 
Sbjct: 216 ALTSQGRMQGIVMTLLPLGLMVVLNFMEPEAMAPLFHERVGWLTLAVIAVMEFLGYKAIS 275

Query: 181 LMINFDV 187
            + N DV
Sbjct: 276 KITNIDV 282


>gi|73539234|ref|YP_299601.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72122571|gb|AAZ64757.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 312

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 89/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + + +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q 
Sbjct: 127 LWNRVRRIRQKMLLQLPGFLDGVVRLMTIGSSVPAAFQNSIANTDAPLRQCLVQAVHLQR 186

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L +++ +M R   LQE+   ++V+ +  + GG     +   +  +RDR+  + ++ 
Sbjct: 187 AGKELDQAVLQMGRIYHLQELVLLASVLRLSVRYGGRADVMMERTAAFMRDREQAQRELM 246

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWI+G LP  V   ++  + GY+ ++  DP G  +L  A A  + G  ++ 
Sbjct: 247 ALSAETRLSAWILGLLPLVVGGGLFVLNAGYVLMMWRDPTGKTMLLTALALEIAGAFMLY 306

Query: 181 LMIN 184
            +  
Sbjct: 307 RLAK 310


>gi|194366100|ref|YP_002028710.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348904|gb|ACF52027.1| type II secretion system protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 318

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 84/182 (46%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               K  A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +     G
Sbjct: 135 RRTSKLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYARSG 194

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L  +++   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ A 
Sbjct: 195 MDLDRALALAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELAAT 254

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + SAW++G LP   + L+  +SP +   +++DP GH +L +A    L G  ++  +
Sbjct: 255 TSETRMSAWVLGLLPPACAVLMAISSPEFFQPVLHDPLGHKILLIALGLELFGAFLLYRL 314

Query: 183 IN 184
             
Sbjct: 315 AK 316


>gi|312199822|ref|YP_004019883.1| type II secretion system F [Frankia sp. EuI1c]
 gi|311231158|gb|ADP84013.1| Type II secretion system F domain protein [Frankia sp. EuI1c]
          Length = 285

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 69/178 (38%), Gaps = 3/178 (1%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
            A     +P+ +D +  +VRAG+ + + +A +  +   P+R  F R  E      S S  
Sbjct: 101 MADLRGMWPDVVDNLASAVRAGMSLPEGLAAVGQRGPAPLRGAFTRFGEEYRASGSFSSC 160

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           + ++   +           + +  +  G +L   L  LS  LR+    +A+++       
Sbjct: 161 LDKLADELADPVADRIIESLRLAREVGGTDLGRLLRTLSTFLREDARTRAELETRQSWTV 220

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +A +  + P+ V  L+            + P G  +L    A  +   +VM+ +   
Sbjct: 221 NAARLALAAPWVVLLLLATRGQNVSA--YDSPTGVAVLVGGGAVSVFAYVVMKRIGRL 276


>gi|152981651|ref|YP_001355003.1| Flp pilus assembly protein TadB [Janthinobacterium sp. Marseille]
 gi|151281728|gb|ABR90138.1| Flp pilus assembly protein TadB [Janthinobacterium sp. Marseille]
          Length = 311

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 78/184 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  K +   P  LD +VR    G  +  A    V  + +P+R    R      
Sbjct: 126 LWLKATRRHQKMVRQLPAFLDTMVRLTIVGNSLESAFQATVLTTEEPLRELLDRSNRLVQ 185

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  ++ +  R   LQE+   + VI V  + GG     L  ++  +RDR+  + ++ 
Sbjct: 186 AGMDLEHALVQKARVFRLQELELIAAVIGVALRFGGRADTVLERMAAFMRDREYSQNELV 245

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWI+G LP  +   +   +      ++ DP G  LL  A     IG   + 
Sbjct: 246 ALSSETRLSAWILGLLPIGLGVFMVIFNNRMFVTMLEDPLGKNLLIFAVVLEAIGAYWLY 305

Query: 181 LMIN 184
            +  
Sbjct: 306 RLAK 309


>gi|51891535|ref|YP_074226.1| putative integral membrane protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855224|dbj|BAD39382.1| putative integral membrane protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 270

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 84/190 (44%), Gaps = 6/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRVIE 57
           L ++      D    AL  +  S++AG  +  A+     + S        +  E      
Sbjct: 81  LARREAQALRDQLQEALLSLATSLKAGQSLPRALQRCAVELSRLHPGGGGLIREIELTAR 140

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              LG  + E++  +   +PL+E++     +    + GGN+ E + N+++++ DR  ++ 
Sbjct: 141 EVELGTPVDEALLDLRARVPLEELAALVDALVTTRRRGGNIVEVMGNVAQMVADRLAVER 200

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++Q L+ + +  A I+  +P  +  +V  T+P Y+ V      G   LG+    +  G  
Sbjct: 201 EIQVLTAQKRTEAAILAMIPLGIYLVVRVTNPAYLAVFHATLWGQAALGLILLAVAGGYW 260

Query: 178 VMRLMINFDV 187
           + + + + D+
Sbjct: 261 MAQRIASIDM 270


>gi|330873866|gb|EGH08015.1| type II secretion system protein F domain [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 198

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 89/184 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +      LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 13  VSWRYEVRVRRMIQQLAQLLDHTVRSLKSGRTLADAVLHGIEATDQPLKDGMSRIERNVQ 72

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 73  LGVSLPDAARDFAELYERDEFHLFALGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 132

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + ND  G ++L +A      G +V+ 
Sbjct: 133 AMTGETRMTALVLALLPVGMAGYFLTVNPSYLLHMWNDDSGKIMLSMAFVLQATGCVVLW 192

Query: 181 LMIN 184
            M+ 
Sbjct: 193 RMLR 196


>gi|238796993|ref|ZP_04640497.1| Type II secretion system protein F domain protein [Yersinia
           mollaretii ATCC 43969]
 gi|238719253|gb|EEQ11065.1| Type II secretion system protein F domain protein [Yersinia
           mollaretii ATCC 43969]
          Length = 279

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 80/183 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   K     F  D P  + +I  +  +G  ++  +     + S P+  E   +    +
Sbjct: 93  LKISRKTHHTLFKRDLPEVILMINMAASSGASINQVLERCGNEISGPLGDELDLICRRLN 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S     +   +     E  F  T+I +  Q GG L E ++ LS+++   K  + K  
Sbjct: 153 LGESPEAVFNDAYQRFLYPEFYFLITIILLNLQQGGQLRELISRLSQVINKNKTSEQKKA 212

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   STL+YF  P  M  + N P G M+        +IGI ++R
Sbjct: 213 VMTAQTRMSVNIISLMPLVFSTLLYFLDPATMESMWNHPMGKMVFYYIILSEVIGITIIR 272

Query: 181 LMI 183
            M+
Sbjct: 273 TML 275


>gi|156741692|ref|YP_001431821.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
 gi|156233020|gb|ABU57803.1| type II secretion system protein [Roseiflexus castenholzii DSM
           13941]
          Length = 318

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 84/184 (45%), Gaps = 2/184 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
                   F         ++  ++RAG+ +  A+  +  +  +P RSEFR+      LG 
Sbjct: 137 RQNAYVRAFNKQLVEVTQLLANALRAGMSIQQAIGEVSERVPEPARSEFRQTHHELLLGD 196

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           +L  ++  M R +  +++      I VQ Q GGNL   L  ++  L +R+ ++ ++ +L+
Sbjct: 197 NLPLALHDMRRRVCSRDLDVLINAIVVQHQAGGNLVRVLNGMANTLNERQRLEREIDSLT 256

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            EA+ SA ++  LP     ++  T  G    L     G +LLGV A   +    +++ + 
Sbjct: 257 SEARFSALVVMVLPIFFLLMIRDTPLG--EALFQTVIGWVLLGVFAVVQVAVYFLIQRVA 314

Query: 184 NFDV 187
             +V
Sbjct: 315 RIEV 318


>gi|227871817|ref|ZP_03990219.1| type II secretion system protein [Oribacterium sinus F0268]
 gi|227842318|gb|EEJ52546.1| type II secretion system protein [Oribacterium sinus F0268]
          Length = 224

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 82/191 (42%), Gaps = 6/191 (3%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRVI 56
            L KKR    +  F   L I+   + AG  + +A+   +    +       +  E +++ 
Sbjct: 34  KLRKKRQEVLVSQFKEMLSILSAYLSAGYSLENALFACIPDLENLLGKKCYMVEELKQIK 93

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
            +  +   L E++S+      + ++  FS +  V  + GG+L + +   S I+RD+  + 
Sbjct: 94  RSLSMNRPLEEALSQFALRSGVDDIHNFSEIFLVAKRSGGDLIQIIQQSSTIIRDKLTIT 153

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            ++  L+   +    I+  +PF +   +  +SP +  +L +   G  ++       L+ I
Sbjct: 154 EEIITLNASRRFEQKIMNGVPFFMIFYLNASSPEFFRILYSTIMGRGVMSFCLCIYLLAI 213

Query: 177 MVMRLMINFDV 187
            + + +I   V
Sbjct: 214 YLSQKIIAIPV 224


>gi|160935910|ref|ZP_02083284.1| hypothetical protein CLOBOL_00803 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441152|gb|EDP18869.1| hypothetical protein CLOBOL_00803 [Clostridium bolteae ATCC
           BAA-613]
          Length = 245

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
            +L K+R  +    F   + ++   + AG  + + + + + +        + +  EFR +
Sbjct: 54  SNLKKERARRLELQFKEGIQVLSSFLSAGYSLENGLTLSIKELEILFGRREMITEEFRIL 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +   +     E      R   +++V  F+ V+S   + GG L E +   + I+RD+  +
Sbjct: 114 SDGIRMNRPAEELFMDFGRRSGVEDVDNFAQVLSAAKRSGGELVEIIRQTAGIIRDKVQV 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  +         I+  +PF +   +  TSPG+ +V+     G  ++ +  A     
Sbjct: 174 KEEIHTMLASRIFEQRIMNLIPFLIVLYIDLTSPGFFSVMYGTWMGRSVMTMCLAAYAGA 233

Query: 176 IMVMRLMINFDV 187
           +++   +++ +V
Sbjct: 234 LVLAGKILDIEV 245


>gi|254245562|ref|ZP_04938883.1| type II secretion system protein [Burkholderia cenocepacia PC184]
 gi|124870338|gb|EAY62054.1| type II secretion system protein [Burkholderia cenocepacia PC184]
          Length = 204

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  K +   P+ LD IVR V  G  V  A    +  + +P+R     V     
Sbjct: 19  LASRIQRRRLKIVRQIPSFLDGIVRLVTLGNSVPAAFQSALLTTEEPLRGCLDVVSRMLR 78

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ +  ++  + +    +E     +V+ +  + GG     L  ++  +RD +  + ++ 
Sbjct: 79  GGIEIDRAMMHIAKIYRTEEFELVGSVLRLSVKYGGRADVMLERMAVFMRDLEQAERELT 138

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SA+++  LP  + + V  T+P Y+  +  DP G  LL +A    ++G + + 
Sbjct: 139 AMSSETRLSAFVLVMLPIAIGSFVVMTNPKYLYGMWGDPSGRSLLMIAFLAQVVGSIWLY 198

Query: 181 LMINFD 186
            M    
Sbjct: 199 RMARLR 204


>gi|89068023|ref|ZP_01155440.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046262|gb|EAR52319.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 987

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 75/160 (46%), Gaps = 4/160 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +    ++R  +  + FP++LD+++  V AG  +  ++  +  +       +  E+  V  
Sbjct: 824 VNKRQQERQQEIENGFPDSLDMMLVCVEAGQSLDQSIIRVARELKTGFPALAWEYELVAY 883

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M     + +V+ F TV+    Q G +++EAL   +  +RD++ M+A
Sbjct: 884 EMKAGKDKISVLKDMSERCGVNDVASFVTVLIQSQQFGTSIAEALRVYAGEMRDKRVMRA 943

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVLI 156
           + +A ++  K + A ++ ++P  +  L+  +     + LI
Sbjct: 944 EEKANTLPTKMTLATMMLTVPPLLIILIGPSVFDIYDTLI 983


>gi|170022930|ref|YP_001719435.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
 gi|169749464|gb|ACA66982.1| type II secretion system protein [Yersinia pseudotuberculosis
           YPIII]
          Length = 291

 Score = 90.6 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 78/183 (42%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K+   K    F  DFP  L +I  +  +G  ++  +     +   P+  E   +    +
Sbjct: 105 LKYSRSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRLN 164

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +               E  F  T+I +  Q GG L E +  LS+I+  +K  + K  
Sbjct: 165 LGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQKKA 224

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ + + S  II  +P   S L+Y   P  +  + + P G  ++       +IGI+++R
Sbjct: 225 VMTAQIRMSVNIISIMPILFSFLLYLLDPTTIEFVWHHPTGRFIIYYIIISEVIGILIIR 284

Query: 181 LMI 183
            M+
Sbjct: 285 KML 287


>gi|258515695|ref|YP_003191917.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779400|gb|ACV63294.1| type II secretion system protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 306

 Score = 90.6 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 90/186 (48%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  +I KR           L I   S+R+G+ ++ A+A  +G+ +  +  E +R+     
Sbjct: 119 LNAMISKRGELLAKQLHGCLIIWANSLRSGVSLAQAIAGSIGRVAPQINEELKRIKYDID 178

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S ++++ + +  +P+ E         +  QLGGNL+E   N+   + +R   +  ++
Sbjct: 179 LGFSSADALEKALVRIPVAEFKMVVMTAKIHRQLGGNLAERFDNICLTIEERIATRDVLK 238

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + +AK  A + G +PF V  ++   SP Y+  +++ P G M+L ++   + +G   + 
Sbjct: 239 AHTTQAKLGAVVAGLMPFIVLIILKTMSPDYLKPMLDSPYGTMMLMLSVFLVFLGWFTIN 298

Query: 181 LMINFD 186
            +    
Sbjct: 299 KLSTIK 304


>gi|257791503|ref|YP_003182109.1| type II secretion system protein [Eggerthella lenta DSM 2243]
 gi|257475400|gb|ACV55720.1| type II secretion system protein [Eggerthella lenta DSM 2243]
          Length = 306

 Score = 90.6 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 91/182 (50%), Gaps = 1/182 (0%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQ-HLGLS 64
           KKR+ +F     +AL +I  ++R G     +++ +     +P+ SE +RVIE   +  +S
Sbjct: 123 KKRSMQFETQLASALPMISENLRGGSSFEMSISAVAQFMPEPIHSELQRVIEDVSNASIS 182

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           L ++  R+   +   E    +T + +Q + GGNL+  +  ++  +  R  +K KV++ + 
Sbjct: 183 LPDAFERLAIRIQSSEAHLLATAVMIQKEGGGNLASVVDTIAETIARRIELKNKVRSSTA 242

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            A+ SA  + ++PF V     + SPGYM+     P    ++  AA    IG+ ++  M  
Sbjct: 243 NARFSAVFVAAVPFAVLAFFTYGSPGYMDNFYAWPFWPAVIIAAAVLDGIGLFLISRMYK 302

Query: 185 FD 186
           F 
Sbjct: 303 FK 304


>gi|149175457|ref|ZP_01854078.1| putative tight adherence tadb-related transmembrane protein
           [Planctomyces maris DSM 8797]
 gi|148845725|gb|EDL60067.1| putative tight adherence tadb-related transmembrane protein
           [Planctomyces maris DSM 8797]
          Length = 285

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 78/180 (43%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
             +R  K  D   + +D + R+ + G  ++     +  ++  P+  E +       +G+S
Sbjct: 101 RSRRQNKINDQLSDMIDELARAAKTGRSLTHCFINVAEKTPAPLGDELKEASRRLQMGVS 160

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           +  ++  +     +  ++  S  + V  + GG+L + L  L+R +RDR     +++  + 
Sbjct: 161 MKAALDGLYERTGVASLNILSMALIVHQETGGDLVKVLERLARTIRDRVLFLGRLRTATA 220

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            ++A+A ++  LP  +        P Y+  L+    G      A A  +IG + +  ++ 
Sbjct: 221 GSRATAVLMILLPPLILGFFILRDPTYLTTLMASSWGRGATFTAIALQVIGSLWVLRVLK 280


>gi|331082851|ref|ZP_08331973.1| hypothetical protein HMPREF0992_00897 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400180|gb|EGG79829.1| hypothetical protein HMPREF0992_00897 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 248

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 72/192 (37%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRV 55
           K  I+ R  +    F +AL+ +   + AG  + + +                +  EF  +
Sbjct: 57  KQQIRLRKKRLNYQFKDALNAMQVGISAGYSLDNTIREARKDLERLYGEKAEMAREFAYI 116

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                  + L E +  +     ++++  F+ V+    ++GGN+   L      + +R  +
Sbjct: 117 ERQLGHSIPLEELLYDLGIRSRVEDILNFTDVLIQAKKMGGNMRGILNRCISSIEERIQV 176

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++ A+    K    I+  +P  +   +  TSP +++VL  +  G  ++          
Sbjct: 177 KKEIDAVLASRKMEQKIMSFIPLGIILYMQITSPEFLSVLYGNSVGICVMTACLLLYTAA 236

Query: 176 IMVMRLMINFDV 187
                 +   DV
Sbjct: 237 FQWGVRLTQIDV 248


>gi|116671218|ref|YP_832151.1| type II secretion system protein [Arthrobacter sp. FB24]
 gi|116611327|gb|ABK04051.1| type II secretion system protein [Arthrobacter sp. FB24]
          Length = 284

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 74/183 (40%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   +KRTA     +P+ +D +  ++RAGL + +A+  +  +  + +R  FR       
Sbjct: 93  VRWRARKRTATLRQLWPDVVDHLRSAIRAGLSLPEALIQLGEKGPEELRHVFRDFGADYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G     +++R+   +           + +  +  G +L   L  L   LR+    ++++
Sbjct: 153 AGGQFDPALNRLKERLADPVADRIVEALRLTREVGGSDLGRLLGTLGEFLRESARTRSEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  L+  T P  +    N   G  +L        I   VM
Sbjct: 213 EARQSWTVNAARLAVAAPWIVMVLL-ATRPEAVAA-YNTATGAAVLLGGLVVSTICYSVM 270

Query: 180 RLM 182
             +
Sbjct: 271 LRI 273


>gi|33152382|ref|NP_873735.1| tight adherence protein B [Haemophilus ducreyi 35000HP]
 gi|21326711|gb|AAL92471.1| TadB [Haemophilus ducreyi]
 gi|33148605|gb|AAP96124.1| tight adherence protein B [Haemophilus ducreyi 35000HP]
          Length = 295

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 75/183 (40%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K   ++    F + FP  + I+  +  +G+ +  A+         P+  EF  + +    
Sbjct: 110 KMGQRRNKKMFDETFPEVIQILNAATSSGVSLLQAMERCGKDIRGPLGQEFTLIYKRLAR 169

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G              P +   FF  +I      GG + E ++ L R + D   M+ K +A
Sbjct: 170 GEDAMAVFQDSYSRYPYKSFYFFICIIRTNLSRGGQIREVVSRLGRAIADANKMEQKKKA 229

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++ EA+ S  I+   P      + F +P   + ++NDP G ++L       L+GI  +  
Sbjct: 230 MTAEARMSVMIVACFPVFFFFFMKFMTPENFDFMMNDPGGRIILYYVVGSELLGIFTVWW 289

Query: 182 MIN 184
           ++ 
Sbjct: 290 LMR 292


>gi|260775649|ref|ZP_05884545.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608065|gb|EEX34234.1| flp pilus assembly protein TadB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 306

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 87/184 (47%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           M  L  +    F + FP+AL ++  +V AG  +  +   +      PV  EF+++ +   
Sbjct: 120 MNWLQAREKQHFEEAFPDALTMLASAVSAGEGLMQSFIFVGRTLDGPVGKEFKKMGDRLQ 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S +   S+  +  P     FF   +      GG + E +A L+R++   + ++ K  
Sbjct: 180 MGESTNAVFSKSCQRFPYPSFHFFVITMRANIDRGGQIKEVVAKLNRVMFSARAIEKKKY 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ EA+ SA I+G+LPF    L+ + SP     ++  P G  +L        IG+ ++ 
Sbjct: 240 ALTSEARVSAKIVGALPFFFLFLLQYISPDNFEFVMFHPDGRPVLYYVMISECIGMGLIW 299

Query: 181 LMIN 184
           L++ 
Sbjct: 300 LLMK 303


>gi|238027559|ref|YP_002911790.1| Flp pilus assembly protein TadB [Burkholderia glumae BGR1]
 gi|237876753|gb|ACR29086.1| Flp pilus assembly protein TadB [Burkholderia glumae BGR1]
          Length = 338

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 84/184 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
             I  R  K +   P+ LD +VR V  G  V  A    +G +  P+R    +V      G
Sbjct: 155 RRISARRLKIVQQLPSFLDGVVRLVTLGNSVPAAFQGALGTTEMPLRRCLDQVSRMLRTG 214

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + +  ++  + +   ++E     +V+ +  + GG     L  ++  +RD +  + ++ A+
Sbjct: 215 VEIDRAMLHIAKEYRVREFELVGSVLRLSVKYGGRADVMLERMATFMRDLEQAERELHAM 274

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAW++G LP  V + V  T+P Y   +  +  G ++L VA    ++G  ++  M
Sbjct: 275 SAETRLSAWVLGLLPVAVGSFVVSTNPQYFTAMWMNESGRLVLYVAFGLQMLGGYLLYRM 334

Query: 183 INFD 186
               
Sbjct: 335 ARLR 338


>gi|254524987|ref|ZP_05137042.1| Flp pilus assembly protein TadB [Stenotrophomonas sp. SKA14]
 gi|219722578|gb|EED41103.1| Flp pilus assembly protein TadB [Stenotrophomonas sp. SKA14]
          Length = 318

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 85/184 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +  A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +    
Sbjct: 133 IMRRTTRLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYAR 192

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  ++S   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ 
Sbjct: 193 SGMDLDRALSLAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELA 252

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + E + SAW++G LP   + L+   SP +   ++++P GH +L +A    L+G  ++ 
Sbjct: 253 ATTSETRMSAWVLGLLPPASAVLMAIASPDFFQPVLHEPLGHKVLLIALGLELVGAFLLY 312

Query: 181 LMIN 184
            +  
Sbjct: 313 RLAK 316


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 1/158 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  + L   P+ALD++  SV AGL    A+  IV +  + +  EF  V+    
Sbjct: 483 LSREITQRRRRILLQMPDALDLLTISVEAGLGFDAAMLEIVQKWDNDIAREFALVLSEMK 542

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S  +++  M   + L E+    + I    ++G ++   L+  S  +R R+  +A+  
Sbjct: 543 LGKSRRDALRSMAERVQLDEMKLLVSSIVQADEIGASIGRTLSIQSEQMRLRRRQRAEEL 602

Query: 121 ALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
                 K     ++   P     L+    P  +N L N
Sbjct: 603 GHKAVIKIIIPMVLFIFPAVFVVLLGPAIPTILNALGN 640


>gi|257069183|ref|YP_003155438.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
 gi|256560001|gb|ACU85848.1| Flp pilus assembly protein TadB [Brachybacterium faecium DSM 4810]
          Length = 290

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 74/186 (39%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++RT    + +P A+D I  ++RAGL + +A+  +     + +R  F        
Sbjct: 99  LRSAARRRTTAMREVWPEAVDHINSAIRAGLSLPEALVQLSRNGPEELRPAFAEYALDYQ 158

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
                +  + R+   +           + +     G +L   L  LS  LR+    +A++
Sbjct: 159 ASGDFASCLDRLKIRLADPVGDRIVEALRITRDVGGTDLGSLLRTLSAFLREDARTRAEL 218

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  L+  T P       +   G +L+ V A   LI   VM
Sbjct: 219 EARQSWTVNAARLALAAPWIVLALM-ATRPQAAQA-YDTATGMVLIVVGAVASLIAYRVM 276

Query: 180 RLMINF 185
            L+   
Sbjct: 277 LLIARL 282


>gi|167760286|ref|ZP_02432413.1| hypothetical protein CLOSCI_02659 [Clostridium scindens ATCC 35704]
 gi|167662169|gb|EDS06299.1| hypothetical protein CLOSCI_02659 [Clostridium scindens ATCC 35704]
          Length = 238

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 75/189 (39%), Gaps = 6/189 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIET 58
            +K+  +FL  F  A+  +  ++  G  V +A+     +          +  EF  +   
Sbjct: 50  ARKKDQEFLLQFKEAIQAMASALNTGYSVENALLEAQKELRLLYPEDARISREFLVMARQ 109

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
             L + + + +         ++V  F  V +   + GG++   + N +  + D+ ++K +
Sbjct: 110 LRLHVPMEQILEEFAGRSGQEDVENFVAVFAAARKSGGDMISIIRNTANQIGDKIDVKRE 169

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +  +    K    ++ ++P+ +   +  + P +M+ L  +  G  ++       L    +
Sbjct: 170 IDTVLAAKKYEFRVMAAIPYAIIGYMSLSFPEFMDSLYGNIMGIGVMSACLTMYLGAYYL 229

Query: 179 MRLMINFDV 187
              +I  +V
Sbjct: 230 GARIIRIEV 238


>gi|294146461|ref|YP_003559127.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
 gi|292676878|dbj|BAI98395.1| Flp pilus assembly protein TadB [Sphingobium japonicum UT26S]
          Length = 297

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 92/185 (49%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++R    ++  P  +D + +    G  ++ A+   +  +   VRS    V     
Sbjct: 111 VRRRAQRRVEALIEALPYYIDAVRQMQAVGNSLAQALDRALADAPAVVRSYIAPVARRLE 170

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  +++++  +   + + E+S  +  I    + GG++S  L NL+ ILR+R  +K +++
Sbjct: 171 LGAPVADAMQVLAERLRVPEISMLAAAIRTNMRYGGSISAVLLNLANILRERIRIKRELK 230

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A   EAK S  ++  +P     ++   +P Y++  + DPRGH L  VA     +G++VMR
Sbjct: 231 AAISEAKISGRVLIVMPLVAMAVLVAMNPDYIDFFLRDPRGHRLAVVALVLQGMGMLVMR 290

Query: 181 LMINF 185
            ++  
Sbjct: 291 RVMRL 295


>gi|291460200|ref|ZP_06599590.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417147|gb|EFE90866.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 256

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 83/190 (43%), Gaps = 6/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIE 57
           L K+R  K L +F  AL ++   + AG  + +A  +   +       +  +  EF+++ E
Sbjct: 67  LRKQRQRKLLLEFREALSVLSSFLGAGYSLENAFRLSGRELSSLLGENAMISREFQKISE 126

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                L + + +        L E+  FS + SV  + GG L   +   S ++ D+  +  
Sbjct: 127 GLEQKLPIEDLLFDFSTRSGLDEIRNFSELFSVARKSGGELETIIRRSSELIHDKIGISE 186

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++  LS   +    I+  +PF +   +  +SP ++ +L     G +L+       L+ + 
Sbjct: 187 EILTLSAARRYEQRIMNLIPFLLLLYMKLSSPDFLRILYETAAGRILMSFCLFLYLLAVR 246

Query: 178 VMRLMINFDV 187
           +   +++ +V
Sbjct: 247 LSERILDIEV 256


>gi|330816718|ref|YP_004360423.1| Flp pilus assembly protein TadB [Burkholderia gladioli BSR3]
 gi|327369111|gb|AEA60467.1| Flp pilus assembly protein TadB [Burkholderia gladioli BSR3]
          Length = 329

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 84/184 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
             I  R  K +   P+ LD +VR V  G  V  A    +G +  P+R    +V      G
Sbjct: 146 RRISARRLKIVRQLPSFLDGVVRLVTLGNSVPAAFQGALGTTEMPLRLCLDQVSRMLRTG 205

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + +  ++  + +   ++E     +V+ +  + GG     L  +S  +RD +  + +++A+
Sbjct: 206 VEIDRAMLHIAKEYRIREFELVGSVLRLSVKYGGRADVMLERMSTFMRDLEQAERELRAM 265

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAW++G LP  V + V  T+P Y   +  +  G ++L VA     IG  ++  M
Sbjct: 266 SAETRLSAWVLGLLPIAVGSFVVSTNPKYFMAMWMNESGRVVLYVAFILQAIGGFMLYRM 325

Query: 183 INFD 186
               
Sbjct: 326 ARLR 329


>gi|330953056|gb|EGH53316.1| type II secretion system protein [Pseudomonas syringae Cit 7]
          Length = 294

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/184 (24%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    + R  + +   P  LD  VRS+++G  ++DAV   +  +  P++    R+     
Sbjct: 109 VSWRYEVRVRRMIQQLPQLLDHTVRSLKSGRTLADAVLHGIDATDQPLKDGMSRIERNVQ 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+SL ++           E   F+  + V  + GGN SE + NL +++RDR+    +++
Sbjct: 169 LGVSLPDAARDFAELYERDEFHLFAIGLRVNHRYGGNASELMENLIKLIRDREQAGRQLR 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + +A ++  LP  ++      +P Y+  + +D  G ++L +A A  + G +V+ 
Sbjct: 229 AMTGETRMTALVLALLPITMAGYFLAVNPSYLLHMWDDDSGKIMLSMAFALQVTGCVVLW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLR 292


>gi|255281814|ref|ZP_05346369.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267487|gb|EET60692.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 245

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 83/189 (43%), Gaps = 6/189 (3%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIET 58
           +KKR  +    F   +  +  ++ AG  V +A    + +          +  EFR ++  
Sbjct: 57  MKKRQRELSAQFLAGMQSVSVALSAGCSVENAFGEALRELRQLYEEDAMIVREFRYIVVQ 116

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
             +  SL + ++ +     ++++  F+ + S   + GGNL   + N  + +  ++  + +
Sbjct: 117 LGMNRSLEQLLTGLAVRSGIEDIRNFADIFSAAKRTGGNLIAIIRNTVQCISQKEETRRE 176

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +       +    I+  +P  +   V   SPG+++V+ ++P G +++ +      +  + 
Sbjct: 177 INTCLSAKRLEQNIMSIVPCMILVYVQMVSPGFLDVMYHNPAGILIMSICLLVYFLAWLW 236

Query: 179 MRLMINFDV 187
            R +++ +V
Sbjct: 237 GRKIVSIEV 245


>gi|261251594|ref|ZP_05944168.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
 gi|260938467|gb|EEX94455.1| flp pilus assembly protein TadB [Vibrio orientalis CIP 102891]
          Length = 302

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/181 (24%), Positives = 88/181 (48%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             K++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG 
Sbjct: 117 RKKQQIEEFEQSIVQVLGLISRAVSAGLSVPQAISQVAESQGGLLGREFSRIEDQLALGH 176

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            +  +++     +P +   +F+  + +    GG L E L +LSR L D + M+ KV++L+
Sbjct: 177 GMRYTLNEACIRLPYKAFRYFTIALVLNQSNGGQLREILHSLSRTLHDNRTMQKKVKSLT 236

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + +A  +  LP  +  +V + +P    +LI    G  +L   A  +++G + +++M 
Sbjct: 237 SEPRMAARFLSLLPLGLLAVVAWINPSLFVLLIKTETGQSVLIYCAVSIVLGAITLQVMT 296

Query: 184 N 184
            
Sbjct: 297 K 297


>gi|332534352|ref|ZP_08410193.1| Flp pilus assembly protein TadB [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036171|gb|EGI72645.1| Flp pilus assembly protein TadB [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 291

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 78/178 (43%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           + AKF   F   ++ +   +  GL +  ++      +   ++ +   +++   +G     
Sbjct: 112 KLAKFEHHFLEFIETVQSCLSTGLSLQQSMQFADEHADPYIKKQSSLLLQRMSMGSDAET 171

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           S + ++     + V  F+  I   +Q   +L++ L ++  ++  R   + +++A     K
Sbjct: 172 SFAPLIERYNCETVRLFAHSIITHTQSQCDLTDMLKSVCNMMSLRTLDRQQLKAKLSGTK 231

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            +A   G LP+ +  L  +T P +   L+NDP G   + VA    L G + +RL +  
Sbjct: 232 YAAVFSGFLPYALIPLFSYTDPTWFEPLLNDPNGIAFITVALLCQLFGFLWLRLSLRV 289


>gi|190574782|ref|YP_001972627.1| putative type II secretion/pilus assembly transmembrane protein
           [Stenotrophomonas maltophilia K279a]
 gi|190012704|emb|CAQ46332.1| putative type II secretion/pilus assembly transmembrane protein
           [Stenotrophomonas maltophilia K279a]
          Length = 313

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 84/182 (46%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
               K  A+ L   P+ LD +VR    G  +  A  V   Q+S P+R      +     G
Sbjct: 130 RRTTKLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYARSG 189

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           + L  ++S   +   +  +   S VI V  ++GG   + L  +   +RD +  + ++ A 
Sbjct: 190 MDLDRALSLAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELAAT 249

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + SAW++G LP   + L+  +SP +   +++DP GH +L +A    L G  ++  +
Sbjct: 250 TSETRMSAWVLGLLPPASAVLMAISSPEFFQPVLHDPLGHKILLIALGLELFGAFLLYRL 309

Query: 183 IN 184
             
Sbjct: 310 AK 311


>gi|84501671|ref|ZP_00999843.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390292|gb|EAQ02851.1| type II/IV secretion system protein, TadC subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 330

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 66/148 (44%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +     +R  +  + FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V  
Sbjct: 159 INKRQAQRQEEITNGFPDALDMLLVCVEAGQSMDQAILRVAKEIRVSYPSLADEFELVSH 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  +  M     + +++ F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 219 EIKAGKDKASVLGDMAERCGVPDIASFVTVLIQSASFGTSVADALRVYASEMRDKRVMRA 278

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  +  K +   +      +  ++ 
Sbjct: 279 EEKANKLPTKMTLATMMLTVPPLLIILI 306


>gi|238923483|ref|YP_002936999.1| hypothetical protein EUBREC_1103 [Eubacterium rectale ATCC 33656]
 gi|238875158|gb|ACR74865.1| Hypothetical protein EUBREC_1103 [Eubacterium rectale ATCC 33656]
          Length = 286

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 76/193 (39%), Gaps = 7/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRR 54
           ++ +IKK+  +    F + L+ +  S+ AG  V D+   +             + SE   
Sbjct: 95  IQSIIKKQKNQLNKQFRDMLEALSTSLGAGKNVIDSFRSVYDDMKMQYEDGAYIISELEL 154

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++      + + + +         +++  F+ V  +  + GGN+ + + +   IL D+  
Sbjct: 155 LLSGMDNNIDIEDLLLDFGERSGNEDIESFAKVFQICYRKGGNIKDTVRSTYEILNDKME 214

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +   ++ +    K    ++  +P  +  ++   SP +    +  P G M   VA    + 
Sbjct: 215 IAEDIETVVTANKTEQNVMLIMPIGLIGMMKLMSPDFAENFV-SPSGIMATTVAVIIFVA 273

Query: 175 GIMVMRLMINFDV 187
              + R ++   +
Sbjct: 274 AYFIGRKVLEIKI 286


>gi|84687272|ref|ZP_01015152.1| type II/IV secretion system protein, TadC subfamily protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664705|gb|EAQ11189.1| type II/IV secretion system protein, TadC subfamily protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 324

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 72/159 (45%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   +  R  +  + FP+ALD+++  V AG  +  A+  +  +       +  EF  V  
Sbjct: 161 VTRRVDSRKEEITNGFPDALDMMLVCVEAGQSLDQAIIRVAKEIRAGYPALADEFEIVSW 220

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     + +V  F TV+   +  G +++EAL   +  +RD++ M+A
Sbjct: 221 EIKAGKDRIQVLRDMGERCGVADVQSFVTVLIQSTSFGTSIAEALRVYAGEMRDKRVMRA 280

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A ++  K + A ++ ++P  +  L+  +       L
Sbjct: 281 EEKANTLPTKMTLATMMLTVPPLLIILIGPSVYEVYKTL 319


>gi|260892677|ref|YP_003238774.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
 gi|260864818|gb|ACX51924.1| Type II secretion system F domain protein [Ammonifex degensii KC4]
          Length = 283

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 82/164 (50%), Gaps = 1/164 (0%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
                 ++  ++RAG  V  AV   V  +  P++ E   ++    LG SL E++    R 
Sbjct: 110 LEGVCGVMATALRAGQDVMSAVEGSVKYARPPLKRELEELVAEVKLGRSLGEAVENFARK 169

Query: 76  MPLQEVSFFSTVISV-QSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            P  E    +  +++ Q   G  + +AL +++  +R+R  +K +V+A +   + SA ++G
Sbjct: 170 WPSPETRLLAYAVTLAQRMGGQAVPKALLSVTSSVRERLELKHQVRAKTTYQRVSAVVVG 229

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++P     +++F +PG++  L+  P G     V  A +++G ++
Sbjct: 230 AVPLWCLGVMWFLNPGFLGSLLETPGGRACFTVGVALLVVGWLL 273


>gi|317500896|ref|ZP_07959107.1| hypothetical protein HMPREF1026_01050 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897694|gb|EFV19754.1| hypothetical protein HMPREF1026_01050 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 205

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 83/193 (43%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP------VRSEFRR 54
           ++ L +KR  +F   F NA+  +  +++AG  V +A+       +        +R EFR+
Sbjct: 13  LRDLCRKREKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 72

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 73  MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 132

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + +     + 
Sbjct: 133 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENAAGRCFMTICLIAYIA 192

Query: 175 GIMVMRLMINFDV 187
                R +I+ +V
Sbjct: 193 AYSFGRKIIHIEV 205


>gi|160893700|ref|ZP_02074484.1| hypothetical protein CLOL250_01254 [Clostridium sp. L2-50]
 gi|156864685|gb|EDO58116.1| hypothetical protein CLOL250_01254 [Clostridium sp. L2-50]
          Length = 301

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
              I+KR  +   +F + +  +  S+ AG    +A      +       S  +  E + V
Sbjct: 110 SRCIEKRQRQLYVEFKDMVQSLAASMGAGYAFENAFTAAYEEMRKLYGDSGLIVKELKWV 169

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           I    +   +   +  M     ++E+S F+ V+ V  + GGN+   +   +  +  +  +
Sbjct: 170 IRGLRMHEDIEYLLQDMGERSGVREISEFAQVVGVAKRTGGNMVHIMKATAADISRKMEV 229

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++Q +    K    I+  +PF +   +   +  Y+++L  +  G +++ +  A  ++ 
Sbjct: 230 ELEIQTMIAAKKYEQKIMLIVPFFILAYLRIANGSYIHILYENIAGRLIMTICLAVSILS 289

Query: 176 IMVMRLMINFDV 187
               R MI   V
Sbjct: 290 AAWSRKMIRIGV 301


>gi|218132582|ref|ZP_03461386.1| hypothetical protein BACPEC_00441 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992308|gb|EEC58311.1| hypothetical protein BACPEC_00441 [Bacteroides pectinophilus ATCC
           43243]
          Length = 248

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 75/192 (39%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           + L K+   +    F + +  +  S+  G  + +A      +          +  EFR +
Sbjct: 57  RELAKREDERLAGAFKDGIIAVSFSLNVGYSIENAFREAYKEMQMLYGSESRIAKEFRII 116

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                   ++ + +        ++++ +F+ V     + GG+L   + N + ++RD+  +
Sbjct: 117 CNRMAQNENIEDILEDFAAESGVEDILYFAQVFRYAKRSGGDLMSIIRNTASVIRDKNEV 176

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
              ++ +    +    ++  +PF +   +   SP ++  L  +  G  ++    A   + 
Sbjct: 177 AEDIRTIISGRRMEQMVMNFVPFGIIVYLRLASPEFIEPLYGNAAGVAVMTGCLAVYALA 236

Query: 176 IMVMRLMINFDV 187
           I + R + +  V
Sbjct: 237 IALGRKITDIKV 248


>gi|299529715|ref|ZP_07043152.1| type II secretion system protein [Comamonas testosteroni S44]
 gi|298722578|gb|EFI63498.1| type II secretion system protein [Comamonas testosteroni S44]
          Length = 405

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 57/182 (31%), Gaps = 11/182 (6%)

Query: 4   LIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            IKKR      K    D       +   ++AG+P+  +  ++    ++  V      +  
Sbjct: 51  KIKKRRTRGGKKIKPKDIALFTRQLATMMKAGVPLLQSFDIVGRGNTNPNVTKLLNDIRS 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +  +          +     +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLSAAFRKFPL-----YFNSLYCNLVEAGEAAGILESLLDRLATYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     LL +  +   +   
Sbjct: 166 KIKSALMYPTSVMIVAFVVVTVIMIFVIPAFKEVFTSFGADLPAPTLLVMGISDYFVQYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 36.3 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 39/131 (29%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + +      R+      G SL+ +++       
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNYLYKNATDRIQSEVSTGTSLTVAMANA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G +   L   +       +      +  ME     ++   + 
Sbjct: 330 -NIFPSMVLQMCAIGEESGAIDHMLGKAADFYESEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|220913152|ref|YP_002488461.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860030|gb|ACL40372.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 285

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 75/183 (40%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   KKRTA     +P+ +D +  ++RAGLP+ +A+  +  +  + +R  FR       
Sbjct: 94  LRWRAKKRTALLRQLWPDVVDHLRSAIRAGLPLPEALIQLGDKGPEELRPVFREFGADYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G     S+ ++   +           + +  +  G +L + L  L+  LR+    ++++
Sbjct: 154 AGGQFDGSLDKLKNRLADPVADRIVEALRLTREVGGSDLGKLLGTLAEFLRENARTRSEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  L+  T P  +    N   G  +L       L     M
Sbjct: 214 EARQSWTVNAARLAVAAPWIVMLLL-ATRPEAVQA-YNTAIGAAVLLGGLVISLACYSTM 271

Query: 180 RLM 182
             +
Sbjct: 272 LRI 274


>gi|37680190|ref|NP_934799.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
 gi|37198937|dbj|BAC94770.1| Flp pilus assembly protein TadB [Vibrio vulnificus YJ016]
          Length = 294

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 93/178 (52%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
             +F    P+ +D + R+V+ G P+ D    +  Q     +  F  + +   LG S+   
Sbjct: 116 INEFNTQMPDIIDSMERAVKVGAPLHDIFFALSEQYQGSAKRLFLAMHDRLKLGHSVERV 175

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           +    + MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M+++V+ ++ E++ 
Sbjct: 176 MQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMESRVRTITSESRT 235

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++++R +  F 
Sbjct: 236 SAKVLAILPPALIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLLLIRQLTKFK 293


>gi|295395217|ref|ZP_06805425.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971979|gb|EFG47846.1| type II secretion system protein [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 290

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 70/185 (37%), Gaps = 5/185 (2%)

Query: 4   LIKKRTAKFLDD--FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            I+ R         +P A+D +   VRAGL + +AV  +  +    +R  F         
Sbjct: 100 KIRARKTSVSRRTLWPEAIDHLSSGVRAGLSLPEAVCGLSARGPVALRPLFEVFAREYRA 159

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQ 120
             S S +++R                + +  +  G +L   L  LS+ LR+    +A++ 
Sbjct: 160 TGSFSLALNRFKESAADPVADRMVAALHITREVGGTDLGAMLKTLSQFLREDARTRAELT 219

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A        A +  + P+ V  L+  T P   +   N  +G +LL V     L    VM+
Sbjct: 220 ARQSWTVTGAKLGVAAPWVVLGLL-ATRPETADA-YNTAQGTVLLVVGLVISLCAYSVMK 277

Query: 181 LMINF 185
            +   
Sbjct: 278 RIGRL 282


>gi|198284410|ref|YP_002220731.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666085|ref|YP_002427078.1| tight adherence protein TadB, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248931|gb|ACH84524.1| type II secretion system protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518298|gb|ACK78884.1| tight adherence protein TadB, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 313

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 85/186 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++ I  R +  +   P  LD +VR+ R G  +  A+      +  PVR  F +++  Q 
Sbjct: 128 IRYRIGLRRSAAILALPGFLDAVVRASRVGASLPAALLSATKDAHGPVREVFNQIMRRQQ 187

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  + +++  + +   +QE++  +TV+ +  + GG     L  ++  LR R   +A+  
Sbjct: 188 SGTPIDQAMLTVGKRYQMQELAIIATVLRLNMRYGGRTDVVLERIADWLRGRVMAQAEFN 247

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E +  A I+  +   ++  +   +  Y+  +     G MLL      ++ G++++ 
Sbjct: 248 ALSAETRLGALILSLMIPGLALYIVLMNHSYLQGMWAVSTGRMLLVAGGTLLVTGVVLLN 307

Query: 181 LMINFD 186
            M    
Sbjct: 308 RMAKLR 313


>gi|163801323|ref|ZP_02195222.1| Flp pilus assembly protein TadB [Vibrio sp. AND4]
 gi|159174812|gb|EDP59612.1| Flp pilus assembly protein TadB [Vibrio sp. AND4]
          Length = 289

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 92/184 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    K +  F D F  +L +I R++ +G  ++ ++      +   +R EF R+I+  +
Sbjct: 102 LKEYHAKLSNYFEDKFAFSLRMISRNLISGRTIAASIESASRHTMGKIRIEFERIIKQIN 161

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G +L E+++      P +  + FS  + +  + GG++ ++L  L++ L   + ++ K  
Sbjct: 162 AGNTLEEALTTGENIYPYKGYTVFSANVKMSLKRGGSIKDSLDELAQDLVASQVIRKKTL 221

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           +L+ E++ +A I+  LPF +  ++   +      L  +  G  ++      + IG ++++
Sbjct: 222 SLTSESRGAAKILAVLPFIMLLVLKSFAVENFEYLFGEQYGKYIIIYVVTSVSIGFVLIK 281

Query: 181 LMIN 184
            MI+
Sbjct: 282 RMID 285


>gi|264676897|ref|YP_003276803.1| type II secretion system protein [Comamonas testosteroni CNB-2]
 gi|262207409|gb|ACY31507.1| type II secretion system protein [Comamonas testosteroni CNB-2]
          Length = 405

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 57/182 (31%), Gaps = 11/182 (6%)

Query: 4   LIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            IKKR      K    D       +   ++AG+P+  +  ++    ++  V      +  
Sbjct: 51  KIKKRRTRGGKKIKPKDIALFTRQLATMMKAGVPLLQSFDIVGRGNTNPNVTKLLNDIRS 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +  +          +     +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLSAAFRKFPL-----YFNSLYCNLVEAGEAAGILESLLDRLATYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     LL +  +   +   
Sbjct: 166 KIKSALMYPTSVMIVAFVVVTVIMIFVIPAFKEVFTSFGADLPAPTLLVMGISDYFVQYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 35.9 bits (81), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 39/131 (29%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + +      R+      G SL+ +++       
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNYLYRNATDRIQSEVSTGTSLTVAMANA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G +   L   +       +      +  ME     ++   + 
Sbjct: 330 -NIFPSMVLQMCAIGEESGAIDHMLGKAADFYESEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|110833083|ref|YP_691942.1| hypothetical protein ABO_0222 [Alcanivorax borkumensis SK2]
 gi|110646194|emb|CAL15670.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 268

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 75/182 (41%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            +  +KR     +  P  +D ++R + AG  +  A+   +  +         R+      
Sbjct: 81  NYRYQKRRRLIFESTPEVIDDVIRGIDAGRSLEQALVNALNDAPKVFFPLLFRLRSAVES 140

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +  I    +   +  ++F +  +   S  G  +   L  +SR LR ++ M+ +  A
Sbjct: 141 GRDYTGLIDDFSKLYRIPPLTFVAVALRTSSHYGSAVRPVLKKVSRSLRSQQEMRREFLA 200

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + E + +A     LP  +   +   +  + +VL++   G  +L  +   +++G +++  
Sbjct: 201 ATAETRFTAMAFAVLPLVIGASLIGLNESFRDVLLDTESGQKMLMTSIGLIVVGTIIVFR 260

Query: 182 MI 183
           M+
Sbjct: 261 MV 262


>gi|188592035|ref|YP_001796633.1| type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938409|emb|CAP63396.1| Type II secretion system protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 308

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 91/182 (50%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q  G
Sbjct: 125 HRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQNSIANTEAPLRQCLVQAVHLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L +++ ++ R   ++E+   ++V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KELDQAVLQVGRAYKVEELVLVASVLRLSVRYGGRADVVMERTATFMRDREQAQRELMAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAW++G LP  V+  ++  + GY+ ++  DP G  +L  AAA  + G +++  +
Sbjct: 245 SAETRLSAWVLGLLPLVVAGGLFTLNAGYILMMWKDPTGKTMLLSAAALEVAGALMLYRL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|311111714|ref|YP_003982936.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
 gi|310943208|gb|ADP39502.1| type II secretion system protein [Rothia dentocariosa ATCC 17931]
          Length = 284

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 73/183 (39%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  K R  K    +P+A+D +  ++RAGL + +A+  +  +    +R  F R      
Sbjct: 93  VNHRAKVREGKLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           +   +   G +L   L  LS  LR+    +A++
Sbjct: 153 ATGDFVASLNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           QA       +A +    P+ V  L+       +  + N   G +L+   A   +I   +M
Sbjct: 213 QARQSWTVNAARLACVAPWVVLMLMAT--QPAVRNIYNSFAGFVLMFAGAGLSVIAYRIM 270

Query: 180 RLM 182
             +
Sbjct: 271 LRI 273


>gi|300741823|ref|ZP_07071844.1| putative bacterial type II secretion system protein F domain
           protein [Rothia dentocariosa M567]
 gi|300381008|gb|EFJ77570.1| putative bacterial type II secretion system protein F domain
           protein [Rothia dentocariosa M567]
          Length = 284

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 73/183 (39%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  K R  K    +P+A+D +  ++RAGL + +A+  +  +    +R  F R      
Sbjct: 93  VNHRAKVREGKLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           +   +   G +L   L  LS  LR+    +A++
Sbjct: 153 ATGDFVASLNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           QA       +A +    P+ V  L+       +  + N   G +L+   A   +I   +M
Sbjct: 213 QARQSWTVNAARLACVAPWVVLMLMAT--QPAVRNIYNSFAGFVLMFAGAGLSVIAYRIM 270

Query: 180 RLM 182
             +
Sbjct: 271 LRI 273


>gi|320156057|ref|YP_004188436.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
 gi|319931369|gb|ADV86233.1| flp pilus assembly protein TadB [Vibrio vulnificus MO6-24/O]
          Length = 294

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 93/178 (52%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
             +F    P+ +D + R+V+ G P+ D    +  Q     +  F  + +   LG S+   
Sbjct: 116 INEFNMQMPDIIDSMERAVKVGAPLHDIFFALSEQYQGSAKRLFLAMHDRLKLGHSVERV 175

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           +    + MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M+++V+ ++ E++ 
Sbjct: 176 MQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMESRVRTITSESRT 235

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++++R +  F 
Sbjct: 236 SAKVLAILPPALIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLLLIRQLTKFK 293


>gi|153853656|ref|ZP_01995036.1| hypothetical protein DORLON_01027 [Dorea longicatena DSM 13814]
 gi|149753811|gb|EDM63742.1| hypothetical protein DORLON_01027 [Dorea longicatena DSM 13814]
          Length = 258

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 66/182 (36%), Gaps = 6/182 (3%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIETQHLGLSL 65
           F   F   +  +  ++  G  V +A      +          +  E   +     + + +
Sbjct: 77  FQKQFREMIQTLSSALNTGYSVENAFYETQKELKIQYPEEARISRELLLITRKLRMHIPV 136

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            + +      +P ++V  F TV     + GG++   + N +  + D+  +K ++  L   
Sbjct: 137 EQVLEEFAEKVPSEDVKSFVTVFVTAKKSGGDMIGIIRNTTSQIGDKIEVKREIDTLLAA 196

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
            K    I+  +P+ +   +  +   +M  L  +  G  ++ +     +    +   ++  
Sbjct: 197 KKYEFQIMSMVPYGIIAYMSLSFSDFMEELYGNVTGIGVMTLCLGIYVGAYYLGVRLLRI 256

Query: 186 DV 187
           DV
Sbjct: 257 DV 258


>gi|27365655|ref|NP_761183.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
 gi|27361803|gb|AAO10710.1| Flp pilus assembly protein TadB [Vibrio vulnificus CMCP6]
          Length = 294

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 93/178 (52%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
             +F    P+ +D + R+V+ G P+ D    +  Q     +  F  + +   LG S+   
Sbjct: 116 INEFSMQMPDIIDSMERAVKVGAPLHDIFFALSEQYQGSAKRLFLAMHDRLKLGHSVERV 175

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
           +    + MP QE  F +T++S+QS+ GG LS  L  L + LR+R  M+++V+ ++ E++ 
Sbjct: 176 MQFAAQQMPSQEFRFLTTLLSLQSETGGKLSHMLKQLGQTLRERSLMESRVRTITSESRT 235

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
           SA ++  LP  +  ++Y ++  + + L+ D  G  +L      ++ G++++R +  F 
Sbjct: 236 SAKVLAILPPVLIGVLYGSAKEHFDYLLRDATGQWILLYVVLSVVTGLLLIRQLTKFK 293


>gi|255264846|ref|ZP_05344188.1| type II secretion system protein [Thalassiobium sp. R2A62]
 gi|255107181|gb|EET49855.1| type II secretion system protein [Thalassiobium sp. R2A62]
          Length = 323

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 73/159 (45%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +    + R     + FP++LD+++  V AG  +  ++  +  +       + SE+  V  
Sbjct: 160 VTKRQQTRQEAITNGFPDSLDMMLVCVEAGQSLDQSILRVSQELKSGFPDLASEYEIVSH 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  +  M     + +++ F TV+      G +++EAL   +  +RD++ M+A
Sbjct: 220 EMKAGKDKTSVLRDMSERCGVPDIASFVTVLIQSQSFGTSIAEALRVYAGEMRDKRVMRA 279

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A ++  K + A ++ ++P  +  L+  +  G    L
Sbjct: 280 EEKANTLPTKMTLATMMLTVPPLLIILIGPSVYGIAETL 318


>gi|33596972|ref|NP_884615.1| hypothetical protein BPP2379 [Bordetella parapertussis 12822]
 gi|33566423|emb|CAE37676.1| putative membrane protein [Bordetella parapertussis]
          Length = 306

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 77/179 (43%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K    + +   P  LD +VR +  G  V+ A    +G    P+    +R       G  L
Sbjct: 126 KADRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVRSGKDL 185

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ ALS E
Sbjct: 186 DAALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELTALSAE 245

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + SAWI+  LP  ++  +   +      + +DP G  LL  A      G   +  M  
Sbjct: 246 VRLSAWILALLPIGLALFIIIFNNQLFMGMWHDPMGFRLLVFAMLLQAGGSYWLYRMAR 304


>gi|221068971|ref|ZP_03545076.1| type II secretion system protein [Comamonas testosteroni KF-1]
 gi|220713994|gb|EED69362.1| type II secretion system protein [Comamonas testosteroni KF-1]
          Length = 405

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 56/182 (30%), Gaps = 11/182 (6%)

Query: 4   LIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            IKKR      K    D       +   ++AG+P+  +  ++    ++  V      +  
Sbjct: 51  KIKKRRTRGGKKIKPKDIALFTRQLATMMKAGVPLLQSFDIVGRGNTNPNVTKLLNDIRS 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +  +                +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLSAAFRKFPL-----YFDSLYCNLVEAGEAAGILESLLDRLATYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     LL +  +   +   
Sbjct: 166 KIKSALMYPTSVMIVAFVVVTVIMIFVIPAFKEVFTSFGADLPAPTLLVMGISEYFVQYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 35.9 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 39/131 (29%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + +      R+      G SL+ +++       
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNYLYKNATDRIQSEVSTGTSLTVAMANA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G +   L   +       +      +  ME     ++   + 
Sbjct: 330 -NIFPSMVLQMCAIGEESGAIDHMLGKAADFYESEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|87310970|ref|ZP_01093095.1| hypothetical protein DSM3645_15370 [Blastopirellula marina DSM
           3645]
 gi|87286260|gb|EAQ78169.1| hypothetical protein DSM3645_15370 [Blastopirellula marina DSM
           3645]
          Length = 317

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 93/184 (50%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           H   +RT       P A   I R++RAG  +  A+ ++      P+  EF    E QHLG
Sbjct: 136 HRRLQRTEMLTQQLPEAFSAISRALRAGQGLPTAIQMVANDFPKPLSEEFTHYYEQQHLG 195

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
           ++   ++  MVR + + E+  F+  + VQ + GGNL+E L  L+ ++R R  ++ +V+AL
Sbjct: 196 VANEVALRDMVRRVDVMELRIFAVALIVQQRAGGNLAELLKKLADLIRKRVKLRRRVKAL 255

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E +  A ++ ++P  V   +   +P Y +VL      + +L   A    IG  ++  +
Sbjct: 256 TGEGRMQAVVLIAMPVLVLAALAVVAPDYSSVLWEH---YEILIGCAISQCIGAFLISRI 312

Query: 183 INFD 186
           +N D
Sbjct: 313 VNID 316


>gi|33593027|ref|NP_880671.1| hypothetical protein BP1999 [Bordetella pertussis Tohama I]
 gi|33563402|emb|CAE42279.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382439|gb|AEE67286.1| hypothetical protein BPTD_1969 [Bordetella pertussis CS]
          Length = 306

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 77/179 (43%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           K    + +   P  LD +VR +  G  V+ A    +G    P+    +R       G  L
Sbjct: 126 KADRRRMVHQLPTFLDALVRLITIGNSVNAAFQNALGSVEQPLLEVLQRADSQVRSGKDL 185

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
             ++ ++ R   L+E+   S VI++  + GG   + L  ++  +RD +  + ++ ALS E
Sbjct: 186 DAALHQVSRQYQLRELFLVSAVIALALRFGGRSDQVLERMAAFMRDLEQARDELTALSAE 245

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + SAWI+  LP  ++  +   +      + +DP G  LL  A      G   +  M  
Sbjct: 246 VRLSAWILALLPIGLALFIIIFNNQLFMGMWHDPMGFRLLVFAMLLQAGGSYWLYRMAR 304


>gi|224824220|ref|ZP_03697328.1| type II secretion system protein [Lutiella nitroferrum 2002]
 gi|224603639|gb|EEG09814.1| type II secretion system protein [Lutiella nitroferrum 2002]
          Length = 314

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   ++ R  +  ++FP+A+D+++  V AGL +  A+  +  +    S  +  E   V  
Sbjct: 148 LSRRVENRQREIFNNFPDAIDLLLVCVEAGLGLDAALLKVGEEMRIKSPILADELHLVNL 207

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +     +QEV     ++    + G ++ E+L   +  LR ++ ++A
Sbjct: 208 ELRAGSTKERALRNLAIRTGVQEVDTLVAMLIQSDRFGTSIGESLRVHADDLRTKRRLRA 267

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           +  A  +        I    P  +  L+         VL+    G
Sbjct: 268 EEAAAKIPLKLLFPLIFCIFPALLLVLLGPAFIQIYRVLLPTLGG 312


>gi|163840095|ref|YP_001624500.1| flp pilus assembly protein [Renibacterium salmoninarum ATCC 33209]
 gi|162953571|gb|ABY23086.1| type II secretion system protein [Renibacterium salmoninarum ATCC
           33209]
          Length = 284

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 77/183 (42%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   K+R A   + +P+ +D +  ++RAGL +++A+  +  +  +P+R  FR       
Sbjct: 93  VRRRAKRRIAVLRELWPDVVDHLRSAIRAGLSLAEALIQLAEKGPEPLRPYFRDFGADYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G S   S+  +   +           + +  +  G +L   L  LS  LR+    ++++
Sbjct: 153 AGGSFETSLDLLKERLADPVADRIFEALRLTREVGGSDLGLLLGTLSEFLRESARTRSEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A I  + P+ V  L+       +    N P G +LL       ++   +M
Sbjct: 213 EARQSWTVNAARIAVAAPWIVLVLLAAQPNALLA--YNSPSGWILLLAGLIISVVCYRLM 270

Query: 180 RLM 182
             +
Sbjct: 271 LRI 273


>gi|307295328|ref|ZP_07575167.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306878831|gb|EFN10050.1| Type II secretion system F domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 297

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 91/185 (49%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   + R    ++  P  +D + +    G  ++ A+   +  +   V      V     
Sbjct: 111 VRRRAQVRVEALIEALPYYIDAVRQMQAVGNSLAQALDRALADAPGVVWGFIAPVARRLE 170

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG  +++++  +   + + E+S  +  I    + GG++S  L NL+ ILR+R  +K +++
Sbjct: 171 LGAPVADAMQMLAERLRVPEISMLAAAIRTNMRYGGSISAVLLNLANILRERIRIKRELK 230

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A   EA+ S  ++  +P     L+   +PGY++  + DPRGH L  VA A   +G++VMR
Sbjct: 231 AAISEARISGRVLIVMPLAAMALLVAMNPGYVDFFLRDPRGHRLALVAMALQGMGMLVMR 290

Query: 181 LMINF 185
            ++  
Sbjct: 291 RVMRL 295


>gi|148655425|ref|YP_001275630.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567535|gb|ABQ89680.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 311

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IKKR    +   P+ALD++   V AGL    A+  +  +  DP+  EF+RV+    
Sbjct: 151 LGQQIKKRKKAIVKALPDALDLLCICVEAGLSFDQAMQRLTEKWDDPLSKEFKRVLSDTR 210

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG    +++  M+    + +V  F   +    QLG ++   L   S  +R R+  +A+ +
Sbjct: 211 LGRPRRDAMKDMIDRCGVDDVQTFIGAVIQAEQLGVSIGRILRIQSDQMRIRRRQRAEEE 270

Query: 121 ALSMEAKA-SAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           A     K     +    P     ++    P  M  L  
Sbjct: 271 AHKAPIKMLFPMVFLIFPALFIVILGPAVPRIMKSLGG 308


>gi|331089204|ref|ZP_08338106.1| hypothetical protein HMPREF1025_01689 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330405756|gb|EGG85285.1| hypothetical protein HMPREF1025_01689 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 249

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 83/193 (43%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP------VRSEFRR 54
           ++ L +K+  +F   F NA+  +  +++AG  V +A+       +        +R EFR+
Sbjct: 57  LRDLCRKKEKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 116

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 117 MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 176

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + +     + 
Sbjct: 177 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENATGRCFMTICLIVYIA 236

Query: 175 GIMVMRLMINFDV 187
                R +I+ +V
Sbjct: 237 AYSFGRKIIHIEV 249


>gi|153815434|ref|ZP_01968102.1| hypothetical protein RUMTOR_01669 [Ruminococcus torques ATCC 27756]
 gi|145847293|gb|EDK24211.1| hypothetical protein RUMTOR_01669 [Ruminococcus torques ATCC 27756]
          Length = 205

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 83/193 (43%), Gaps = 6/193 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP------VRSEFRR 54
           ++ L +K+  +F   F NA+  +  +++AG  V +A+       +        +R EFR+
Sbjct: 13  LRDLCRKKEKEFRVQFSNAIQAMGAALKAGYSVENAIREAEKDLAPMYEENVRIRKEFRK 72

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++    + +     + +    M  ++   F TV S     GG+    + N  +I+  + +
Sbjct: 73  MVHQLDMKMPAVSVMEQFSERMKQEDTEDFVTVFSSAKMSGGDSISIIRNAVKIISGKID 132

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
            + ++Q +    K    I+ ++PF +   +  T   +++VL  +  G   + +     + 
Sbjct: 133 TEQEIQTMFASKKLEFEIMCAVPFFIILYMKLTFGEFLSVLYENAAGRCFMTICLIVYIA 192

Query: 175 GIMVMRLMINFDV 187
                R +I+ +V
Sbjct: 193 AYSFGRKIIHIEV 205


>gi|220927957|ref|YP_002504866.1| Flp pilus assembly protein TadB-like protein [Clostridium
           cellulolyticum H10]
 gi|219998285|gb|ACL74886.1| Flp pilus assembly protein TadB-like protein [Clostridium
           cellulolyticum H10]
          Length = 247

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 85/193 (44%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA-------VIVGQSSDPVRSEFRR 54
           K +I+KR  +    F + L  +  S+ AG P+  A         V+       +  E + 
Sbjct: 55  KQIIEKRKNELNLQFKDLLISLSSSLSAGKPLEKAFVGALSDLYVLYPSDDAYIVRETKI 114

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +I    L +S+ E++S       + ++  FS VI +  + GGNL +A+ N SRI+ ++  
Sbjct: 115 IINKLSLNVSIEEAVSDFAERSDIDDIKNFSDVIIICKRTGGNLVDAIKNSSRIISEKIE 174

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           M  +++ L    K    ++  +P  +  ++  T+  Y+N +     G +   +    +  
Sbjct: 175 MAQEIETLLSSRKLEQKVLNIMPIAMIFILSTTATEYINPVFTTVTGRIAATLCLILLTA 234

Query: 175 GIMVMRLMINFDV 187
              + + +IN  +
Sbjct: 235 AYFISKRIINIKM 247


>gi|72162675|ref|YP_290332.1| integral membrane protein [Thermobifida fusca YX]
 gi|71916407|gb|AAZ56309.1| putative integral membrane protein [Thermobifida fusca YX]
          Length = 273

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 60/140 (42%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
            +KR  +     P+ LD++  +V AGL    A+A +       + SEF+  +    LG S
Sbjct: 117 KRKRQEEIQKQLPDFLDVLAVTVSAGLSFRQALARVADAMPGVLASEFQLALRQMELGTS 176

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             ++ + +      + +  F T +    +LG  LS+ L  LS  +R       + +A  +
Sbjct: 177 RRDAFAALRERNSNEALGRFITALQQAEELGAPLSQTLHALSTDMRREDAQFLRRKAQHL 236

Query: 125 EAKASAWIIGSLPFCVSTLV 144
             + +A    ++   +  ++
Sbjct: 237 NPRVTAVTAATMLPGLLLII 256


>gi|254483273|ref|ZP_05096505.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
 gi|214036496|gb|EEB77171.1| Bacterial type II secretion system protein F domain [marine gamma
           proteobacterium HTCC2148]
          Length = 283

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 81/174 (46%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
               + +  +  S+++G+ +  A + +V     P+  EF  + E    G  +  ++    
Sbjct: 110 AQTADVMTALSASIKSGMTIEQAFSEMVDNMYPPISEEFALIRERIDAGQPVIAAVKSAD 169

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             + +  +S     I +  + GG L+  +  L+   R+ + ++ +V+  +   + SA I+
Sbjct: 170 ERLQVPRLSLIFQTICISLERGGRLASLMDRLAESTREIERVEERVRTETAGLRLSARIM 229

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             +PF +  L+Y   P  + +L ++  G+++L +A A  +    +M+ +I  D+
Sbjct: 230 FLMPFFICGLLYLIEPDQVMLLFDNLVGNIVLVIAIAMDISAYFIMKKLIELDI 283


>gi|331003046|ref|ZP_08326558.1| hypothetical protein HMPREF0491_01420 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413090|gb|EGG92465.1| hypothetical protein HMPREF0491_01420 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 227

 Score = 87.5 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 85/192 (44%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K LI  +  K + +F  A+ II   + AG  + +++   + +        + +  EF  +
Sbjct: 36  KELINVKKRKLVLEFKEAIMIISSLLSAGYSLENSIKEALVELRLLYSKDNLIIKEFEYI 95

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
            +  ++ +S+  +   +      +++  F+ V+ +  + GG L   +++   ++ D+  +
Sbjct: 96  NQLIYMNISVERAFDDLAYRSHSEDIRSFAKVLRIAKRSGGELVSIISHTVNVIADKVRI 155

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K ++  ++   +    ++   P  +   +  +SPG+ N++     G + +       L  
Sbjct: 156 KEEIITMTAAKRFEQSVMNVFPLFIVLYIDISSPGFFNIMYTTIIGRICMSFGLIMYLFA 215

Query: 176 IMVMRLMINFDV 187
           I + + ++N +V
Sbjct: 216 IYISKGLLNIEV 227


>gi|94312589|ref|YP_585798.1| type II secretion system protein, pilus assembly, transmembrane
           part [Cupriavidus metallidurans CH34]
 gi|93356441|gb|ABF10529.1| type II secretion system protein, pilus assembly, transmembrane
           part [Cupriavidus metallidurans CH34]
          Length = 309

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 50/181 (27%), Positives = 87/181 (48%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            I++   K L   P  LD +VR +  G  V  A    V  +  P+R    +VI  Q  G 
Sbjct: 127 RIRRIKEKMLRQLPGFLDGVVRLMTIGSSVPAAFQNSVANTEPPLRQCLVQVIHLQRAGK 186

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L +++ +M R   L E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS
Sbjct: 187 ELDQAVLQMGRAYDLDELVIVSSVLRLSQRYGGRADVVMERTATFMRDREEAQRELMALS 246

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAW++G LP  V   ++  + GY+ ++  DP G  +L  AA   + G  ++  + 
Sbjct: 247 AETRMSAWVLGLLPLIVGGGMFVFNAGYILLMWRDPGGRAMLLTAAGLEVAGAFLLYRLA 306

Query: 184 N 184
            
Sbjct: 307 R 307


>gi|116694143|ref|YP_728354.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
 gi|113528642|emb|CAJ94989.1| flp pilus assembly protein TadB [Ralstonia eutropha H16]
          Length = 308

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 89/182 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           + +++   K L   P  LD +VR +  G  V  A    +  +  P+R    + +  Q  G
Sbjct: 125 NRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQNSIANTEAPLRQCLVQAVHLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L +++ ++ R   ++E+   ++V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KELDQAVLQVGRVYKVEELVLVASVLRLSVRYGGRADVVMERTAAFMRDREQAQRELMAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LP  V+  ++  + GY+ ++  DP G  +L  A A  + G  ++  +
Sbjct: 245 SAETRLSAWILGLLPLVVAGGLFMLNAGYILMMWKDPTGKTMLLSALALEIAGAFMLYRL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|49085940|gb|AAT51316.1| PA4301 [synthetic construct]
          Length = 295

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 94/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        
Sbjct: 109 LGMLYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVL 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ 
Sbjct: 169 LGIHLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLH 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SA+++  +P  +   +  ++PGY+  +  D  G  LL  +    L+G   + 
Sbjct: 229 AMTGETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTGRFLLLASLGLQLLGCYALW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLK 292


>gi|159043673|ref|YP_001532467.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
 gi|157911433|gb|ABV92866.1| type II secretion system protein [Dinoroseobacter shibae DFL 12]
          Length = 331

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 69/159 (43%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I KR  +  + FP++LD+++  V AG  +  A+  +  +       +  EF  V  
Sbjct: 167 VDKRIDKRQEEITNGFPDSLDLMLVCVEAGQGLDQAIIRVAHEIRAGYPDLADEFEMVAF 226

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M     + +V+ F TV+      G ++++AL   +  +RD++ M+A
Sbjct: 227 EIKAGKDKITVLKDMAERCGVGDVTSFVTVLIQSQSFGTSIADALRVYAGEMRDKRVMRA 286

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K     ++ ++P  +  L+  +       L
Sbjct: 287 EEKANVLPTKLTLGTMMFTVPPLLIILIGPSMWSIYESL 325


>gi|329905443|ref|ZP_08274133.1| type II secretion system protein [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547600|gb|EGF32398.1| type II secretion system protein [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 161

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 89/161 (55%)

Query: 27  VRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFST 86
           +RAG+ ++ A   +V +S  P+  EF  ++  Q LG++L +S++ + R +P    +   +
Sbjct: 1   MRAGVGLNAATQQLVAESQPPLAQEFSLMLREQRLGVTLEQSLTNLSRRIPTTTTTLVVS 60

Query: 87  VISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYF 146
            + + ++ GG L+EAL   S  +R R  M+ K+ AL+ + K  AW++G LP  +  ++  
Sbjct: 61  AMRIAAETGGGLAEALERTSHTVRSRLQMEGKIGALTAQGKLQAWVVGMLPLSLMAVLNK 120

Query: 147 TSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             P  M+ L +   G   L V A   ++G++++R ++  DV
Sbjct: 121 MEPESMSYLWHSQVGWATLAVIAFLEIMGVVLIRKIVAIDV 161


>gi|89901674|ref|YP_524145.1| type II secretion system protein [Rhodoferax ferrireducens T118]
 gi|89346411|gb|ABD70614.1| type II secretion system protein [Rhodoferax ferrireducens T118]
          Length = 405

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 60/182 (32%), Gaps = 10/182 (5%)

Query: 3   HLIKKRTAKFL----DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-VRSEFRRVIE 57
            + K+R          D       +   ++AG+P+  A  ++   + +P V      +  
Sbjct: 51  KIKKRRMRAGKSIKPKDLAIFTRQLATMMKAGVPLLQAFDIVGRGNPNPSVTKLLNDIRT 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +  +                +    +  G L + L  L+  +   + +K+
Sbjct: 111 DVETGTSLSVAFRKFPL-----YFDNLYCNLIEAGESAGILDQLLDRLAVYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V        +    D     L+ +A + + +   
Sbjct: 166 KIKSALMYPISVLIVAFVVTAVIMIFVVPAFKEVFSNFGADLPAPTLVVIAISEIFVKYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227


>gi|20094143|ref|NP_613990.1| hypothetical protein MK0706 [Methanopyrus kandleri AV19]
 gi|19887150|gb|AAM01920.1| Predicted membrane protein [Methanopyrus kandleri AV19]
          Length = 362

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 69/180 (38%), Gaps = 2/180 (1%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           LI++R  +     P A+  +   V AGL + +++  I       +  EF RVI   + G 
Sbjct: 177 LIRRREGEIARQLPYAIRQMATEVSAGLSLIESMKSISESDYGALSEEFERVIREINSGT 236

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            ++ ++ RM     +  +      I+   + G N+++ L  L+  +      + +     
Sbjct: 237 PINVALQRMANRWNVDGLRTMVRFITQAMESGANIAKTLMTLADEIAHELRQRYREYGHK 296

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMN--VLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           ++A A  +I+ +L       V       ++   L+  P    ++      M    + +  
Sbjct: 297 LQALAFPYIMLTLVIPTLVTVAMLLAANLSGAFLVPPPLFGPMIAGMVGVMAGIFLFIFK 356


>gi|284048519|ref|YP_003398858.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952740|gb|ADB47543.1| Type II secretion system F domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 309

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 74/146 (50%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H+I+ R  K +   P+ LD++  SV+AGL +  A+  +V +   P+  EFRR++    
Sbjct: 153 LNHIIRNRQTKIIRQLPDVLDLLSISVQAGLSLDGAMRKVVERMEGPLIDEFRRMLRDVR 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G++   S+  M R   +Q+V  F   +    +LG ++S+ L   +  +RD +  +A+ Q
Sbjct: 213 MGMTRRRSMQLMARRCDVQDVYLFVMSVVQSERLGASMSDTLVIQADNMRDLRRQRARTQ 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYF 146
           A+    K    ++  +   +  +V  
Sbjct: 273 AMKAPVKMIFPLVFCIFPAIFVVVLL 298


>gi|283457756|ref|YP_003362343.1| Flp pilus assembly protein TadB [Rothia mucilaginosa DY-18]
 gi|283133758|dbj|BAI64523.1| Flp pilus assembly protein TadB [Rothia mucilaginosa DY-18]
          Length = 315

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 73/183 (39%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  +   A+    +P+A+D +  ++RAGL + +A+  +  +  + +R  F        
Sbjct: 124 VNHRARAADARIWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPEELRDAFAHFSRDYR 183

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           +   +   G +L + L  LS  LRD    ++++
Sbjct: 184 ASGEFVPSLNRLKEYLSDPVADTIIEALKIAREVGGSDLGKLLGTLSDFLRDNARTRSEL 243

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A       +A +    P+ V  L+         ++ N   G ML+   AA  L    +M
Sbjct: 244 LARQSWTVNAARLSCVAPWFVLCLMAT--QPAARMVYNSFAGAMLMIAGAAISLAAYRLM 301

Query: 180 RLM 182
             +
Sbjct: 302 LRI 304


>gi|15599497|ref|NP_252991.1| TadB [Pseudomonas aeruginosa PAO1]
 gi|107100115|ref|ZP_01364033.1| hypothetical protein PaerPA_01001136 [Pseudomonas aeruginosa PACS2]
 gi|218893393|ref|YP_002442262.1| TadB [Pseudomonas aeruginosa LESB58]
 gi|254244888|ref|ZP_04938210.1| hypothetical protein PA2G_05761 [Pseudomonas aeruginosa 2192]
 gi|9950523|gb|AAG07689.1|AE004846_6 TadB [Pseudomonas aeruginosa PAO1]
 gi|126198266|gb|EAZ62329.1| hypothetical protein PA2G_05761 [Pseudomonas aeruginosa 2192]
 gi|218773621|emb|CAW29435.1| TadB [Pseudomonas aeruginosa LESB58]
          Length = 294

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 94/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        
Sbjct: 109 LGMLYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVL 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ 
Sbjct: 169 LGIHLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLH 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SA+++  +P  +   +  ++PGY+  +  D  G  LL  +    L+G   + 
Sbjct: 229 AMTGETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTGRFLLLASLGLQLLGCYALW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLK 292


>gi|312883758|ref|ZP_07743477.1| Flp pilus assembly protein TadB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368507|gb|EFP96040.1| Flp pilus assembly protein TadB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 302

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 88/182 (48%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
              K++  +F       L +I R+V AGL V  A++ +       +  EF R+ +   LG
Sbjct: 116 MRKKQQIEEFEQSMVQVLGLISRAVSAGLSVPQAISQVTESQGGLMSREFSRIEDQLALG 175

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             +  +++     +P +   +F+  + +    GG L E L +LSR L + + M+ KV++L
Sbjct: 176 HGMRYALNEACIRLPYKAFRYFTIALLLNQSNGGQLREILHSLSRTLHENRAMQKKVKSL 235

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           + E + +A  +  LP  + TLV + +P    +LI    G  +L   A  +L+G + + LM
Sbjct: 236 TSEPRTAARFLSLLPLGLLTLVAWINPSLFLLLIETEPGQSVLIYCAVSILVGAITLHLM 295

Query: 183 IN 184
             
Sbjct: 296 TK 297


>gi|160878194|ref|YP_001557162.1| Flp pilus assembly protein TadB-like protein [Clostridium
           phytofermentans ISDg]
 gi|160426860|gb|ABX40423.1| Flp pilus assembly protein TadB-like protein [Clostridium
           phytofermentans ISDg]
          Length = 247

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 77/192 (40%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           + + + R  K   +F + +  +  ++ AG  V +A    +            +  EF+ +
Sbjct: 56  RKMAEDRKKKLNTEFLDGIHSLSVALEAGYSVENAFKAAIKDLGLMYSKEALIMKEFQCI 115

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           +   +  + +  +I        L++V  FS V     + GG+L   +    + + ++  +
Sbjct: 116 VSQINHNIPIENAIGEFANRSKLEDVECFSEVFKTAKRTGGDLVAIIKMTGKTIGEKVEV 175

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
             +++ L    K  A I+  +PF +   +   SP ++  L ++  G + + +     L  
Sbjct: 176 MREIETLITAKKMEANIMKLVPFGILGYMLLGSPQFLKPLYHNLFGIIFMTILLGIYLFL 235

Query: 176 IMVMRLMINFDV 187
             ++  +I   V
Sbjct: 236 TKLVDKIIAIRV 247


>gi|325264273|ref|ZP_08131004.1| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. D5]
 gi|324030344|gb|EGB91628.1| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. D5]
          Length = 224

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 75/188 (39%), Gaps = 6/188 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRVIETQ 59
           +++  +F + F  ++  +  ++  G  V +AV                +R EF R+I   
Sbjct: 37  REKEQEFREQFRVSIQTMASALNIGYSVENAVRETARDLKPLFRRDSRIRKEFERMIHQL 96

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
            +   + + +S +   +  ++V  F  V S   + GG+    L +  R + D+   + ++
Sbjct: 97  DINQPVEQVMSELADRVSQEDVENFVIVFSAAKRTGGDSISILRSAVRDISDKIEAEKEI 156

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           Q L    K    ++  +PF +   +    P +M VL  +  G  L+ V          + 
Sbjct: 157 QTLLASKKLEFKVMCIIPFGILFYMRLAFPEFMQVLYGNLAGAALMTVCLGIYAAAYRMG 216

Query: 180 RLMINFDV 187
             ++  +V
Sbjct: 217 EKLVEIEV 224


>gi|332284567|ref|YP_004416478.1| type II secretion system protein [Pusillimonas sp. T7-7]
 gi|330428520|gb|AEC19854.1| type II secretion system protein [Pusillimonas sp. T7-7]
          Length = 282

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 99/187 (52%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  + K R  +F +  P+ L  +  ++RAG  +  A+  IV QS  P+  EF  ++  Q 
Sbjct: 96  IGRIRKLRLQRFDEQLPDLLQALAGALRAGAGLQSALKHIVAQSPAPLSQEFGLMLRQQR 155

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+   ++++ + R MP +      + +++ +Q GGNL+E L +++  LR R  + ++VQ
Sbjct: 156 MGIGFEQALADLYRRMPFEGTGLVVSALTIAAQSGGNLAETLESIAATLRARLRLLSRVQ 215

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+ + +  AWI+  LP  ++ ++++  P  M  L   P G  ++       ++GI  +R
Sbjct: 216 ALTSQGRLQAWIMAGLPPVLAIVLHYLDPDSMRALWETPAGWSVVAAIVTMEVLGIWFIR 275

Query: 181 LMINFDV 187
            ++   +
Sbjct: 276 RIVAITI 282


>gi|260427288|ref|ZP_05781267.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
 gi|260421780|gb|EEX15031.1| type II/IV secretion system protein, TadC subfamily [Citreicella
           sp. SE45]
          Length = 324

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 71/148 (47%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   +++R  +  + FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +  
Sbjct: 161 ITKRVEERKKQIEEGFPDALDMMLVCVEAGQSLDQSIVRVSKELRASYPALADEFEIISH 220

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   S  ++ M     +Q+VS F TV++  +  G ++++AL   +  +RD++ M+A
Sbjct: 221 EMRAGKDKSNVLNDMGERCGVQDVSSFVTVLNQAANFGTSIADALRIYASEMRDKRVMRA 280

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  +  K +   +      +  ++ 
Sbjct: 281 EEKANKLPTKMTLTTMMLTVPPLLIILV 308


>gi|269126091|ref|YP_003299461.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
 gi|268311049|gb|ACY97423.1| type II secretion system protein [Thermomonospora curvata DSM
           43183]
          Length = 307

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 71/149 (47%), Gaps = 2/149 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           +R  +     P+ LD++V SV AGL    A+  +   +S P+  E  RV++   +G S +
Sbjct: 155 RRQEELKRSLPDTLDLLVVSVEAGLGFDAALTRVAQHTSGPLAEELARVLQEIRIGKSRT 214

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           E++  M   + ++EV  F   +   S+LG ++   L   +R  R ++  +A+  A  +  
Sbjct: 215 EALRSMGERVAVEEVRTFIAALVQASELGMSIGVVLREQAREARLKRRQRAEEMAQKVPV 274

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           K    ++  +   +   +    PG ++++
Sbjct: 275 KVMFPVVLCILPALI--ITVVGPGVLSIM 301


>gi|254466278|ref|ZP_05079689.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
 gi|206687186|gb|EDZ47668.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium Y4I]
          Length = 326

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 76/158 (48%), Gaps = 4/158 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I++R  K  + FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V  
Sbjct: 164 ITRRIEERKQKITEGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPDLAEEFEVVAY 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M     +Q++S F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 224 EMKAGKEKDRVLRDMGTRCGVQDISSFVTVMIQSASFGTSIADALRVYAGEMRDKRVMRA 283

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
           +  A  +  K + A +  ++P  +  LV  +  G MN+
Sbjct: 284 EEAANKLPVKMTLATMGLTVPPLLIILVGPSIQGIMNM 321


>gi|119717342|ref|YP_924307.1| type II secretion system protein [Nocardioides sp. JS614]
 gi|119538003|gb|ABL82620.1| type II secretion system protein [Nocardioides sp. JS614]
          Length = 304

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 1/149 (0%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R+ +     P+A+D++  SV AGL    AV  +   +  P+  E  RV+    LG S S 
Sbjct: 156 RSERIRRALPDAIDLLTISVEAGLGFDAAVQQVAQHTEGPLADELSRVLREMQLGQSRSA 215

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           ++  +     + E+  F   +     LG  +++ L   SR +R ++   A+ +A  +  K
Sbjct: 216 ALRSLSARTTVPELRGFVGAMVQADALGIPIAQVLRVQSREIRVKRRQHAEERAQQVPVK 275

Query: 128 AS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
            +   I   LP     ++       M+  
Sbjct: 276 ITVPLIFCILPCLFVVVLGPAVLNIMDTF 304


>gi|91788419|ref|YP_549371.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91697644|gb|ABE44473.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 314

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 71/165 (43%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +K+LI +R  +  + FP+ALD++   V AGL +  A+A +  +    S  +  E + V  
Sbjct: 148 LKNLISRRQREIFESFPDALDLMTVCVEAGLAMDAALARVASEIGLKSAVLSEELQLVTL 207

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++  +     + +V     ++    + G +++++L   S  LR ++  +A
Sbjct: 208 ELRAGSSKEKALRNLALRTGVDDVDALVAMLIQSERFGTSIADSLRVQSDQLRTKRRQRA 267

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + QA  +        I    P  +  L+         VL+    G
Sbjct: 268 EEQAAKIALKLLFPLIFFIFPSLLVVLMGPAFIQIYRVLLPTMAG 312


>gi|163857688|ref|YP_001631986.1| putative Flp pilus assembly protein [Bordetella petrii DSM 12804]
 gi|163261416|emb|CAP43718.1| putative Flp pilus assembly protein [Bordetella petrii]
          Length = 307

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 75/181 (41%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
              +R  +  D  P  LD +VR +  G  ++ A       +S+P+R    +         
Sbjct: 125 RADRRRGRMFDQLPEMLDTMVRLITIGNSMAAAFQAASANTSEPLREVVEKAAHLSRSTQ 184

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  +++ + R    +E+   + V+ V  + GG     L  ++  +RD    + ++ A S
Sbjct: 185 ELDAALANVARQYGFEELRLLAAVVRVAQKYGGRSDVVLERIAAFMRDVAQARGELVAAS 244

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAW++  +P  ++  +  T+      + +DP G  +L  A    L G   +  M 
Sbjct: 245 AEIRLSAWVLALMPLGIACYIMLTNNAMFMDMWDDPLGFKMLMAALGLQLAGSYWLYRMT 304

Query: 184 N 184
            
Sbjct: 305 K 305


>gi|116052335|ref|YP_792646.1| hypothetical protein PA14_55880 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254239029|ref|ZP_04932352.1| hypothetical protein PACG_05206 [Pseudomonas aeruginosa C3719]
 gi|296391000|ref|ZP_06880475.1| hypothetical protein PaerPAb_22729 [Pseudomonas aeruginosa PAb1]
 gi|313106820|ref|ZP_07793032.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
 gi|115587556|gb|ABJ13571.1| putative pilus assembly protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170960|gb|EAZ56471.1| hypothetical protein PACG_05206 [Pseudomonas aeruginosa C3719]
 gi|310879534|gb|EFQ38128.1| putative pilus assembly protein [Pseudomonas aeruginosa 39016]
          Length = 294

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 94/184 (51%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L ++R  + +   P  LD +VRS+ AG  + DA+   V  + +P+R  F        
Sbjct: 109 LGMLYQRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVENAEEPLRDIFTLARNHVL 168

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+ L E++  +     ++E+   +  +SV  + GGN S+ L ++ +++ +R+ +  ++ 
Sbjct: 169 LGIHLPEALQEVAELYEVEELRILALGVSVNHRYGGNTSDLLDSIVKLIHEREKLSRQLH 228

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A++ E + SA+++  +P  +   +  ++PGY+  +  D  G  LL  +    L+G   + 
Sbjct: 229 AMTGETRISAYVLAGVPSALGGYILASNPGYLLNMWADGTGRFLLLASLGLQLLGCYALW 288

Query: 181 LMIN 184
            M+ 
Sbjct: 289 RMLK 292


>gi|85707698|ref|ZP_01038764.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
 gi|85689232|gb|EAQ29235.1| hypothetical protein NAP1_00645 [Erythrobacter sp. NAP1]
          Length = 333

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 61/148 (41%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +K+   KRT +     P+ALD++V    AGL V  A   +  +   +   +  EF     
Sbjct: 171 LKNKADKRTKEIQKGLPDALDLLVICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAI 230

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     + + +   + L+ V    T +    + G  L+ AL  LS   R+ + M+A
Sbjct: 231 ELSFLNERKMAFNNLAYRVDLEAVKGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRA 290

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 291 EEKAARLPAIMTVPLILFILPVLFIVIL 318


>gi|87312288|ref|ZP_01094386.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
 gi|87284992|gb|EAQ76928.1| probable secretion system protein TadC [Blastopirellula marina DSM
           3645]
          Length = 309

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 63/148 (42%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           + +L KKR  +     P+ALD++V  V AGL +  A+  +  +       +  EF     
Sbjct: 143 LWYLGKKRKEQIFRGLPDALDLMVVCVEAGLGLDQAMRRVSEEMKKTYRVIAEEFGLCNF 202

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              +G   S+ +  +     + ++   + ++    + G ++S+AL   S  +R R+   A
Sbjct: 203 QLQVGRQRSDVLHELGNRTGVDDLRSLAAILIQADKFGSSISQALRVQSDSMRTRRRQIA 262

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A     K    ++  +   +  ++ 
Sbjct: 263 EEKAAKTAVKMIFPLVFFIFPGIFVVLV 290


>gi|154505644|ref|ZP_02042382.1| hypothetical protein RUMGNA_03183 [Ruminococcus gnavus ATCC 29149]
 gi|153794083|gb|EDN76503.1| hypothetical protein RUMGNA_03183 [Ruminococcus gnavus ATCC 29149]
          Length = 232

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 77/188 (40%), Gaps = 6/188 (3%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRVIETQ 59
           K++  +F + F  ++  +   ++ G  V +A+     +          +  E+  ++   
Sbjct: 45  KQKKEEFREQFRESIQTLSAILKVGYSVENAIRETWKEICPIYKKKTRIIKEYETMVHQL 104

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
            L ++  E + +    +  ++V  F TV     +LGG+    + + +  + ++  ++ ++
Sbjct: 105 DLNMTAEEVMKQFADRVKEEDVENFVTVFGAAKRLGGDSIAIIRHAADAIGEKMEVEREI 164

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           Q +    K    I+  +PF +   +    P +M VL  +  G + + +     L    + 
Sbjct: 165 QVMLTSKKLEFKIMCVIPFVIILYMRSAFPEFMAVLYGNLAGTLFMTICLMVYLTAYQLG 224

Query: 180 RLMINFDV 187
           + M   +V
Sbjct: 225 KKMTQIEV 232


>gi|184200571|ref|YP_001854778.1| hypothetical protein KRH_09250 [Kocuria rhizophila DC2201]
 gi|183580801|dbj|BAG29272.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 285

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 81/183 (44%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++    +RTA   + +P+ +D +  ++RAG+ + +A+  +  +  +P+R  F R      
Sbjct: 94  VRRRAHRRTAVLREVWPDVVDHLRSAIRAGMGLPEALMQLQYRGPEPLRPAFARFAADYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
               L  S++ + + +           + V  +  G +L + L  LS  LR+ +  ++++
Sbjct: 154 ASGQLHGSLTMLKQRLADPVADNIVEALRVTREVGGTDLGKLLGTLSEFLRENERTRSEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ +  L+  T P  +    N P G ++L    A  +    +M
Sbjct: 214 EARQSWTVNAARLSVAAPWLILGLM-ATQPAAVQA-YNTPAGAVVLLGGLAVSVAAYQLM 271

Query: 180 RLM 182
             +
Sbjct: 272 LRL 274


>gi|126729093|ref|ZP_01744907.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
 gi|126710083|gb|EBA09135.1| type II/IV secretion system protein, TadC subfamily [Sagittula
           stellata E-37]
          Length = 324

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 68/148 (45%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   ++KR  +    FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +  
Sbjct: 161 ITKRMEKRKEEIQQGFPDALDMMLVCVEAGQSMEQSIIRVAKELRASYPALADEFEIISH 220

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   S+ ++ M      Q+VS F TV++     G ++S+AL   +  +RD++ M+A
Sbjct: 221 EMKAGKDRSQVLNDMSERCGSQDVSSFVTVLNQAQTFGTSISDALRVYAGEMRDKRVMRA 280

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           +  A  +  K +   +      +  ++ 
Sbjct: 281 EEAANKLPTKMTLTTMMLTVPPLLIILV 308


>gi|291521739|emb|CBK80032.1| Flp pilus assembly protein TadB [Coprococcus catus GD/7]
          Length = 240

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA------VIVGQSSDPVRSEFRRV 55
           +   K R      +F +A  ++  S  AG  +  A+            S   +  EF R+
Sbjct: 49  RMREKSRKQMLWHEFKDAAAMLYSSTAAGGTLEKALRDTCCDMKTSDSSYQVLLPEFERI 108

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                   SL   +         +++++F  V++V  + GG+LS  + + +  +  R  +
Sbjct: 109 CMHLDQNRSLESVLEDFAVRSEDEDIAYFVRVLTVARKSGGSLSSIIRHTADTMNLRMEI 168

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
            ++++ +    +    I+  +P  +   +   S  YMN+L     G +++  A       
Sbjct: 169 NSEIETILAGKRGEWRIMLIVPPGILCYMNMCSSEYMNILYTGLTGRLVMTAALMVYAAA 228

Query: 176 IMVMRLMINFDV 187
           +     +++  V
Sbjct: 229 LWTGHKILDIHV 240


>gi|239817190|ref|YP_002946100.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239803767|gb|ACS20834.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 409

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 58/185 (31%), Gaps = 11/185 (5%)

Query: 1   MKHLIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRR 54
           +   IKKR           D       +   ++AG+P+  +  ++    ++  V      
Sbjct: 52  LASKIKKRRMRSGKSIKPKDIAIFTRQLATMMKAGVPLLQSFDIVGRGNANPSVAKLLND 111

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +      G SLS +  +  +             +    +  G L + L  L+  +   + 
Sbjct: 112 IRSDVETGTSLSSAFRKFPK-----YFDNLYCNLVEAGEAAGILEDLLDRLATYMEKTEA 166

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K+K+++  M   +   +   +   +   V             D     L  +A +   +
Sbjct: 167 IKSKIKSALMYPTSVVVVAFVVVAIIMIFVIPAFKQVFTSFGADLPAPTLFVMAMSEFFV 226

Query: 175 GIMVM 179
               +
Sbjct: 227 SYWWL 231



 Score = 35.9 bits (81), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 43/131 (32%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVR-SEFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + V      ++ +    G SL+ +++ +     
Sbjct: 279 WTRTLATMFAAGVPLVEALDSVGGASGNTVYGDATAKIQQEVSTGTSLTTAMTNV----- 333

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     ++   +  G++   L   +       +      +  ME     ++   + 
Sbjct: 334 -NLFPSMVIQMTAIGEESGSIDHMLGKAADFYESEVDDMVAGLSSLMEPIIIVFLGVIIG 392

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 393 GIVVSMYLPIF 403


>gi|152986618|ref|YP_001350204.1| hypothetical protein PSPA7_4868 [Pseudomonas aeruginosa PA7]
 gi|150961776|gb|ABR83801.1| hypothetical protein PSPA7_4868 [Pseudomonas aeruginosa PA7]
          Length = 293

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 44/179 (24%), Positives = 91/179 (50%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + +   P  LD +VRS+ AG  + DA+   V  + DP+R  F        LG+ L
Sbjct: 113 RRRLKRMIRQMPRFLDQVVRSLHAGRTLGDALMQAVEDAEDPLRDIFGLARNHVLLGIHL 172

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            E++  +     ++E+   +  +SV  + GGN ++ L  + R++ +R+ +  ++ A++ E
Sbjct: 173 PEALQEVAELYEVEELRILALGVSVNHRYGGNTTDLLDGIVRLIHEREKLSRQLHAMTGE 232

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            + SA+++  +P  +   +  ++PGY+  +  D  G  LL  +    L+G   +  M+ 
Sbjct: 233 TRISAYVLAGVPSALGGYILASNPGYLLNMWADGSGRFLLLASLGLQLLGCYALWRMLK 291


>gi|291615154|ref|YP_003525311.1| type II secretion system F domain protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291585266|gb|ADE12924.1| Type II secretion system F domain protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 405

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/172 (12%), Positives = 50/172 (29%), Gaps = 6/172 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLS 66
           R      D       +   +++G+P+  A  ++     +  V      +      G SL 
Sbjct: 59  RGKVTEKDITLFTRQLATMLKSGVPLLQAFDIVGKGHDNPAVSRLLFDIKTDVETGSSLE 118

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +S  +                +    +  G L   L  L+        +K+K+++     
Sbjct: 119 QSFRKFPL-----YFDDLYCNLLGAGEAAGILDSLLDRLATYKEKILAIKSKIKSALFYP 173

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
            +   I   +   +   V        +    D  G  L+ +A +   +    
Sbjct: 174 ISIIVIAFVITAVIMIFVIPAFKDLFSNFGADLPGPTLVVMAISDFFVAWWW 225



 Score = 42.8 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 17/160 (10%), Positives = 44/160 (27%), Gaps = 19/160 (11%)

Query: 2   KHLIKKRTAKFLDDFPNA------------LDIIVRSVRAGLPVSDAVAVIVGQSSDPV- 48
              +++R  + +   P                 +     AG+P+ +A   + G + + V 
Sbjct: 245 NKTMQRRMDQLMLKIPVFGPLVRKASIARWSRTLATMFAAGVPLVEAFDSVAGAAGNAVY 304

Query: 49  RSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRI 108
               + +      G SL+ ++                  +    +  G L   L  ++  
Sbjct: 305 YDATKAIQREVTSGTSLTVAMQN------TDAFPSMVLQMVAIGEESGALDAMLGKVADF 358

Query: 109 LRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTS 148
                +   +  +  ME      +   +   V  +     
Sbjct: 359 FEAEVDDAVEALSSLMEPVIMVVLGTLIGGMVVAMYLPIF 398


>gi|291087379|ref|ZP_06346291.2| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. M62/1]
 gi|291075554|gb|EFE12918.1| putative bacterial type II secretion system protein F domain
           protein [Clostridium sp. M62/1]
          Length = 268

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 78/179 (43%), Gaps = 6/179 (3%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRVIETQHLGLSLSES 68
            F  A+ ++  S+ AG  + ++ +    Q  +       +  EF  +     L  +L E 
Sbjct: 90  QFKEAVLMLSSSLAAGYSMENSFSQAEIQLRELYGERAMMADEFSDMRRQLSLNRTLEEL 149

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
            S       ++E+  F+ ++    + GG +   +++++ I+  +  ++ +++ ++ + + 
Sbjct: 150 WSDFADRSGVEEIRSFALILRSARRNGGRMGAVISHIAEIIGGKLQVQEEIRTMTAQKQF 209

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
              I+  LP  +   +  TSPG+ + +     G +++ V  A      ++   M+  ++
Sbjct: 210 EQKIMNLLPILIVLYIDVTSPGFFDSMYETTVGRIVMTVCLAVYAGAYVLAGRMLEIEI 268


>gi|114798130|ref|YP_761686.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
 gi|114738304|gb|ABI76429.1| type II secretion system protein [Hyphomonas neptunium ATCC 15444]
          Length = 339

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%), Gaps = 5/156 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + +L +KR    +  FP+ALD+++  V AG+ +      +  +   +S  +  EF   + 
Sbjct: 162 ISNLAQKRQKSLMRAFPDALDMLLICVEAGMSIEMGFNKVSQEIGSASPELAEEFGITVA 221

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +      + V      +    + G  L +AL  +++  R+ +  +A
Sbjct: 222 ELSYLPDRRLAYENLALRTGHEGVKAVCMALGQAERYGTPLGDALRMMAKENREMRMSEA 281

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMN 153
           + +A S+ AK +  +I      +  +V    P Y+ 
Sbjct: 282 EKKAASLPAKLTVPMILFFLPVLFLVV--LGPAYIQ 315


>gi|303241709|ref|ZP_07328206.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
 gi|302590710|gb|EFL60461.1| Type II secretion system F domain protein [Acetivibrio
           cellulolyticus CD2]
          Length = 306

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 74/157 (47%), Gaps = 2/157 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K L+  P+ LD++  SV AGL    A+A ++ +   P+  EF  V++   
Sbjct: 149 LNKQIAQRQKKILNSLPDVLDLLTVSVEAGLGFDGALAKVIDKMPGPIAIEFENVLQEMK 208

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    +++  M   + L +++ F   I    QLG ++   L   S  +R+++  +AK +
Sbjct: 209 VGKQKRDALKDMAERVGLHDLTTFVGSIIQADQLGVSIGNVLRIQSEQMREKRRQRAKEK 268

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           A+    K    ++  +   + +++    P  + V+  
Sbjct: 269 AMKAPVKMLIPMVLFIFPTIFSVL--IGPVIIKVIYT 303


>gi|194290795|ref|YP_002006702.1| type IV pilus assembly transmembrane protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224630|emb|CAQ70641.1| type IV pilus ASSEMBLY TRANSMEMBRANE PROTEIN [Cupriavidus
           taiwanensis LMG 19424]
          Length = 423

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 57/179 (31%), Gaps = 7/179 (3%)

Query: 1   MKHLIKKRTAKF-LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +K     R  K    D       +   ++AG+P+  ++ +I     +         +   
Sbjct: 70  LKKRKAARGRKITEKDIAYFTRQLSTMLKAGIPLLQSIDIIARGHVNPNFTQLLSDIRFD 129

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G S++ +  R  +             +    + GG L   L  LS  +     +K +
Sbjct: 130 IEAGSSMAAAFRRHPK-----YFDTLYCNLIDAGEQGGILDSLLERLSLYMEKTIALKGQ 184

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           +++  +   A   +  ++   +   V     G  +    +     LL +A +   +   
Sbjct: 185 IKSAMIYPIAVLTVAFAVTVILMLFVIPAFKGVFSSFGANLPAPTLLVIAISDFFVQYW 243


>gi|307943150|ref|ZP_07658495.1| type II secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773946|gb|EFO33162.1| type II secretion system protein [Roseibium sp. TrichSKD4]
          Length = 326

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 65/161 (40%), Gaps = 4/161 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +++ I+KR       +P+ALD+++  V +G+ +  A+  +  +    S  +  E      
Sbjct: 165 LQNTIEKRQKAIGRAWPDALDLMLICVESGMSIEVAMQKVADEIGVQSADLAEELTLTTA 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +     +  +      +    + G  +++AL  +S   RD++  +A
Sbjct: 225 ELSYLQDRRIAFENLGNRTGMDNIKNVVMALIQAERYGTPVAKALRAMSDDTRDQRMQEA 284

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           + +A S+  K     I+  LP   + ++       M+V+  
Sbjct: 285 EKKAASLPPKLTVPMIVFFLPVLFAVIMTPAILQIMDVMGG 325


>gi|308176985|ref|YP_003916391.1| type II secretion system protein F [Arthrobacter arilaitensis
           Re117]
 gi|307744448|emb|CBT75420.1| putative type II secretion system protein F [Arthrobacter
           arilaitensis Re117]
          Length = 283

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 72/188 (38%), Gaps = 3/188 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++H   KR A   + +P  +D +  ++RAGL + +A++ +       +R  FR       
Sbjct: 92  LRHQAAKRQAALQEQWPEVVDHLRSAIRAGLSLPEALSQLAMVGPQILRPLFRDFALDYR 151

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
              + + ++ ++   +         T + +  +  G +L   L  LS  LRD    + ++
Sbjct: 152 ATANFAVALDQLGERLADPVADKILTTLRITREVGGTDLGHTLTTLSAFLRDDVRTRGEL 211

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A      ++A +  + P+ +  ++                G ++L +      I   +M
Sbjct: 212 AARQSWIVSAARLAVAAPWILLLVLGT--QEAAKDAYMTVGGVIVLSLGMLVSFICYRIM 269

Query: 180 RLMINFDV 187
             +    V
Sbjct: 270 LRLGTLPV 277


>gi|113869209|ref|YP_727698.1| Type IV pilus assembly protein PilC [Ralstonia eutropha H16]
 gi|113527985|emb|CAJ94330.1| Type IV pilus assembly protein PilC [Ralstonia eutropha H16]
          Length = 423

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 57/179 (31%), Gaps = 7/179 (3%)

Query: 1   MKHLIKKRTAKF-LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +K     R  K    D       +   ++AG+P+  ++ +I     +         +   
Sbjct: 70  LKKRKAARGRKITEKDIAYFTRQLSTMLKAGIPLLQSIDIIARGHVNPNFTQLLSDIRFD 129

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G S++ +  R  +             +    + GG L   L  LS  +     +K +
Sbjct: 130 IEAGSSMAAAFRRHPK-----YFDTLYCNLIDAGEQGGILDSLLERLSLYMEKTIALKGQ 184

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           +++  +   A   +  ++   +   V     G  +    +     LL +A +   +   
Sbjct: 185 IKSAMIYPIAVLTVAFAVTVILMLFVIPAFKGVFSSFGANLPAPTLLVIAISDFFVQYW 243


>gi|296131925|ref|YP_003639172.1| Type II secretion system F domain protein [Thermincola sp. JR]
 gi|296030503|gb|ADG81271.1| Type II secretion system F domain protein [Thermincola potens JR]
          Length = 319

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 59/145 (40%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +  L K R  +     P+ LD +  +++AG+P+  A+  +V     P+  E +R      
Sbjct: 156 INMLAKSRQEQIALGLPDFLDGMSVTLQAGVPLDAAMNQVVNHMEGPLAEELQRFNRELE 215

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+   E+  R+V     +E+      +   S+LG  ++     ++  +R  +  K K +
Sbjct: 216 LGVPREEAYHRLVNRNECEELETLVQSLIQGSKLGVPIARTFKVMADDMRITRFNKVKEK 275

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVY 145
           A     K +      +   V   + 
Sbjct: 276 AAKASPKVTLVTSFIITPGVMLAIL 300


>gi|319795782|ref|YP_004157422.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315598245|gb|ADU39311.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 330

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 84/185 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   ++K   + +   P  +D +VR +  G     A  + +     P+R    R      
Sbjct: 145 LWLRLQKFRRQLVSQLPAYIDSMVRLITIGNSTQAAFQLAIANCEPPLRGYLDRAASLVR 204

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+ L  ++ +    + ++E+   ++++ +  + GG     L  ++  +RDR+  + ++ 
Sbjct: 205 AGVDLDRALHQTAVSVRIEEMYLLASILGLGVRYGGRADLLLERVANFMRDREQAEHELV 264

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A+S E + SAWI+G LP  V T +  ++P Y   L ND  G ML+  A    L+G   + 
Sbjct: 265 AMSSETRLSAWILGLLPVGVCTFLMISNPSYFMGLWNDGTGRMLIFSAVGLQLLGAAFLY 324

Query: 181 LMINF 185
            +   
Sbjct: 325 RLARL 329


>gi|163738365|ref|ZP_02145780.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
 gi|163742218|ref|ZP_02149606.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384548|gb|EDQ08929.1| type II/IV secretion system protein, TadC subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161388286|gb|EDQ12640.1| type II secretion system protein [Phaeobacter gallaeciensis BS107]
          Length = 326

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 72/160 (45%), Gaps = 3/160 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I++R  +    FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V +
Sbjct: 164 ITRRIEERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALADEFDIVAQ 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q+VS F TV+   +  G +++EAL   +  +RD++ M+A
Sbjct: 224 EMKAGKDKDKVMRDMGTRCGVQDVSSFVTVMIQSATFGTSIAEALRVYAGEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +  A  +  K +   +      +  ++   S   +  L N
Sbjct: 284 EEAANKLPTKMTLATMTLTVPPLLIILVGPSAQGIANLGN 323


>gi|84494454|ref|ZP_00993573.1| hypothetical protein JNB_06649 [Janibacter sp. HTCC2649]
 gi|84383947|gb|EAP99827.1| hypothetical protein JNB_06649 [Janibacter sp. HTCC2649]
          Length = 289

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 71/171 (41%), Gaps = 3/171 (1%)

Query: 16  FPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRY 75
           +P+A+D I  +VRAG+ + +AVA +  +  + +R  F+   +   +     + + R+   
Sbjct: 113 WPDAVDNITSAVRAGMSLPEAVAQLGLRGPEELRPAFQAFAQDYRITGRFHDCLDRLKER 172

Query: 76  MPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
           +           + +  +  G +L   L  LS  LR+    +++++        +A +  
Sbjct: 173 LSDPVADRLIESLRIAREVGGSDLGRLLRTLSVFLREDSRTRSELETRQSWTVNAARLAV 232

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           + P+ V  ++  T P  +    +   G ++L   A    +   VM  +   
Sbjct: 233 AAPWIVLAMLS-TRPESVQA-YSTGTGALILFFGAVMTAVAYWVMVRIGRL 281


>gi|187930139|ref|YP_001900626.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|309783039|ref|ZP_07677758.1| type IV pilus biogenesis protein PilC [Ralstonia sp. 5_7_47FAA]
 gi|187727029|gb|ACD28194.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|308918147|gb|EFP63825.1| type IV pilus biogenesis protein PilC [Ralstonia sp. 5_7_47FAA]
          Length = 424

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 59/179 (32%), Gaps = 7/179 (3%)

Query: 2   KHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQ 59
           K     R  K    D       +   ++AG+P+  ++ +I    ++         +    
Sbjct: 72  KRRRAARGKKITPKDIAYFTRQLSTMLKAGVPLLQSIDIIAKGHANPNFTQLLTEIRVDI 131

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G S++++  R  +             +    + GG L   L  LS  +     +KA++
Sbjct: 132 ESGSSMAQAFRRHPK-----YFDTLYCNLIDAGEQGGILDALLERLSLYMEKSLALKAQI 186

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++  +   +   +   +   +   V  +  G  +    D     L  +A +   +   +
Sbjct: 187 KSALIYPISVLTVAFLVTVVLMIFVVPSFKGVFSGFGADLPAPTLFVIAISDFFVKWWI 245


>gi|220923700|ref|YP_002499002.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
 gi|219948307|gb|ACL58699.1| type II secretion system protein [Methylobacterium nodulans ORS
           2060]
          Length = 321

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 58/148 (39%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +K+ I KR       +P+ALD+++  V +G+ V  A   +  +    S  +  E      
Sbjct: 163 VKNRISKRQTAIRRAWPDALDLLLICVESGMGVESAFRKVADEIGPQSPELAEELSLTTA 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +     L  V    T +    + G  + + L  L++  RD +  +A
Sbjct: 223 ELSYLPDRRKAYENLAERTGLDGVKGVVTSLIQAEKYGTPVGQTLRVLAQENRDMRMTEA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +  +I      +  ++ 
Sbjct: 283 EKKAAALPPKLTVPMILFFLPVLFAVII 310


>gi|260574611|ref|ZP_05842614.1| type II secretion system protein [Rhodobacter sp. SW2]
 gi|259023028|gb|EEW26321.1| type II secretion system protein [Rhodobacter sp. SW2]
          Length = 326

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 71/148 (47%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   +KKR A+ +  FP+ALD+++  V AG  +  ++  +  +S      +  EF  V +
Sbjct: 163 VNSRVKKRQAEIVSGFPDALDMMLVCVEAGQSMDQSIIRVARESRAGYPALADEFDMVAQ 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  +  M   + + +V+ F T +   +  G +++EAL   S  +RD++ M+A
Sbjct: 223 EIKAGKERTTVMRDMSERVGIADVASFVTTLVQSATFGTSIAEALRVYSAEMRDKRVMRA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +   +      +  ++ 
Sbjct: 283 EEKANTLPTKLTLGTMLFTLPPLLIILI 310


>gi|121593228|ref|YP_985124.1| type II secretion system protein [Acidovorax sp. JS42]
 gi|120605308|gb|ABM41048.1| type II secretion system protein [Acidovorax sp. JS42]
          Length = 405

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 56/182 (30%), Gaps = 10/182 (5%)

Query: 3   HLIKKRT---AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            + K+R     K    D       +   ++AG+P+  A  ++    ++  V      +  
Sbjct: 51  KIKKRRMSAGKKIKPKDIALFTRQMATMMKAGVPLLQAFDIVGRGNTNPSVTKLLNDIRG 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SL+ +  +                +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLNAAFRKYPM-----YFDSLYCNLVEAGEAAGILEALLDRLALYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     L  +A +   +   
Sbjct: 166 KIRSALMYPISVIIVAFVVVTIIMIFVIPAFKEVFTSFGADLPAPTLFVMAISEFFVAYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227


>gi|149915637|ref|ZP_01904163.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
 gi|149810529|gb|EDM70372.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. AzwK-3b]
          Length = 328

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 71/158 (44%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +    ++R     + FP++LD+++  V AG  +  ++  +  +   S   +  E++ V  
Sbjct: 165 VTKRQQQRQEDITNGFPDSLDMMLTCVEAGQSLDQSIVRVSNEIAASYPALAEEYQIVAN 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      ++ M     +Q++S F TV+      G ++++AL   +  +RD++ M+A
Sbjct: 225 QIKAGRDKPSVLNEMAERCGVQDISSFVTVLVQSQTFGTSIADALRVYAGEMRDKRVMRA 284

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K +   +      +  ++    P  + +L
Sbjct: 285 EEKANKLPTKMTLATMMLTVPPLLIIL--VGPSVIGIL 320


>gi|255327036|ref|ZP_05368112.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
 gi|255296253|gb|EET75594.1| type II secretion system protein [Rothia mucilaginosa ATCC 25296]
          Length = 284

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 73/183 (39%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + H  +   A+    +P+A+D +  ++RAGL + +A+  +  +  + +R  F        
Sbjct: 93  VNHRARAADARIWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPEELRDAFAHFSRDYR 152

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVI-SVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
                  S++R+  Y+           +   +   G +L + L  LS  LR+    ++++
Sbjct: 153 ASGEFVPSLNRLKEYLSDPVADTIIEALKIAREVGGSDLGKLLGTLSDFLRENARTRSEL 212

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
            A       +A +    P+ V  L+         ++ N   G ML+   AA  L    +M
Sbjct: 213 LARQSWTVNAARLSCVAPWFVLCLMAT--QPAARMVYNSFAGAMLMIAGAAISLAAYRLM 270

Query: 180 RLM 182
             +
Sbjct: 271 LRI 273


>gi|237798378|ref|ZP_04586839.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331021230|gb|EGI01287.1| type II secretion system protein, F domain [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 294

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 48/173 (27%), Positives = 92/173 (53%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
            ++  P  LD  VRS+++G  ++DAV   +  ++ P++    R+     LG+SL ++   
Sbjct: 120 MIEQLPQLLDHSVRSLKSGRTLADAVLFGITAANQPLKEGMSRIERNVQLGVSLPDAARD 179

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                   E   F+  + V  + GGN SE + NL R++RDR+    +++A++ E + +A 
Sbjct: 180 FAELYESDEFHLFALGLRVNHRYGGNASELMENLIRLIRDREQASRQLRAMTGETRMTAL 239

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           ++G LP  ++      +P Y+  + ND  G +LL +A A  L+G +++  M+ 
Sbjct: 240 VLGLLPVGMAGYFMAVNPAYLMHMWNDGSGRILLSMAFALQLLGCLMLWRMLR 292


>gi|254293219|ref|YP_003059242.1| type II secretion system protein [Hirschia baltica ATCC 49814]
 gi|254041750|gb|ACT58545.1| type II secretion system protein [Hirschia baltica ATCC 49814]
          Length = 333

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 66/157 (42%), Gaps = 5/157 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + +   KR A  +  FP++LD+++  V +G+ +  A A +  +   +S  +  E      
Sbjct: 159 LTNRADKRKASIMKAFPDSLDMMLICVESGMSIESAFAKVGEEVGTASVELAEELGLTTA 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +        +   +T +    + G  +  AL  +++  R+ + ++A
Sbjct: 219 ELSYLQERRQAYVNLADRTNHPGIKSVATALVQAEKYGTPMGTALRTMAKENREIRVLEA 278

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           + +A ++ AK +  +I      +  ++    P Y+ +
Sbjct: 279 EKKAAALPAKLTVPMIVFFLPVLFIVIGT--PAYIQI 313


>gi|291459839|ref|ZP_06599229.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417629|gb|EFE91348.1| putative bacterial type II secretion system protein F domain
           protein [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 285

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 75/191 (39%), Gaps = 7/191 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K L KKR  +    F   L+ +  ++ +G+ ++D++  +             +  E   +
Sbjct: 95  KMLQKKRITELSIQFRGFLEALAVALSSGMNMNDSLQSVYKDLVLEYTRDSWIVKETEEM 154

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
           I      + + + I  +      +++  F+TV +V  + GGN+ + +   + I+ ++  +
Sbjct: 155 ISGMRNNIPIEDMIRSLGERSDNRDIRNFATVFNVSYRAGGNIRDIVRRTADIIGEKIEI 214

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
             ++       K     +  +P  +  ++      +     + P G +    A    ++ 
Sbjct: 215 SGEIATAISSNKLQFNAMMVIPVFLILMLRAMGGNFAKS-FSTPLGVIATTFALGIFVLA 273

Query: 176 IMVMRLMINFD 186
            ++ + +++  
Sbjct: 274 FLLGQKIMDIK 284


>gi|311697135|gb|ADQ00007.1| type II secretion system protein [marine bacterium HP15]
          Length = 305

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 76/178 (42%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +++  +  ++ P+ LD ++RS+  G  V  +V       S        R+      G   
Sbjct: 122 ERQRRQIFEELPSILDGMIRSISVGRSVEQSVVAAFSDGSPVFDPLIFRLKNAVGQGRDY 181

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
           +  I        + ++   +      S+ G +L   L  +++ +R R++++ +  A + E
Sbjct: 182 TRVIDEFAALYQIPDLVQVAIAFRTSSRFGSSLRPVLMEVAKAIRSRQDLRREFMAATAE 241

Query: 126 AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + +A     +P  ++  +   + G+   L++   G  LL ++    LIGI+ +  +I
Sbjct: 242 TRFTAVAFAIIPPGLAAYMVILNDGFSAQLLDTNAGQTLLWMSGILQLIGIVFIWRLI 299


>gi|116620536|ref|YP_822692.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223698|gb|ABJ82407.1| type II secretion system protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 315

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 64/158 (40%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  + KR        P+ALD++V S+ AGL +  A+  +  +   S   +  E + V  
Sbjct: 149 LEKRVAKRQETLRLSLPDALDLLVVSIEAGLGLDQAIQHVARELYASHPQLSDEMQLVTL 208

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   SE++          E      ++    + G ++ E+L   S  LR R+  +A
Sbjct: 209 EMRAGKRRSEALRNFAERTGEAEFRKLVAILIQNDRFGTSMGESLRTHSDFLRTRRRQEA 268

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K    I   +   +  LV    PG + + 
Sbjct: 269 EERAGKVGVKLVFPIFFFILPSM--LVVAAGPGILQIF 304


>gi|222109982|ref|YP_002552246.1| type II secretion system protein [Acidovorax ebreus TPSY]
 gi|221729426|gb|ACM32246.1| type II secretion system protein [Acidovorax ebreus TPSY]
          Length = 405

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 56/182 (30%), Gaps = 10/182 (5%)

Query: 3   HLIKKRT---AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            + K+R     K    D       +   ++AG+P+  A  ++    ++  V      +  
Sbjct: 51  KIKKRRMSAGKKIKPKDIALFTRQMATMMKAGVPLLQAFDIVGRGNTNPSVTKLLNDIRG 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SL+ +  +                +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLNAAFRKYPM-----YFDSLYCNLVEAGEAAGILEALLDRLALYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     L  +A +   +   
Sbjct: 166 KIRSALMYPISVIIVAFVVVTIIMIFVIPAFKEVFTSFGADLPAPTLFVMAISEFFVAYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 34.7 bits (78), Expect = 6.2,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 41/131 (31%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSE-FRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + V +    ++ +    G SL+ ++        
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVAGASGNSVYAIATEKIQQEVSTGTSLTAAMGNA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +       +      +  ME     ++   + 
Sbjct: 330 -NVFPSMVLQMCAIGEESGSIDHMLGKAADFYEAEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|241664289|ref|YP_002982649.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|240866316|gb|ACS63977.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 420

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 59/179 (32%), Gaps = 7/179 (3%)

Query: 2   KHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQ 59
           K     R  K    D       +   ++AG+P+  ++ +I    ++         +    
Sbjct: 68  KRRRAARGKKITPKDIAYFTRQLSTMLKAGVPLLQSIDIIAKGHANPNFTQLLTEIRVDI 127

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G S++++  R  +             +    + GG L   L  LS  +     +KA++
Sbjct: 128 ESGSSMAQAFRRHPK-----YFDTLYCNLIDAGEQGGILDALLERLSLYMEKSLALKAQI 182

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++  +   +   +   +   +   V  +  G  +    D     L  +A +   +   +
Sbjct: 183 KSALIYPISVLTVAFLVTVVLMIFVVPSFKGVFSGFGADLPAPTLFVIAISDFFVKWWI 241


>gi|256827716|ref|YP_003151675.1| Flp pilus assembly protein TadB [Cryptobacterium curtum DSM 15641]
 gi|256583859|gb|ACU94993.1| Flp pilus assembly protein TadB [Cryptobacterium curtum DSM 15641]
          Length = 321

 Score = 84.4 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 91/182 (50%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
            H I++R     +  P+A+  I   + AGL      + +  +S  P++  F RV +    
Sbjct: 135 SHAIERREDALREALPDAVWSIGICLHAGLSQQQTFSRLEEESHGPLKEVFSRVSQALAA 194

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G  L E+++ +     ++E++F +T + +Q Q GG++ + L     +L    N++  +  
Sbjct: 195 GSPLDEALALLKGDGSIRELTFVATALEIQHQAGGSMKQVLETAGEMLAHETNLRRSLAV 254

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + +A+ SA ++ ++   ++ ++   S G++    +   G ++L VA +  + GIM +R 
Sbjct: 255 NTAQARLSARVVVAVTVLLAGVLSVLSDGFLETFFSSTEGIIMLAVALSMQVGGIMAVRK 314

Query: 182 MI 183
           ++
Sbjct: 315 IL 316


>gi|92113784|ref|YP_573712.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
 gi|91796874|gb|ABE59013.1| type II secretion system protein [Chromohalobacter salexigens DSM
           3043]
          Length = 291

 Score = 84.4 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 84/170 (49%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVR 74
             P  L+  +R +  G     A    + +S+ P+R+   RV   + LGL L E + R  +
Sbjct: 120 QLPGYLEQFLRELAVGASPERAFQRQIARSAPPLRNMLERVWVRRELGLELHEGLVRESQ 179

Query: 75  YMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134
            + L E++  +T + V  + GG+L + L +   +LR ++  + +++AL+ E + +A ++ 
Sbjct: 180 LLKLSELALLATALEVNQRHGGSLRDILGSFVTLLRQQERGRRELKALTGETRFTAVVLA 239

Query: 135 SLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            +P  +   +  T+P +++ + +   G   L +A    L G  VM  M+ 
Sbjct: 240 VIPVLIGGYILLTNPEFLSTMWHSADGRAALWLALGLELSGCFVMWRMLK 289


>gi|239817415|ref|YP_002946325.1| type II secretion system protein [Variovorax paradoxus S110]
 gi|239803992|gb|ACS21059.1| type II secretion system protein [Variovorax paradoxus S110]
          Length = 241

 Score = 84.4 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 84/182 (46%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            ++K   + +   P  +D +VR +  G     A  + +  +  P+R    R       G+
Sbjct: 59  RLQKVRRQLISQLPAYIDAMVRLITIGNSTQAAFQLAIATTQAPLRGHMERSAALVRAGV 118

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++ +    + ++E+   ++++ +  + GG     L  ++  +RDR+  + ++ A+S
Sbjct: 119 DLDRALHQTANNVRVEEMFLLASILGLGVRYGGRSDLLLERVANFMRDREQAEHELVAMS 178

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+G LP  V T +   +P Y   + ND  G ML+  +A   L+G   +  + 
Sbjct: 179 AETRLSAWILGLLPLGVGTFLVVVNPDYFLSMWNDDTGRMLIFSSAGLQLLGAFFLYRLA 238

Query: 184 NF 185
             
Sbjct: 239 RL 240


>gi|282865305|ref|ZP_06274357.1| type II secretion system protein [Streptomyces sp. ACTE]
 gi|282559778|gb|EFB65328.1| type II secretion system protein [Streptomyces sp. ACTE]
          Length = 295

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 66/161 (40%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I +R        P+ LD++   V AGL    A+  +  + S P   E R  +    
Sbjct: 134 IRSAISRRKDDIDRTLPDFLDVLAVVVSAGLGFRQALERVAEKYSGPWADELRITLRQMD 193

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+S  E+  ++ +    ++VS F + +    +LG  + + L  ++  +R      A+ +
Sbjct: 194 MGVSRREAFDQLRKRNESEQVSMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARRK 253

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           A     KA+  +   +      L+        +V I D  G
Sbjct: 254 AAKAVPKATLIVTSFMLPGTMILIAVGFYYAADVNIGDVFG 294


>gi|238750901|ref|ZP_04612398.1| Type II secretion system protein F domain protein [Yersinia rohdei
           ATCC 43380]
 gi|238710815|gb|EEQ03036.1| Type II secretion system protein F domain protein [Yersinia rohdei
           ATCC 43380]
          Length = 272

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 80/184 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   KK  + F  DFP  L +I  +  +G  ++  +     + + P+ SE R +    +
Sbjct: 86  IKAARKKHYSLFKQDFPEVLLMINMASSSGASINQVLERCGQEITGPLGSELRLICRRLN 145

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG S         +     E  F  T+I +  Q GG L +    LS+I+   K  + K  
Sbjct: 146 LGESPESVFHDAYQRFNFPEFYFLITIILLNLQQGGQLKDLTNRLSQIISKNKTAEQKKA 205

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
            ++ E + S  II  +P   S L+YF     +  + N P G ++        +IGI ++R
Sbjct: 206 TMTAETRMSVNIISVMPIAFSLLLYFIDSTSIESMWNHPTGKLIFYYIIISEIIGISLIR 265

Query: 181 LMIN 184
            M+ 
Sbjct: 266 KMLR 269


>gi|238897545|ref|YP_002923224.1| putative tight adherance operon protein B [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465302|gb|ACQ67076.1| putative tight adherance operon protein B [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 300

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 74/180 (41%)

Query: 5   IKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLS 64
            K++   F + FP  L I      +G+ V++ +     +    +  E   +     +G +
Sbjct: 118 KKQKKIYFTETFPELLLIFNMGSVSGISVNEILKKAGQEIKGGLGKECDLIFRRLSIGEN 177

Query: 65  LSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           ++       +     E   F  ++ +    GG L E +  L++++ +   M+ +  A++ 
Sbjct: 178 INTVFYDAYQRFSYPEFYMFINILMLNINQGGQLRELMHRLNQVVTNYNKMEKRKMAMTG 237

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           E + S W++  +P       YF +P     + +   G +++    A   +GI +MR M  
Sbjct: 238 EIRMSIWVVTLIPVIFFAFSYFMNPLSFQKIFSYEIGKIIIYYCLASNTLGIFIMRYMFR 297


>gi|51891529|ref|YP_074220.1| putative sercretion system protein [Symbiobacterium thermophilum
           IAM 14863]
 gi|51855218|dbj|BAD39376.1| putative sercretion system protein [Symbiobacterium thermophilum
           IAM 14863]
          Length = 299

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 84/173 (48%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           +  P  L ++   +RAG  +  AV  +V Q+  P+R EF RV     L +   +++  + 
Sbjct: 125 EQLPETLMLMASVIRAGGTLYQAVQTVVQQAPQPMRGEFERVARAMQLQVPAGDALGLIR 184

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             + L E +       V  + GG+L   L ++SR L + +     ++A   E KASA ++
Sbjct: 185 DRVGLGEFTSVVVACKVAGEAGGDLDRVLESISRELVEDRQFLRAMEAACAEGKASARLV 244

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFD 186
            ++P  V  LV + +P Y    + DP G +LL  +   M +G +++R + +  
Sbjct: 245 TAVPLVVVALVSYQNPAYFGEALTDPLGRVLLLGSLCAMALGWLLIRQITDVR 297


>gi|229821271|ref|YP_002882797.1| type II secretion system protein [Beutenbergia cavernae DSM 12333]
 gi|229567184|gb|ACQ81035.1| type II secretion system protein [Beutenbergia cavernae DSM 12333]
          Length = 285

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 64/176 (36%), Gaps = 3/176 (1%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +    +P+ +D +  +VRAG+ + +A+  +  +    VR+E                S+ 
Sbjct: 104 ELRQVWPDVVDDLTSAVRAGMTLPEALISLSERGPQEVRAELHAFAVDYRASGRFVASLD 163

Query: 71  RMVRYMPLQEVSFFSTVISV-QSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKAS 129
            +   +           + +     G +L   L  LS  LRD    + +++A        
Sbjct: 164 ALKERLADPVADRIVETLRIATDVGGSDLGRMLRTLSEFLRDDLRTRGELEARQSWTVNG 223

Query: 130 AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           A +  + P+ V  L+  T P       + P G ++L       ++  + M  +   
Sbjct: 224 ARLAVAAPWVVLALMS-TRPE-TAAAFDTPAGVLMLLAGGLTCVVAYLAMMRIGRL 277


>gi|260768629|ref|ZP_05877563.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
 gi|260616659|gb|EEX41844.1| flp pilus assembly protein TadB [Vibrio furnissii CIP 102972]
          Length = 292

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 91/176 (51%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSES 68
             + +   P+ ++ + R ++ GL ++ AV      ++ P++   +RVI  + +G+ L ++
Sbjct: 115 KLQLVQQLPSFVEQVNRRIKVGLSIAQAVEQSASATNAPLKDVLQRVIHRKAVGVELQDA 174

Query: 69  ISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
             +      +       ++ S+ ++ GG+++++L +L ++LR +   + ++++++ E + 
Sbjct: 175 FEKESVVTGVVAFHLLGSIFSINTRYGGSITDSLESLVKLLRQQDLSRRELKSITGETRI 234

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
           +AW+IGS P  VS  +   +P  +  +     G   L +  +  L+GI+++  M  
Sbjct: 235 TAWVIGSAPLLVSAYMLTQNPELLINMWYSEGGRQALILGISLQLLGIILIWRMFR 290


>gi|126733578|ref|ZP_01749325.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
 gi|126716444|gb|EBA13308.1| Putative Flp pilus assembly protein TadC [Roseobacter sp. CCS2]
          Length = 321

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 70/160 (43%), Gaps = 5/160 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +    + R     + FP++LD+++  V AG  +  ++  +  +       +  EF  V +
Sbjct: 162 VTRRQQMRQEAIENAFPDSLDMMLVCVEAGQSLDQSIIRVARELKSGFPELAEEFEIVSQ 221

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  +  M     + +++ F TV+   SQ G ++++AL   S  +RD++ M+A
Sbjct: 222 EAKAGKDKNTVLKDMSDRCGVPDIASFVTVLVQSSQFGTSIADALRVYSAEMRDKRVMRA 281

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           + +A  +  K +   +      +  ++    P    ++ +
Sbjct: 282 EEKANKLPTKMTLATMMLTVPPLMAML--IGPSIYAIVTS 319


>gi|302335343|ref|YP_003800550.1| Type II secretion system F domain protein [Olsenella uli DSM 7084]
 gi|301319183|gb|ADK67670.1| Type II secretion system F domain protein [Olsenella uli DSM 7084]
          Length = 312

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 32/181 (17%), Positives = 67/181 (37%), Gaps = 1/181 (0%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
           L  +R      + P     +  ++ +G  +S AV  +       V   F R     H G 
Sbjct: 130 LESRRRRAIEREMPAVFRTLAMAMGSGETLSQAVDYLAAHGGGEVAKAFTRTSLRMHCGY 189

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
              ES+  + R +    V    T + +  + G  L       +R++  +   +  +   +
Sbjct: 190 PARESLDLLARELDAPGVGLLVTALLISQRTGSPLRSLFRRSARLVERQGEFERMLGVKT 249

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            + + S  ++  LP  +  L+   S  +   L + P G   +  AA      I+++R ++
Sbjct: 250 AQVRLSVRVVSGLPVIMIALLSLISSDFQRGL-STPVGAACILAAALMDGAAILIIRRLM 308

Query: 184 N 184
            
Sbjct: 309 R 309


>gi|297618076|ref|YP_003703235.1| type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145913|gb|ADI02670.1| Type II secretion system F domain protein [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 295

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 65/145 (44%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R+   L   P+ LD++  SV AGL    A+  +V +S  P+  EF   +    
Sbjct: 139 LNLCRRQRSEGILKSLPDVLDLLSVSVEAGLGFDAALQKVVEKSQGPLADEFDTALNEIR 198

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    E++  M R + + +VS F   +     LG ++S  L   +  +R ++  +A+ +
Sbjct: 199 MGKPRREALRDMARRVEVDDVSTFVGAVVQADTLGVSISNVLTVQAEQVRQKRRQRAEEK 258

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVY 145
           A     K    ++  +   +  ++ 
Sbjct: 259 AQKAPVKILIPMLFFIFPTIFIVLL 283


>gi|167725257|ref|ZP_02408493.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 275

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   I  R    ++DFP+ALD++   V AGL +  A+  +  +    S  V  E   ++ 
Sbjct: 110 LARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLL 169

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +      ++V  FST++    + G ++  +L  LS  LR ++ M+A
Sbjct: 170 EMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRA 229

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +        I    P  ++ L+          L+    G
Sbjct: 230 EERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTLLPTMAG 274


>gi|328884729|emb|CCA57968.1| putative integral membrane protein [Streptomyces venezuelae ATCC
           10712]
          Length = 295

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 56/137 (40%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSE 67
           R  +     P+ LD++   V AGL    A+  +  +   P   E R  +    +G+S  +
Sbjct: 141 RKDQIERTLPDFLDVLAVVVSAGLGFRQALERVAEKYEGPWADELRITLRQMDMGVSRRQ 200

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           +   + R    ++V+ F T +    +LG  + E L  ++  +R      A+ +A     K
Sbjct: 201 AFDELRRRNDSEQVAQFVTALQQGEELGAPIVETLIQIANDMRRTDAQNARRKAAKAVPK 260

Query: 128 ASAWIIGSLPFCVSTLV 144
           A+  I   +      L+
Sbjct: 261 ATMVITTLMVPATMILL 277


>gi|187478774|ref|YP_786798.1| pilus assembly protein [Bordetella avium 197N]
 gi|115423360|emb|CAJ49894.1| putative pilus assembly protein [Bordetella avium 197N]
          Length = 282

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 84/170 (49%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
              P  L  +  ++RAG  +  A+  +   +  P+  E   ++  Q LG+S  +++ R+ 
Sbjct: 109 AQLPAGLLSLASALRAGASLPAALRQLADLAQPPLAQEIGLMLREQRLGVSFDDALHRLE 168

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
             + L  V   +    V    GGNL++ L  +++ LR +   + +++AL+ + +  AW++
Sbjct: 169 CRVDLPSVRLMTAAFRVAGSAGGNLAQTLEGIAQALRGQLLAEGRLKALTAQGRMQAWVL 228

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            +LP  ++ ++Y   P  M  L     G +L+ +  A  ++G  ++R ++
Sbjct: 229 SALPLVLAVVLYLLRPEQMARLWQTEAGWILIALVMALQVLGWFLIRRIL 278


>gi|113866736|ref|YP_725225.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
 gi|113525512|emb|CAJ91857.1| flp pilus assembly protein TadC [Ralstonia eutropha H16]
          Length = 324

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 73/166 (43%), Gaps = 4/166 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   + +R     ++FP+ +D++   V AGL +  A+  +  +       +  E + ++ 
Sbjct: 157 LARKVAQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLL 216

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++S +     +++V  F++++    + G +L E+L  LS +LR ++ M+A
Sbjct: 217 ELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRA 276

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           + QA  +        I    P  +  L+         VL+    G 
Sbjct: 277 EEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQIYRVLLPTMAGQ 322


>gi|319795465|ref|YP_004157105.1| type II secretion system f domain [Variovorax paradoxus EPS]
 gi|315597928|gb|ADU38994.1| Type II secretion system F domain [Variovorax paradoxus EPS]
          Length = 410

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 58/185 (31%), Gaps = 11/185 (5%)

Query: 1   MKHLIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRR 54
           +   IKKR           D       +   ++AG+P+  +  ++    ++  V      
Sbjct: 53  LASKIKKRRMRSGKAIKPKDIAIFTRQLATMMKAGVPLLQSFDIVGRGNANASVAKLLND 112

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +      G SLS +  +  +             +    +  G L + L  L+  +   + 
Sbjct: 113 IRSDVETGTSLSAAFRKFPK-----YFDNLYCNLVEAGEAAGILEDLLDRLATYMEKTEA 167

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K+K+++  M   +   +   +   +   V             D     L  +A +   +
Sbjct: 168 IKSKIKSALMYPTSVVVVAFVVVAIIMIFVIPVFKEVFTSFGADLPAPTLFVMAMSEFFV 227

Query: 175 GIMVM 179
               +
Sbjct: 228 SYWWL 232



 Score = 34.7 bits (78), Expect = 6.2,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 43/131 (32%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVR-SEFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + V      ++ +    G SL+ +++ +     
Sbjct: 280 WTRTLATMFAAGVPLVEALDSVGGASGNSVYGDATAKIQQEVSTGTSLTAAMTNV----- 334

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     ++   +  G++   L   +       +      +  ME     ++   + 
Sbjct: 335 -NLFPSMVIQMTAIGEESGSIDHMLGKAADFYESEVDDMVAGLSSLMEPIIIVFLGVIIG 393

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 394 GIVVSMYLPIF 404


>gi|308068033|ref|YP_003869638.1| Flp pilus assembly protein TadB [Paenibacillus polymyxa E681]
 gi|305857312|gb|ADM69100.1| Flp pilus assembly protein TadB [Paenibacillus polymyxa E681]
          Length = 291

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 80/193 (41%), Gaps = 8/193 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFRR 54
           K L+++R +     F  AL  +  S+ AG  V +     V             +  EF  
Sbjct: 100 KFLLQRRRSALSIQFKQALYSLSSSLSAGRSVENGFREAVEDLRLLSPDGDHDLIFEFNI 159

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +     +G  +  ++  + R   +++++ F+ V +   + GG+L E +   S ++ ++  
Sbjct: 160 ITACLEIGQPVEAALQELARRAQMEDITNFADVFAACKRTGGDLVEVVRRASSVIGEKLE 219

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           ++ ++  +  + +  + ++ + PF     +  T+  YM  L     G +L       +  
Sbjct: 220 IQQEIGVMIAQKRFESRVMFAAPFLFVLFMTMTAGDYMMPLY-SGTGMILSTFCLLVLGG 278

Query: 175 GIMVMRLMINFDV 187
            ++ +  ++  +V
Sbjct: 279 CLVWINHIMKIEV 291


>gi|300694108|ref|YP_003750081.1| type II secretion system protein [Ralstonia solanacearum PSI07]
 gi|299076145|emb|CBM10581.1| Type II secretion system protein [Ralstonia solanacearum PSI07]
          Length = 308

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 83/182 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G
Sbjct: 125 NRTRRMNERLMQQLPGFLDGMVRLMSIGSAVPAAFQAASANTEPPLRTCLTSATQLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KDLDAAVLAVGQQYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQKELLAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  +
Sbjct: 245 SAETRLSAWILGLLPVVVGGIIIMFNAAYVMSMWRDPVGKMLMTAAFGLEVMGSLMLARL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|89053483|ref|YP_508934.1| type II secretion system protein [Jannaschia sp. CCS1]
 gi|88863032|gb|ABD53909.1| type II secretion system protein [Jannaschia sp. CCS1]
          Length = 326

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 71/160 (44%), Gaps = 5/160 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +    + R  +    FP+ALD+++  V AG  +  A+  +  +   S  P+  EF  V  
Sbjct: 166 ITKRAQTREDQINSGFPDALDLMLVCVEAGQSLDQAIIKVANEIKTSYPPLAEEFEIVSY 225

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   ++ +  M   + +Q+V+ F T +   S  G +++EAL   S  +RD++  +A
Sbjct: 226 EMKAGKDKTKVLRDMGERVGIQDVNSFITTLIQSSTFGTSVAEALKVYSDEMRDKRISRA 285

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           + +A  +  K + + +      +  ++    P    +  +
Sbjct: 286 EEKANKLPTKLTLFTMLFCVPPLLVIL--IGPSIYGIATD 323


>gi|328545274|ref|YP_004305383.1| hypothetical protein SL003B_3658 [polymorphum gilvum SL003B-26A1]
 gi|326415016|gb|ADZ72079.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 325

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 63/160 (39%), Gaps = 5/160 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +++ I KR       +P+ALD+++  V +G+ +  A   +  +    S P+  E      
Sbjct: 166 IQNRITKRQQSIRRAWPDALDLMLICVESGMSIEAAFRKVADEIGIQSIPLAEELTLTNA 225

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++     +   +  V   +  +    + G  +  AL  ++   R+++  +A
Sbjct: 226 ELSFLQERRQAYLNFAKRTGVDGVKNVTMALIQAERYGTPIGHALRVMADDNREQRMQEA 285

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           + +A S+  K +  +I      +  ++    P  M ++  
Sbjct: 286 EKKAASLPPKLTVPMIVFFLPVLFFVI--MGPAVMQIIAT 323


>gi|319639058|ref|ZP_07993815.1| PilG protein [Neisseria mucosa C102]
 gi|317399636|gb|EFV80300.1| PilG protein [Neisseria mucosa C102]
          Length = 413

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 64/187 (34%), Gaps = 7/187 (3%)

Query: 1   MKHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +  +   R  +   +D       +   ++AGLP+  A  ++    S+  +     +V   
Sbjct: 59  ISKVKTARKRRITQEDITVFTRQLATMMKAGLPLMQAFEIVARGHSNPSMTEMLMQVRSD 118

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G +L +S S+  +         F   +    + GG L   L  L+      + +K K
Sbjct: 119 VEQGSALGKSFSKYPK-----YFDRFYCNLVSAGESGGVLESLLDKLAVYKEKTQAIKKK 173

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           V+       A   +  +L F +   V          +  +  G   L +  + + +    
Sbjct: 174 VKTALTYPIAIIVVAIALIFIMMMFVLPAFKEVYANMGAELPGLTQLVMNLSDLFVDYGW 233

Query: 179 MRLMINF 185
           + +++  
Sbjct: 234 IMIILLI 240


>gi|73542334|ref|YP_296854.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72119747|gb|AAZ62010.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 323

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 74/166 (44%), Gaps = 4/166 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           + H + +R     ++FP+ +D++   V AGL +  A+  +  +       +  E + ++ 
Sbjct: 157 LSHKVAERQRAVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLL 216

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++S +     +++V  F++++    + G +L ++L  LS +LR ++ M+A
Sbjct: 217 ELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGDSLRVLSDMLRTKRRMRA 276

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           + QA  +        I    P  +  L+         VL+    G 
Sbjct: 277 EEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQIYRVLLPTMAGQ 322


>gi|332970974|gb|EGK09948.1| hypothetical protein HMPREF9374_2751 [Desmospora sp. 8437]
          Length = 306

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 66/158 (41%), Gaps = 2/158 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K   +KR  +   + P+ +D++  +++AG+ +  A+   V  ++ P+  E  R+ +   
Sbjct: 143 VKFKAQKRQEEIQYELPDFMDMMSITLQAGMALDTALDYYVSTNNGPLSEEIARMNQEIS 202

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G+    +   ++      E+      +     LG  +SE  A  +  +R+ +  KAK Q
Sbjct: 203 FGVQRETAYRALIDRTDSTELETLVQSMIQAHNLGTPISETFALQAMEMRNMRAEKAKEQ 262

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIND 158
           A   E K SA     +   +  LV+      +     D
Sbjct: 263 AGKSEPKISAVAGLVITPSIMLLVFGAF--ILKFFFTD 298


>gi|260431089|ref|ZP_05785060.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414917|gb|EEX08176.1| type II/IV secretion system protein, TadC subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 327

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 73/158 (46%), Gaps = 4/158 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   +++R       FP+ LD+++  V AG  +  A+  +  +       +  EF  V  
Sbjct: 165 ITRRVEERKEAITAGFPDTLDLMLVCVEAGQSLDQAIVRVASEMKSSYPDIAQEFEIVAY 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   ++ +        +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 225 EMKAGKDKNQVLRDFGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRA 284

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNV 154
           +  A  +  K + A ++ ++P  +  LV  ++ G M  
Sbjct: 285 EEAANKLPTKMTLATMMLTVPPLLIILVGPSAKGIMEF 322


>gi|134299964|ref|YP_001113460.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
 gi|134052664|gb|ABO50635.1| type II secretion system protein [Desulfotomaculum reducens MI-1]
          Length = 310

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 69/155 (44%), Gaps = 2/155 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I+ R  +     P+ALD++  SV AGL    A+  +  ++   +  EF  +++  H
Sbjct: 153 LNSRIRNRKTQVEKSLPDALDLLTVSVEAGLGFDGALMKVAEKTKGIMADEFILMLQECH 212

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    E++  M   + + ++S F   I +   LG ++   L   S+ +R ++  K +  
Sbjct: 213 MGKPRREALRDMATRLDVDDLSSFCGSIILADTLGISIGNVLRTQSQQMRQKRRQKTEEL 272

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           A+    K    ++  +   +  ++    P  + ++
Sbjct: 273 AMKAPIKMLFPMVFFIFPAIFVIL--LGPAALQIM 305


>gi|253995967|ref|YP_003048031.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253982646|gb|ACT47504.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 407

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 6/167 (3%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISR 71
             D       +   +++G+P+  +  ++    S+  V      +      G SLS +  +
Sbjct: 65  DKDITLFTRQLATMMKSGVPLLQSFDIVGKGHSNPAVAKLLGDIKSDVETGSSLSAAFRK 124

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                           +    +  G L   L  L+      + +K+K+++      +   
Sbjct: 125 YPL-----YFDALFCNLISAGEQAGILDTLLDRLATYKEKIQAIKSKIKSALFYPVSIIV 179

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +   +   +   V        +    D  G  L+ +A +   +    
Sbjct: 180 VAFIITAVIMIFVVPAFKELFSSFGADLPGPTLVVMAISEFFVNWWW 226



 Score = 45.9 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 43/142 (30%), Gaps = 11/142 (7%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLS 66
           R A            +     AG+P+ +A+  + G S + V     +R+      G SL+
Sbjct: 268 RKATIAR----FARTMATMFSAGVPLVEALDSVAGASGNRVYYDATKRIQSEISTGTSLT 323

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++         +        ++   +  G L   L  ++       +   +  +  ME 
Sbjct: 324 VAMQNA------EVFPNMVLQMTAIGEESGALDSMLGKVADFYEGEVDDAVEALSSLMEP 377

Query: 127 KASAWIIGSLPFCVSTLVYFTS 148
                +   +   V  L     
Sbjct: 378 IIMVVLGVLIGGLVVALYLPIF 399


>gi|118589708|ref|ZP_01547113.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
 gi|118437794|gb|EAV44430.1| hypothetical protein SIAM614_04690 [Stappia aggregata IAM 12614]
          Length = 325

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 58/159 (36%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +K+ I KR       +P+ALD+++  V +G+ + +    +  +    S  +  E      
Sbjct: 166 LKNKIDKRKLTIQRAWPDALDLMLICVESGMSIEEGFRRVAEEVGVQSVELAEELSLTTA 225

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   + +   +  V      +    + G  +  AL  ++   R+++   A
Sbjct: 226 ELSYLSDRRIAYENLAKRTGVDGVKNVMMALIQAERYGTPVGTALRTMADDTREQRMQMA 285

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A S+  K     I+  LP     ++       M+  
Sbjct: 286 EQKAASLPPKLTVPMIMFFLPVLFFIIMGPAVIQVMDTF 324


>gi|298370054|ref|ZP_06981370.1| type IV pilin biogenesis protein PilC [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281514|gb|EFI23003.1| type IV pilin biogenesis protein PilC [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 413

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 67/187 (35%), Gaps = 9/187 (4%)

Query: 1   MKHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +  +   R  +   +D       +   ++AGLP+  A  ++    S+  +     +V   
Sbjct: 59  VSKVKSTRKKRITQEDITVFTRQLATMMKAGLPLMQAFEIVARGHSNPSMTQMLMQVRAD 118

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G +L +S S+  +         F   +    + GG L   L  L+      + +K K
Sbjct: 119 VEQGSALGKSFSKYPK-----YFDRFYCNLVSAGETGGVLEGLLDKLAVYKEKTQAIKKK 173

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI--GI 176
           V+       A   +  +L F +   V        + +  +  G   + ++ +   +  G 
Sbjct: 174 VKTALTYPIAIMVVAVALIFVMMMFVLPAFGEVYSSMGAELPGLTQIVMSMSKFFVKYGW 233

Query: 177 MVMRLMI 183
           +++  +I
Sbjct: 234 VMIVAII 240


>gi|225174956|ref|ZP_03728953.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
 gi|225169596|gb|EEG78393.1| type II secretion system protein [Dethiobacter alkaliphilus AHT 1]
          Length = 306

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 67/145 (46%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +K    +R  +     P+ LD+++ SV AGL    A+  +  +    +  E  + ++   
Sbjct: 148 VKRKATERQKEIQRSLPDMLDLLLVSVDAGLAFDMALKKVADKMPGELSREIGKALDEIR 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G +  E++  M     + ++S F + +    QLG N+++ L   +  +R R+ M+A+ +
Sbjct: 208 MGKTRIEALRSMANRTGVPDISTFISAVIQAEQLGSNIAKTLDVQANTMRQRRRMRAEEE 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVY 145
           A+    K    ++  +   +  ++ 
Sbjct: 268 AMRAPIKMLFPLVFFIFPALFVVLL 292


>gi|188586923|ref|YP_001918468.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351610|gb|ACB85880.1| type II secretion system protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 317

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 1/159 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   +  R  +     P  LD++  SV AGL    ++  +  + + P+  E +RV +   
Sbjct: 158 LSSKVNTRKNEIQRALPEFLDLLTVSVEAGLGFESSLKKVAEEGTGPLAVEIKRVTQEIS 217

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S  E++  +   + LQ++S F   I    QLG  +S  L   S+  R ++  +A+ Q
Sbjct: 218 MGKSRKEALIDLKERIDLQDLSTFINAIIQAEQLGVGISRVLKVESKEFRRKRRQRAEEQ 277

Query: 121 ALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVLIND 158
           A+    K     I+   P     L+   +   M+ LI  
Sbjct: 278 AMKAPVKLLIPLILFIFPTIFIILLGPAALRIMDNLIGT 316


>gi|296129085|ref|YP_003636335.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
 gi|296020900|gb|ADG74136.1| Type II secretion system F domain protein [Cellulomonas flavigena
           DSM 20109]
          Length = 286

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 76/186 (40%), Gaps = 3/186 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   ++R A   + +P+ +D +   VRAGL + +AVA +  +    +R+ FR   E   
Sbjct: 95  VQGRARRRLASTRELWPDVVDHLASGVRAGLSLPEAVAQLGDRGPAELRAPFRAFAEDYR 154

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
                ++S+  +   +           + +     G +L   L  LS  LRD    + ++
Sbjct: 155 ATGRFTDSLDALKDRLADPVADRIIEALRLTRDVGGTDLGRLLRTLSTFLRDDLRTRGEL 214

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +  + P+ V  ++  T P  +    + P G  +L   AA  +    +M
Sbjct: 215 EARQSWTVYAARMAVAAPWVVLAML-ATRPEAIRA-YDSPAGAAVLLAGAASSVAAYRLM 272

Query: 180 RLMINF 185
             +   
Sbjct: 273 LRVARL 278


>gi|221633000|ref|YP_002522225.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
 gi|221157259|gb|ACM06386.1| type II secretion system protein [Thermomicrobium roseum DSM 5159]
          Length = 303

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R        P+A+D++V SV AGL    A+  +V +  + +  EF R +    
Sbjct: 147 LSRRIAQRKRAIQRALPDAIDLLVISVEAGLGFDQALLRVVEKWDNELTREFARTLSEMR 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+   +++  + R + + +++ F   +    QLG ++S+ L   +  +R R+  +A+  
Sbjct: 207 MGIPRRQALRDLARRVNVDDLNVFIASLVQADQLGVSISQVLRAQANQMRLRRRQRAQEL 266

Query: 121 ALSMEAKA-SAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           A     K     +    P     ++    P  +   
Sbjct: 267 AHKAPIKMIFPMVFLIFPALYVVILGPAIPRIVEAF 302


>gi|187479015|ref|YP_787039.1| type IV pilus assembly protein [Bordetella avium 197N]
 gi|115423601|emb|CAJ50139.1| putative type IV pilus assembly protein [Bordetella avium 197N]
          Length = 305

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 80/184 (43%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     +R  + +   P+ +D +VR +  G  V+ A    +    DP+    +R      
Sbjct: 120 IWRQAGERRQRMIKQLPDFIDGVVRLITIGNSVNAAFQGAMTSIDDPLLEVLQRAEALMR 179

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  ++ ++ R   LQE+   S+VIS+  + GG     L  ++  +RD +  + ++ 
Sbjct: 180 SGKDLDSALLKVSRQYGLQELYLVSSVISLALRFGGRSDLVLERMAAFMRDLELAREELI 239

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + S WI+  LP  +   +   +      +  DP G  +L   A   ++G  ++ 
Sbjct: 240 ALSAEVRMSVWILSLLPIGLGLFIIVFNNDLFMGMWRDPLGFKMLIGGAMLQVVGTYLLF 299

Query: 181 LMIN 184
            M  
Sbjct: 300 RMAR 303


>gi|197106463|ref|YP_002131840.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
 gi|196479883|gb|ACG79411.1| Flp pilus assembly protein TadC [Phenylobacterium zucineum HLK1]
          Length = 320

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 69/161 (42%), Gaps = 5/161 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +K+ I+KR+ K     P+ALD+ V    AGL +  A+A +  +   ++  +  E      
Sbjct: 160 LKNAIQKRSLKIQRALPDALDLFVICAEAGLSLDAALARVSREIGPAAPELADELGLTAV 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    E++  + R +   +V      +    + G  L++AL  L+   RD + MKA
Sbjct: 220 ELGFLPDRREALLNLTRRVAAPQVRGLVNTLVQTEKYGTPLAQALRVLAAEFRDTRMMKA 279

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIND 158
           + +A  + A  +  +I  +   +  ++    P  + VL   
Sbjct: 280 EEKAARLPATLTVPMIAFILPPLFVVL--IGPAIVQVLTTS 318


>gi|297192377|ref|ZP_06909775.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197723022|gb|EDY66930.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 296

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 60/146 (41%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  I +R        P+ LD++   V AGL    A+  +  + + P   E R  +    
Sbjct: 135 LRAAIARRRDDIERTLPDFLDVLAVVVSAGLGFRQALERVAEKYAGPWSDELRITLRQMD 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+   E+  ++ R    ++VS F + +    +LG  + + L  ++  +R      A+ +
Sbjct: 195 MGMGRREAFEQLRRRNESEQVSMFVSALQQGEELGAPIVDTLIQIANDMRRTDAQNARRK 254

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYF 146
           A     KA+  +   +      L+  
Sbjct: 255 AAKAVPKATLIVTSFMLPGTMILIVA 280


>gi|295395665|ref|ZP_06805857.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971481|gb|EFG47364.1| integral membrane protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 297

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 65/143 (45%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           +KR     D  P+ LD++  +V AGL    A+A +  ++  P+  E   V+   ++G ++
Sbjct: 144 RKRQEAIEDSLPDFLDVLAVTVSAGLSFRSAIAKVTERTQGPLADELNTVLHQLNMGETV 203

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSME 125
            ++ S + +    + +  F T +    +LG  L++ LA ++  +R     +A+ +A    
Sbjct: 204 YDAFSALRKRTTSESLDSFITTLLQAEELGAPLADTLATIALDMRQTTAQRARQKAAKAS 263

Query: 126 AKASAWIIGSLPFCVSTLVYFTS 148
            K +  +   +      L+  + 
Sbjct: 264 PKIAGVVTIIMVPGTMALIMVSV 286


>gi|16127170|ref|NP_421734.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|221235971|ref|YP_002518408.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
 gi|13424566|gb|AAK24902.1| hypothetical protein CC_2940 [Caulobacter crescentus CB15]
 gi|220965144|gb|ACL96500.1| tyrosine phenol-lyase [Caulobacter crescentus NA1000]
          Length = 362

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 65/157 (41%), Gaps = 5/157 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + ++ +KR    +  FP+ALD+++  V +G+ +  A+  +  +   SS  +  E   +  
Sbjct: 203 ISNVAQKRRESIVAAFPDALDLLLICVESGMSIEAAIQKVGAEVGSSSMELAEELSLLTA 262

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   + R      +   +T +    + G  L  AL  +++  R+ +   A
Sbjct: 263 ELSYLPDRRLAYENLARRTNHPGIKSVATAMIQAERYGTPLGTALRVMAKENRELRLSAA 322

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           + +A ++ A+ +  +I      +  ++    P  M V
Sbjct: 323 EKKAAALPAQLTVPMILFFLPVLFIMI--LGPAIMKV 357


>gi|320161469|ref|YP_004174693.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995322|dbj|BAJ64093.1| putative bacterial type II secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 319

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 71/163 (43%), Gaps = 2/163 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  +     P+ALD++   V AGL    A+A +  +    +   F RVI+   
Sbjct: 158 LTSKISRRQKEIRKSMPDALDLLTICVEAGLGFDAAMAKVAEKWESELSLAFARVIQEIQ 217

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  +++  M   + + E++ F   +    QLG ++++ L   S  +R R+   A+ +
Sbjct: 218 LGKTRRDALRDMAERIGIPEMTSFVAAVIQSEQLGVSMAKVLRIQSDQMRVRRRQAAEEE 277

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM 163
           A     K    +   +   +  ++   +P  + ++ +   G  
Sbjct: 278 AHKAPVKMLIPMALLIFPSL--MIVLMTPAALRLMNSALAGMF 318


>gi|207739455|ref|YP_002257848.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
 gi|206592831|emb|CAQ59737.1| pilus assembly protein tadb [Ralstonia solanacearum IPO1609]
          Length = 319

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 82/181 (45%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G 
Sbjct: 137 RTRRMKERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGK 196

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS
Sbjct: 197 DLDAAVLAVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALS 256

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  + 
Sbjct: 257 AETRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPAGKMLMMAAFGLEVMGSLMLARLA 316

Query: 184 N 184
            
Sbjct: 317 K 317


>gi|110679391|ref|YP_682398.1| TadC family type II/IV secretion system protein [Roseobacter
           denitrificans OCh 114]
 gi|109455507|gb|ABG31712.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter denitrificans OCh 114]
          Length = 355

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 71/165 (43%), Gaps = 3/165 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  +  R  +    FP++LD+++  V AG  +   +  +  +   S   +  EF  V  
Sbjct: 191 VRRRVDARKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAY 250

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  ++       +Q+VS F TV++   Q G +++EAL   +  +RD++ M+A
Sbjct: 251 EMKAGKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAEEMRDKRVMRA 310

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           +  A  +  K +   +      +  ++   S   +  L N   G 
Sbjct: 311 EEAANKLPTKMTLATMMLTVPPLLIILVGPSVHGITQLGNLGAGQ 355


>gi|260220289|emb|CBA27679.1| Type IV pilus assembly protein tapC [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 405

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 59/182 (32%), Gaps = 10/182 (5%)

Query: 3   HLIKKRTAKFL----DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-VRSEFRRVIE 57
            + K+R          D       +   ++AG+P+  A  ++   + +P V      +  
Sbjct: 51  KIKKRRMRSGKSIKPKDLAIFTRQLATMMKAGVPLLQAFDIVGRGNPNPSVTKLLSDIRS 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +  +                +    +  G L + L  L+  +   + +K+
Sbjct: 111 DVETGTSLSAAFRKYPL-----YFDNLYCNLVEAGESAGILDQLLDRLAVYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V  +          +     L  +A + + I   
Sbjct: 166 KIKSALMYPISVLVVAFVVVSVIMIFVIPSFKQVFTSFGGELPAPTLFVIALSEVFIEYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 33.9 bits (76), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 41/131 (31%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + V     +++ +    G SL+ +++       
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNIVYQYATQKIQQEVSTGTSLTAAMTNA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +       +      +  ME      +   + 
Sbjct: 330 -NLFPSMVLQMCAIGEESGSIDHMLGKAADFFEAEVDDMVAGISSLMEPIIIVVLGTIIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040398|gb|ACT57194.1| pilus component protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 329

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 64/162 (39%), Gaps = 4/162 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           + +L++KR +     +P+ALD+++  V +G+ +  A+  +          +  E    I 
Sbjct: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                 +   +         +  V   +  +    + G ++ ++L  L    R  + M+A
Sbjct: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVLIND 158
           + +A S+  K     II  LP  +  ++       ++ + + 
Sbjct: 288 EKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH 329


>gi|317472142|ref|ZP_07931474.1| hypothetical protein HMPREF1011_01824 [Anaerostipes sp. 3_2_56FAA]
 gi|316900546|gb|EFV22528.1| hypothetical protein HMPREF1011_01824 [Anaerostipes sp. 3_2_56FAA]
          Length = 259

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 75/193 (38%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-------VRSEFRR 54
           +   K R  +   +F   L  +  S+ AG  + +AV                 +  E   
Sbjct: 67  REERKMRIRQSRLEFKEMLLSVYNSLSAGYSLENAVRAARDDMRAVNGDKKSVLEQELSL 126

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V     +   +   + +M   + + E S F+ V+ +  + GGNL + +      +  +  
Sbjct: 127 VCAGLEVNQPIEVLMDKMALRLGVDEASQFAQVLWIIKRNGGNLIQIIKKSVEHMNQKIQ 186

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  +    +    I+  +PF +   V   +PGY  VL + P G +L  V    ++ 
Sbjct: 187 VKEEILTMVSAKRMEQKIMSVMPFFILLYVRLMNPGYFQVLYDSPGGVILSTVCLIVLVA 246

Query: 175 GIMVMRLMINFDV 187
             M  + ++  +V
Sbjct: 247 AGMWAKKIVEIEV 259


>gi|292491527|ref|YP_003526966.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
 gi|291580122|gb|ADE14579.1| type II secretion system protein [Nitrosococcus halophilus Nc4]
          Length = 320

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 69/158 (43%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++ LIKKR  +  + FP+ LD+++    AGL ++ A+  +  +   S   +  E   V  
Sbjct: 159 LERLIKKRQRQIYNGFPDVLDLLITCTEAGLGLNAALKRVAEECAVSHPVLSGELTLVNM 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G++  E++        ++E+  F   +S   + G ++++ L   S   RD++  +A
Sbjct: 219 EIRAGVNRVEALKNFSARAGIEEIHSFVAFLSQSLRFGTSIADTLRIYSDEFRDKRMQRA 278

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           +  A  M  K    +I  +       +    P  + VL
Sbjct: 279 EEMAAKMGTKMIFPLIFCILPS--FFLVAIGPAVLGVL 314


>gi|89100216|ref|ZP_01173083.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
 gi|89085066|gb|EAR64200.1| hypothetical protein B14911_20190 [Bacillus sp. NRRL B-14911]
          Length = 312

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 62/148 (41%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++   KKR  +   D P+ LD +  S++AG  +  A+  ++   S P++ EF   ++   
Sbjct: 148 VRSKAKKRQQQLRSDLPDFLDTVSVSLQAGSNMDSALKEVIKYFSGPIKEEFSIFLQEID 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG+   ++   ++     +E   F   +   ++LG  ++  L + +  +R     + K +
Sbjct: 208 LGVPREKAYGGLLERNDNEEFQSFIKSLIQATRLGVPMASTLKSQAEDIRKISLEQVKEK 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTS 148
           A     K +      +   +  L+    
Sbjct: 268 AAKASPKVTMITSFIIAPLIMLLIIGLV 295


>gi|253996761|ref|YP_003048825.1| type II secretion system protein [Methylotenera mobilis JLW8]
 gi|253983440|gb|ACT48298.1| type II secretion system protein [Methylotenera mobilis JLW8]
          Length = 312

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 68/166 (40%), Gaps = 4/166 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           + H I  R  +  + FP+ALD+I+  V +GL +  A+A +  +       +  E   +  
Sbjct: 147 LSHRIDSRKREIFESFPDALDLIIVCVESGLGLDAALARVGEEMHVRSPTLGEELHLINL 206

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S   ++  +     ++EV     ++    + G N+S++L   +  LR ++ + A
Sbjct: 207 ELRAGSSRERALRNLALRTGVEEVDTLVAMLVQSDRFGTNISDSLRVHADSLRTKRRLLA 266

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           +  A  +  K     I    P  +  L+        N+L+    G 
Sbjct: 267 EEAAAKIAVKLLFPLIFFIFPSMLLVLLGPAFINIHNILLPTLAGQ 312


>gi|149200852|ref|ZP_01877827.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
 gi|149145185|gb|EDM33211.1| type II/IV secretion system protein, TadC subfamily [Roseovarius
           sp. TM1035]
          Length = 326

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +    +KR  +  D FP++LD+++  + AG  +  ++  +  +       +  EF  V  
Sbjct: 164 VTKRQQKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALADEFEIVAL 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +  M     +Q++S F TV+      G ++ EAL   +  +RD++ M+A
Sbjct: 224 QIKAGRDKPSVLGEMAERCGVQDISSFVTVLVQSQTFGTSIGEALRVYAGEMRDKRVMRA 283

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K + A ++ ++P  +  LV  +  G M++L
Sbjct: 284 EEKANKLPTKMTLATMMLTVPPLLIILVGPSVLGIMDLL 322


>gi|167748318|ref|ZP_02420445.1| hypothetical protein ANACAC_03062 [Anaerostipes caccae DSM 14662]
 gi|167652310|gb|EDR96439.1| hypothetical protein ANACAC_03062 [Anaerostipes caccae DSM 14662]
          Length = 259

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 75/193 (38%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-------VRSEFRR 54
           +   K R  +   +F   L  +  S+ AG  + +AV                 +  E   
Sbjct: 67  REERKMRIRQSRLEFKEMLLSVYNSLSAGYSLENAVRAARDDMRAVNGDKKSVLEQELSL 126

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V     +   +   + +M   + + E S F+ V+ +  + GGNL + +      +  +  
Sbjct: 127 VCAGLEVNQPIEVLMDKMALRLGVDEASQFAQVLWIIKRNGGNLIQIIKKSVEHMNQKIQ 186

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K ++  +    +    I+  +PF +   V   +PGY  VL + P G +L  V    ++ 
Sbjct: 187 VKEEILTMVSAKRMEQKIMSVMPFFILLYVRLMNPGYFQVLYDSPGGVILSTVCLIVLVA 246

Query: 175 GIMVMRLMINFDV 187
             M  + ++  +V
Sbjct: 247 AGMWAKKIVEIEV 259


>gi|99082191|ref|YP_614345.1| type II secretion system protein [Ruegeria sp. TM1040]
 gi|99038471|gb|ABF65083.1| hypothetical protein TM1040_2351 [Ruegeria sp. TM1040]
          Length = 323

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 67/149 (44%), Gaps = 3/149 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I++R       FP+ALD+++  V AG  +  ++  +  +   S   +  EF  V  
Sbjct: 164 ITRRIEERKQAITRAFPDALDMMLVCVEAGQSLDQSIVRVGKELQASYPELAEEFEIVAH 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q+V+ F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 224 EMKAGKEKDKVLRDMATRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYF 146
           +  A  +  K +   +G     +  ++  
Sbjct: 284 EEAANKLPTKMTLATMGLTVPPLLAILIA 312


>gi|94309584|ref|YP_582794.1| type II secretion system protein [Cupriavidus metallidurans CH34]
 gi|93353436|gb|ABF07525.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Cupriavidus metallidurans CH34]
          Length = 323

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 72/165 (43%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   +  R     ++FP+ +D++   V AGL +  A+  +  +       +  E + ++ 
Sbjct: 157 LSRKVTARQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLL 216

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  +++S +     +++V  F++++    + G +L E+L  LS +LR ++ M+A
Sbjct: 217 ELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRA 276

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + QA  +        I    P  +  L+         VL+    G
Sbjct: 277 EEQAAKIALKLLFPLIFTIFPTLLLVLLGPAFIQIYRVLLPTMTG 321


>gi|83747914|ref|ZP_00944946.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN: TadB2 [Ralstonia solanacearum
           UW551]
 gi|83725447|gb|EAP72593.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN: TadB2 [Ralstonia solanacearum
           UW551]
          Length = 308

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 82/181 (45%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G 
Sbjct: 126 RTRRMKERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGK 185

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS
Sbjct: 186 DLDAAVLAVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALS 245

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  + 
Sbjct: 246 AETRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPAGKMLMMAAFGLEVMGSLMLARLA 305

Query: 184 N 184
            
Sbjct: 306 K 306


>gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722223|gb|ABC77166.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 317

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 73/158 (46%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           ++  I  R  K ++ FP+ALD++V  V AG+ +  A+  +  +      P+  EFR +  
Sbjct: 156 LRLKIGARKEKIMEGFPDALDLMVICVEAGMGLDQAINRVGEEMKLSCPPISDEFRTLNM 215

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              +G S  E++  M     L +V+   T++    Q G ++ +AL   S  +R ++  +A
Sbjct: 216 EMRMGKSRREALRNMANRTELDDVTSLVTLLIQTDQFGTSIGQALRVHSDSMRVQRRQRA 275

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K    +I  +   +  ++    P  + V 
Sbjct: 276 EEKAAKLPLKLLFPLIFFIFPSLFVVI--MGPAMIQVF 311


>gi|229825136|ref|ZP_04451205.1| hypothetical protein GCWU000182_00487 [Abiotrophia defectiva ATCC
           49176]
 gi|229790508|gb|EEP26622.1| hypothetical protein GCWU000182_00487 [Abiotrophia defectiva ATCC
           49176]
          Length = 245

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
           K LI+KR  +    F   L +I+ S++AG  +  A+     +          + +E   +
Sbjct: 54  KKLIEKRKNELSAQFIEFLQVIMSSLKAGTSLERAILSARERLYSLYNNDSLIITEIISM 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
             +  + + + + +    +   +++++ F+ V  V  + GGNL + + +  + + D+  M
Sbjct: 114 ESSLRMNIPVEDILYDFGKRSGIEDINQFAEVCKVSKRAGGNLIKVMDHTIKCIVDKNEM 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++QA     K  +  + ++   +   +  +    MN L     G +++    A     
Sbjct: 174 EREIQAFISGKKLESKFMTAILPAILLYMNISMADMMNSLYQGILGRLVMSGVLAGYGFC 233

Query: 176 IMVMRLMINFDV 187
            +    + +  V
Sbjct: 234 CLWFDKITDIKV 245


>gi|319761633|ref|YP_004125570.1| type ii secretion system f domain protein [Alicycliphilus
           denitrificans BC]
 gi|330823499|ref|YP_004386802.1| type II secretion system F domain-containing protein
           [Alicycliphilus denitrificans K601]
 gi|317116194|gb|ADU98682.1| Type II secretion system F domain protein [Alicycliphilus
           denitrificans BC]
 gi|329308871|gb|AEB83286.1| Type II secretion system F domain protein [Alicycliphilus
           denitrificans K601]
          Length = 405

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 57/182 (31%), Gaps = 11/182 (6%)

Query: 4   LIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            IKKR      K    D       +   ++AG+P+  +  ++    ++  V      +  
Sbjct: 51  KIKKRRASGGKKIKPKDIALFTRQMATMMKAGVPLLQSFDIVGRGNTNASVTKLLNDIRA 110

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SL+ +  +                +    +  G L   L  L+  +   + +K+
Sbjct: 111 DVETGTSLNAAFRKYPM-----YFDSLYCNLVEAGEAAGILEALLDRLATYMEKTEAIKS 165

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           K+++  M   +   +   +   +   V             D     LL +A +   +   
Sbjct: 166 KIRSALMYPISVLVVAFVVVTVIMIFVIPAFKEVFTSFGADLPAPTLLVMAISEFFVAYW 225

Query: 178 VM 179
            +
Sbjct: 226 WL 227



 Score = 34.7 bits (78), Expect = 6.5,   Method: Composition-based stats.
 Identities = 15/130 (11%), Positives = 37/130 (28%), Gaps = 5/130 (3%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPL 78
               +     AG+P+ +A+  + G S + V       + T  +   +S   S        
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNSVY-----AVATDRIQQEVSTGTSLTAAMGNA 329

Query: 79  QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPF 138
                    +    +  G++   L   +       +      +  ME     ++   +  
Sbjct: 330 NVFPSMVLQMCAIGEESGSIDHMLGKAADFYEAEVDEMVAGLSSLMEPIIIVFLGTLIGG 389

Query: 139 CVSTLVYFTS 148
            V ++     
Sbjct: 390 IVVSMYLPIF 399


>gi|194288828|ref|YP_002004735.1| tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222663|emb|CAQ68666.1| Tad secretion system, secretion accessory protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 324

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 73/166 (43%), Gaps = 4/166 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   + +R     ++FP+ +D++   V AGL +  A+  +  +       +  E + ++ 
Sbjct: 157 LARKVSQRQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLL 216

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S  ++++ +     +++V  F++++    + G +L E+L  LS +LR ++ M+A
Sbjct: 217 ELRSGFSKEKALTNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRA 276

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           + QA  +        I    P  +  L+         VL+    G 
Sbjct: 277 EEQAAKIALKLLFPLIFTIFPSLLLVLLGPAFIQIYRVLLPTMAGQ 322


>gi|254429908|ref|ZP_05043615.1| Bacterial type II secretion system protein F domain [Alcanivorax
           sp. DG881]
 gi|196196077|gb|EDX91036.1| Bacterial type II secretion system protein F domain [Alcanivorax
           sp. DG881]
          Length = 306

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 73/182 (40%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           +   +++     +  P  +D  +R + AG  +  ++      +    +    R+      
Sbjct: 119 RFRFQQQRRAIFESLPGIMDSTLRYMGAGRSLEASLLESFQDAPPVFQPLTFRLRSAVES 178

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G   +       R   +  +   S  +   ++ G ++   L  ++  LR ++ ++ +  A
Sbjct: 179 GRDYTGLFDDFARLYRVPSLVLVSIALRTSARFGSSIRPVLQQVANSLRSQQELRREFLA 238

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
            + E + +A     LP  ++  +   +  Y +VL+    GH +L +A     IG++++  
Sbjct: 239 STAETRFTAGAFTLLPLGMAVYMMLINEKYADVLLRTDTGHTMLIIAGVLQGIGVVIIWR 298

Query: 182 MI 183
           M+
Sbjct: 299 MV 300


>gi|91786744|ref|YP_547696.1| type II secretion system protein [Polaromonas sp. JS666]
 gi|91695969|gb|ABE42798.1| type II secretion system protein [Polaromonas sp. JS666]
          Length = 405

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/167 (12%), Positives = 51/167 (30%), Gaps = 6/167 (3%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRRVIETQHLGLSLSESISRM 72
            D       +   ++AG+P+  +  ++   +    V      V      G SLS +  + 
Sbjct: 66  KDIAIFTRQLATMMKAGVPLLQSFDIVGRGNPNGSVTKLLNDVRTDVETGTSLSAAFRKY 125

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
                    +     +    +  G L   L  L+  +   + +K+K+++  M   +   +
Sbjct: 126 PL-----YFNALYCNLVEAGEAAGILESLLDRLAVYMEKTEAIKSKIKSALMYPISVVVV 180

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
              +   +   V             D     L  +A +   +    +
Sbjct: 181 AFVVVAVIMIFVIPAFKEVFTSFGADLPAPTLFVIAVSEFFVAYWWL 227



 Score = 35.5 bits (80), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 40/131 (30%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + +      ++ +    G SL+ ++        
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNSLYADATEKIQQEVSTGTSLTAAMGNA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +       +      +  ME     ++   + 
Sbjct: 330 -NLFPTMVLQMCAIGEESGSVDHMLGKAADFYEAEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|188997645|ref|YP_001931896.1| type II secretion system protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932712|gb|ACD67342.1| type II secretion system protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 406

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 65/185 (35%), Gaps = 13/185 (7%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRR-VIETQHLGLSLS 66
           +     +D       +   + AG+ ++ A+ ++  Q  +P   E    V +    G+SLS
Sbjct: 62  KKKVKEEDLAIFARQLGAMIGAGIGIAQALEILSEQMPNPTLKEALINVKDDVITGMSLS 121

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
           +S+ +  +  P      F   +   ++  G L E L   +        ++ K+ + S   
Sbjct: 122 KSMQKHPKVFPP-----FLINLIAAAEESGKLDEILKRATIYYEKLAAIRRKIISASWYP 176

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAA-------AFMLIGIMVM 179
            A   I   +   + T V  T          +      + +            +IG  V+
Sbjct: 177 AAVVIIATVIVLGLLTFVVPTFAEIYASFGGELPLLTQILINISNSLKENILYVIGFFVI 236

Query: 180 RLMIN 184
            +++N
Sbjct: 237 FVIMN 241


>gi|299069495|emb|CBJ40764.1| Type II secretion system protein [Ralstonia solanacearum CMR15]
          Length = 308

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 83/182 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G
Sbjct: 125 NRTRRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLTSTTQLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KDLDAAVLAVGQLYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  +
Sbjct: 245 SAETRLSAWILGLLPVVVGGIIIMVNAPYVMSMWRDPSGKMLMMAAFGLEVMGSLILARL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|300021859|ref|YP_003754470.1| type II secretion system protein F [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523680|gb|ADJ22149.1| Type II secretion system F domain protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 68/158 (43%), Gaps = 4/158 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           + + ++KR       FP+ALD+++  V++G+ V  A A +  + ++    +  E      
Sbjct: 167 ISNRVQKRQTSIKQAFPDALDMLLICVQSGMSVEAAFAKVGKEIANQSIELAEEMALTTA 226

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   + +   L  V   +T +    + G  + +AL  +++  R+ +  +A
Sbjct: 227 ELSYLQDRRQAYENLAKRTGLPGVKGVATALVQAERYGTPVGQALRTMAKENREIRQSEA 286

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           + +A ++  K     I+  LP     ++     GYM +
Sbjct: 287 ERKASALPPKLTVPMIVFFLPVLFIVILGPAGIGYMQM 324


>gi|237733160|ref|ZP_04563641.1| predicted protein [Mollicutes bacterium D7]
 gi|229383704|gb|EEO33795.1| predicted protein [Coprobacillus sp. D7]
          Length = 315

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 79/188 (42%), Gaps = 2/188 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ--SSDPVRSEFRRVIET 58
           +    + +  +   +F   ++ I   +  G  + +A+  I+ +  +S  + +E   V + 
Sbjct: 128 VNKRAETKKEELTLEFLEKINEISAHLSVGKTIPNALDEIIKEQNTSQVLINELITVKQN 187

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
            +LG  LS+S      ++ ++E+  F+  +SV  + GGN+ E L       + +  +K  
Sbjct: 188 LNLGYPLSKSFMLAYEHLQIEEIKTFAMTLSVYEETGGNIIEVLKANDNFFQSKIKIKNT 247

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
            +      K S  +   +P     LV F +P +         G ++  +A +F+L GI +
Sbjct: 248 QKVYISSLKTSQKLTVGIPLGFIVLVIFINPSFFGDFYGTAVGELVGIIAISFLLFGIFL 307

Query: 179 MRLMINFD 186
              +    
Sbjct: 308 SNKIAKLK 315


>gi|163856390|ref|YP_001630688.1| hypothetical protein Bpet2079 [Bordetella petrii DSM 12804]
 gi|163260118|emb|CAP42419.1| putative membrane protein [Bordetella petrii]
          Length = 281

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 54/176 (30%), Positives = 101/176 (57%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F    P AL  +  ++RAG+ VS A+  IV  S  P+  EF  ++  Q LG+S   +++R
Sbjct: 106 FEQQLPGALLALASALRAGVGVSTALRHIVDHSEPPLAQEFGLMLREQRLGVSFDAALAR 165

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
           + + +P +  +  +  + V +  GGNL+E L  ++R LR+R  ++ KV+AL+ + +  AW
Sbjct: 166 LSQRVPSEASALVAAALRVATHTGGNLAETLDGIARTLRERLQLQGKVRALTAQGRLQAW 225

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
           I+G+LP  ++ ++    P  M +L + P G  +L V A     G++++R +++ D+
Sbjct: 226 IVGALPLLLAAVLDRMEPDAMAILWHTPLGWAVLAVVAGLETAGVLLIRRIVDIDI 281


>gi|71906278|ref|YP_283865.1| type II secretion system protein [Dechloromonas aromatica RCB]
 gi|71845899|gb|AAZ45395.1| type II secretion system protein [Dechloromonas aromatica RCB]
          Length = 408

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 49/167 (29%), Gaps = 6/167 (3%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISR 71
             D       +   +++G+P+  +  ++    S+  V      +      G SLS++  +
Sbjct: 68  DKDISLFTRQLATMMKSGVPLLQSFDIVGRGHSNPAVGKLLLDIKADVETGSSLSQAFRK 127

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                           +    +  G L   L  L+        +K+K+++      A   
Sbjct: 128 YPLQ-----FDALYCNLVSAGEQAGILDTLLDRLASYKEKILAIKSKIKSALFYPVAILV 182

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +   +   +   V             D     L+ +A +   +    
Sbjct: 183 VAFIITAVIMIFVIPAFKEVFKGFGADLPAPTLIVIAISDFFVAYWW 229


>gi|254419878|ref|ZP_05033602.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
 gi|196186055|gb|EDX81031.1| Bacterial type II secretion system protein F domain [Brevundimonas
           sp. BAL3]
          Length = 326

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 69/164 (42%), Gaps = 5/164 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + + I KR    +  FP+ALD+++  V AG+ +  A+A +  +   SS  +  E   +  
Sbjct: 165 LTNRITKRRTSIMQAFPDALDLLLICVEAGMSIEAAIAKVSQEIGTSSIELAEELSLLSA 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   + +      V   +  ++     G  LS AL  +++  RD +   A
Sbjct: 225 ELSYLPDRRMAYENLGKRTNHPGVKSVAVAMTQAETYGTPLSSALRVMAKENRDLRLSAA 284

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A ++ A+ +  +I      +  ++    P  +N++    +G
Sbjct: 285 EKKAAALPAQLTVPMILFFLPVLFIVI--LGPAILNIMDTMAKG 326


>gi|163745841|ref|ZP_02153200.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161380586|gb|EDQ04996.1| type II/IV secretion system protein, TadC subfamily, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 326

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 70/162 (43%), Gaps = 3/162 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  +  R  +    FP+ALD+++  V AG  +   +  +  +   S   +  EF  V  
Sbjct: 164 VRRRVDSRKEEITRGFPDALDMMLVCVEAGQSLDQCIVRVGRELRASYPALAEEFEMVAY 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      ++ M     +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 224 EMKAGKDRITVLNDMSERCGVQDVSSFVTVLIQSAAFGTSIADALRVYAEEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           +  A  +  K +   +G     +  ++   S   ++ L    
Sbjct: 284 EEAANKLPTKMTLATMGLTVPPLLIILIGPSAHGISQLGQMG 325


>gi|87199097|ref|YP_496354.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134778|gb|ABD25520.1| type II secretion system protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 335

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 61/148 (41%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +++L+ KRT       P+ALD++V    AGL V  A + +  +   +   +  EF     
Sbjct: 171 IQNLVSKRTVAVRKGLPDALDLLVICAEAGLTVDAAFSRVARELGRAYPELGDEFALTAI 230

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +   + L  V    T +    + G  L+ AL  LS   R+ + M+A
Sbjct: 231 ELSFLTERRHAFENLAYRVDLDSVKGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRA 290

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 291 EEKAARLPAIMTIPLILFILPVLFIVIL 318


>gi|294676064|ref|YP_003576679.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
 gi|294474884|gb|ADE84272.1| type II secretion system protein [Rhodobacter capsulatus SB 1003]
          Length = 337

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 70/159 (44%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   +  RT +  D FP+ALD+++  V AG  +   +  +  +   S   +  EF  V  
Sbjct: 172 VNQRVAARTQEIQDGFPDALDMLLVCVEAGQSLDQGIIRVSKELSSSYPALAEEFATVAH 231

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               GL     +        + +V+ F TV+    Q G +++EAL   +  +RD++ M+A
Sbjct: 232 EIKAGLDKPTVLRAFAERSGVSDVASFVTVMIQSQQFGTSIAEALRLYAADMRDKRIMRA 291

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVL 155
           +  A  +  K +   ++ ++P  +  LV  +    M   
Sbjct: 292 EEAANKIPTKMTLGTMMFTVPPLLIILVGPSVHDMMENF 330


>gi|163733537|ref|ZP_02140980.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
 gi|161393325|gb|EDQ17651.1| type II/IV secretion system protein, TadC subfamily, putative
           [Roseobacter litoralis Och 149]
          Length = 327

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 71/165 (43%), Gaps = 3/165 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  +  R  +    FP++LD+++  V AG  +   +  +  +   S   +  EF  V  
Sbjct: 163 VRRRVDTRKDEITRGFPDSLDMMLVCVEAGQSLDQCIVRVSKELHASYPALAQEFDVVAY 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  ++       +Q+VS F TV++   Q G +++EAL   +  +RD++ M+A
Sbjct: 223 EMKAGKDKTTVLNDFGERCGVQDVSSFVTVLNQSQQFGTSIAEALRVYAGEMRDKRVMRA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           +  A  +  K +   +      +  ++   S   +  L N   G 
Sbjct: 283 EEAANKLPTKMTLATMMLTVPPLLIILVGPSVHGITQLGNLGAGQ 327


>gi|121603678|ref|YP_981007.1| type II secretion system protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120592647|gb|ABM36086.1| type II secretion system protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 405

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 58/185 (31%), Gaps = 11/185 (5%)

Query: 1   MKHLIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRR 54
           +   IKKR           D       +   ++AG+P+  +  ++   +    V      
Sbjct: 48  LASKIKKRRMRSGKAIKPRDIAIFTRQLATMMKAGVPLLQSFDIVGRGNPNGSVTKLLND 107

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           V      G SLS +  +          +     +    +  G L   L  L+  +   + 
Sbjct: 108 VRTDVETGTSLSGAFRKYPM-----YFNALYCNLVEAGEAAGILESLLDRLAIYMEKTEA 162

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K+K+++  M   +   +   +   +   V        +    +     L+ +A +   +
Sbjct: 163 IKSKIKSALMYPASVVVVAFVVVAVIMIFVIPAFKQVFSSFGAELPAPTLIVMAISEFFV 222

Query: 175 GIMVM 179
               +
Sbjct: 223 AYWWL 227



 Score = 34.3 bits (77), Expect = 8.9,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 40/131 (30%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + +      ++ +    G SL+ ++        
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNSLYADATEKIQQEVSTGTSLTAAMGNA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +       +      +  ME     ++   + 
Sbjct: 330 -NLFPTMVLQMCAIGEESGSVDHMLGKAADFYEAEVDEMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|126725975|ref|ZP_01741817.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
 gi|126705179|gb|EBA04270.1| type II/IV secretion system protein, TadC subfamily
           [Rhodobacterales bacterium HTCC2150]
          Length = 318

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 61/148 (41%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +      R    +  FP++LD+++  V +G  +  A+  +  +       +  EF  V  
Sbjct: 160 VTRRRGTRQKNIIQAFPDSLDLMLICVESGQSLDQAIIKVSKEIRAGYPDLADEFELVAY 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      +        + ++S F +V+   +  G  ++EAL   S  +RD++ M+A
Sbjct: 220 EIKAGKDKKRVLKDFSERCGVPDISSFVSVLIQAATYGTPIAEALRAYSAEMRDKRVMRA 279

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +   +      +  ++ 
Sbjct: 280 EEKANTLPVKMTLGTMVFCLPSLLIILV 307


>gi|241760203|ref|ZP_04758299.1| pilin biogenesis protein [Neisseria flavescens SK114]
 gi|241319314|gb|EER55779.1| pilin biogenesis protein [Neisseria flavescens SK114]
          Length = 413

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 64/187 (34%), Gaps = 7/187 (3%)

Query: 1   MKHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +  +   R  +   +D       +   ++AGLP+  A  ++    S+  +     +V   
Sbjct: 59  ISKVKTARKRRITQEDITVFTRQLATMMKAGLPLMQAFEIVARGHSNPSMTEMLMQVRSD 118

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G +L +S S+  +         F   +    + GG L   L  L+      + +K K
Sbjct: 119 VEQGSALGKSFSKYPK-----YFDRFYCNLVSAGESGGVLESLLDKLAVYKEKTQAIKKK 173

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           V+       A   +  +L F +   V          +  +      L ++ + + +    
Sbjct: 174 VKTALTYPIAIIVVAIALIFIMMMFVLPAFKEVYANMGAELPSLTQLVMSLSDLFVDYGW 233

Query: 179 MRLMINF 185
           + +++  
Sbjct: 234 IMIILLI 240


>gi|227494921|ref|ZP_03925237.1| type II secretion system protein [Actinomyces coleocanis DSM 15436]
 gi|226831373|gb|EEH63756.1| type II secretion system protein [Actinomyces coleocanis DSM 15436]
          Length = 291

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 81/187 (43%), Gaps = 3/187 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  ++KR   F   +P+ +D ++ +VRAG+ + +AV  +     +  R+ F+       
Sbjct: 102 LRARLQKRQQLFAGAWPDIVDSLLTAVRAGVSLPEAVVQLSHSGPEITRTYFQHFAMEYR 161

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGN-LSEALANLSRILRDRKNMKAKV 119
                  +++ +      +       VI +  ++GG+ +   L +LS ++R+   +  ++
Sbjct: 162 SSGKFDVALTSLQSNFADKNSKRVFEVIRLGREVGGSEMGNILRDLSAMMRENLRISGEI 221

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           QA       +A +  + P+ V  ++   +    +   +   G M+L +          +M
Sbjct: 222 QARQSWTVNAARLAVAAPWIVLLMISMRTDAASS--YSTTNGMMILALGGIACTFAYWLM 279

Query: 180 RLMINFD 186
           + + +FD
Sbjct: 280 QKLGSFD 286


>gi|148253056|ref|YP_001237641.1| putative Type II secretion system protein [Bradyrhizobium sp.
           BTAi1]
 gi|146405229|gb|ABQ33735.1| putative Type II secretion system protein precursor [Bradyrhizobium
           sp. BTAi1]
          Length = 329

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 103/184 (55%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    K+    F+D FP+A+D + R +RAGLP++ A+  +    S PV   F  + +   
Sbjct: 141 LSREQKQTERMFVDLFPDAVDTVARMLRAGLPITVAMRTVAVDGSPPVSRVFGLIADELR 200

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+ L E++    R + L +  FF+  +++Q   GGNL+  L +LS I+R R+  + K +
Sbjct: 201 IGVPLEEALDTNSREIGLPDFRFFAVAMTLQFATGGNLTATLESLSDIIRKRRAARLKAK 260

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A + E + +A+ +G++P   +  +    P Y+  L  DPRGH++L +A A +L+  + MR
Sbjct: 261 AATGEIRLTAYTLGAIPILTTGALLVVQPRYLTPLWTDPRGHLILVLAGALLLLSFLTMR 320

Query: 181 LMIN 184
            M+ 
Sbjct: 321 KMMR 324


>gi|212224827|ref|YP_002308063.1| hypothetical protein TON_1676 [Thermococcus onnurineus NA1]
 gi|212009784|gb|ACJ17166.1| conserved hypothetical membrane protein [Thermococcus onnurineus
           NA1]
          Length = 355

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 72/181 (39%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHL 61
           K + K+R  +     P AL  +   + AG+ +S+A+  +       +  EF  ++     
Sbjct: 169 KMMWKRRVVEVERAMPYALRHMASLLSAGVGISEAILSVARADYGVISEEFELILRDMRT 228

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
           G S  E++++    M  + VS     I    + GGNLSE L  ++        MK     
Sbjct: 229 GSSFEEALTKFDEKMSSENVSRVVKQILRAVKFGGNLSEVLYKMAEDFAFEYRMKLIEYV 288

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
             +   A  ++  ++      +V   +   M   +  P   + + +  AF  +  +++ +
Sbjct: 289 QRVNGIAFIYMFITIVMPTMFVVGILAGSVMAQSLIMPPETLAVILLFAFPALSFIIVNM 348

Query: 182 M 182
           +
Sbjct: 349 I 349


>gi|197123313|ref|YP_002135264.1| type II secretion system protein [Anaeromyxobacter sp. K]
 gi|196173162|gb|ACG74135.1| type II secretion system protein [Anaeromyxobacter sp. K]
          Length = 306

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 66/165 (40%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  ++ R  +     P+ALD++V  V AGL +  A+  +  +   +   +  E R V  
Sbjct: 140 LRSRVQARQTQLDRSLPDALDLLVTCVEAGLGLDSALQRVSDEVALAHPLLSKELRLVFL 199

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G+    +  RM       E+   S  ++     G ++  AL   +  +R R+  +A
Sbjct: 200 EVKAGIPRIAAFRRMAERTGAPELRSLSATLAQTELFGTSVGAALRIQAEGIRIRRMHRA 259

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +  K S   ++  LP   + ++        + L     G
Sbjct: 260 EEKAAYVSVKMSLPLVLCILPCVFAVVLGPAVVNMADRLFPLLGG 304


>gi|291548759|emb|CBL25021.1| Flp pilus assembly protein TadB [Ruminococcus torques L2-14]
          Length = 251

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 79/186 (42%), Gaps = 6/186 (3%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP------VRSEFRRVIETQHL 61
           +  +F   F +++  +  +++AG  V +A+                +R E+ +++    L
Sbjct: 66  KEQEFRRQFRDSIQTMAGALKAGYSVENAIRETNRDLIGMYDANTRIRKEYGQMVRRLDL 125

Query: 62  GLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQA 121
            LS+   ++     +  ++V+ F TV +     GG+    + + +R + ++ + + ++Q 
Sbjct: 126 NLSVVTVLNEFAAEVKQEDVTNFITVYAAAKVSGGDSIAIIRDAARTIGEKIDTEREIQT 185

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
           +    K    I+  +PF +   +  T   +++VL     G +++ +     L        
Sbjct: 186 MLAAKKLEFEIMSVIPFIMILYMKMTFGEFLSVLYGTWTGCIVMSICLVLYLGAYRFGWR 245

Query: 182 MINFDV 187
           ++  ++
Sbjct: 246 LLQIEI 251


>gi|222147177|ref|YP_002548134.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734167|gb|ACM35130.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 326

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 57/148 (38%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           + + I KR       +P+ALD+++  V +G+ +  A+  +  +    S  +  E      
Sbjct: 168 ISNRITKRQHSIRRAWPDALDLMLICVESGMSMEAAMRRVADEMASQSPALAEEMVLTTA 227

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +     L+ V      +    + G  + +AL  L++  RD +   A
Sbjct: 228 ELSFLQDRRTAYENLGNRTQLEIVKSVCQALIQAERYGTPIGQALRVLAQEGRDERMNAA 287

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +  +I      +  ++ 
Sbjct: 288 EKKAAALPPKLTVPMILFFLPVLVAVIL 315


>gi|154507637|ref|ZP_02043279.1| hypothetical protein ACTODO_00118 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797271|gb|EDN79691.1| hypothetical protein ACTODO_00118 [Actinomyces odontolyticus ATCC
           17982]
          Length = 292

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 65/177 (36%), Gaps = 3/177 (1%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
                 +P  +D +V  VRAG  +   +  +  +   PVR  F               ++
Sbjct: 107 KTVRAAWPEVIDAMVSGVRAGTALPQVLCDLAEEGPVPVRFAFEAFSRDYSANGRFELAL 166

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
             M   +           + +     G +L+  L +L+ +LR+   ++ +++A       
Sbjct: 167 DTMKETVADPVADRIVEALRIARSVGGADLTRLLQDLASLLREDARVRGELEARQSWTVG 226

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           +A +  + P+ V  L+          + N P G  +L   A   +I  ++M+ M   
Sbjct: 227 AARLGLAAPWVVLLLLSGGGAN--AHVWNSPGGVAVLCSGAGICVIAYLIMKAMGRL 281


>gi|332526519|ref|ZP_08402631.1| pilus tip-associated protein [Rubrivivax benzoatilyticus JA2]
 gi|332110787|gb|EGJ10964.1| pilus tip-associated protein [Rubrivivax benzoatilyticus JA2]
          Length = 410

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 56/182 (30%), Gaps = 10/182 (5%)

Query: 1   MKHLIKKR----TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRV 55
           +  + K+R     +    D       +   ++AG+P+  A  ++    S+  +      +
Sbjct: 54  VTKVKKRRTSGGRSIKQKDIAIFTRQLATMMKAGVPLLQAFDIVARGASNPRMTKLLNDI 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G SLS +  +  ++            +    + GG L   L  L+        +
Sbjct: 114 RSDVETGTSLSAAFRKHPQH-----FDSLYCNLIEAGEAGGILEALLERLAIYQEKTMAL 168

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K K+++  M   A   +   +   +   V             D     L  +A +   + 
Sbjct: 169 KQKIKSALMYPIAVMVVAFVVLTVIMIWVIPAFKEVFRSFGADLPAPTLFVIALSEFFVN 228

Query: 176 IM 177
             
Sbjct: 229 WW 230



 Score = 35.5 bits (80), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 39/130 (30%), Gaps = 5/130 (3%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPL 78
               +     AG+P+ +A+  + G S + V         T+ +   +S   +        
Sbjct: 280 WTRTLSTMFAAGVPLVEALDSVGGASGNAVY-----AQATEQIQKDVSTGSALTTSMTAT 334

Query: 79  QEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPF 138
                    +S   +  G+L   L   +    +  +   K  +  ME      +   +  
Sbjct: 335 SVFPTMVLQMSAIGEESGSLDHMLGKAAEFYEEEVDDMVKGLSSLMEPFIIVILGVLIGG 394

Query: 139 CVSTLVYFTS 148
            V ++     
Sbjct: 395 IVVSMYLPIF 404


>gi|110632959|ref|YP_673167.1| type II secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283943|gb|ABG62002.1| type II secretion system protein [Chelativorans sp. BNC1]
          Length = 323

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 60/148 (40%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +++ I KR       +P ALD+++  V +G+ +  A   +  +    S  +  E      
Sbjct: 165 IRNKITKRQKAIQRAWPEALDLLLICVESGMSIESAFRKVAEEIGTQSAEIAEEIALTTA 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   + R   ++ V    T +    + G  L +AL  +++  RD +  +A
Sbjct: 225 ELSFLQDRRQAYENLGRRTGVEGVRAAVTSLIQAEKYGTPLGQALRVMAQENRDMRMSEA 284

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +  +I      +  ++ 
Sbjct: 285 EKRAAALPPKLTVPMIVFFLPVLFAVII 312


>gi|17549305|ref|NP_522645.1| pilus assembly transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17431557|emb|CAD18235.1| probable pilus assembly tadb transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 308

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 84/182 (46%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  ++   + +   P  LD +VR +  G  V  A       +  P+R+    + + Q  G
Sbjct: 125 NRTRRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLTSITQLQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KDLDAAVLAVGQLYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQKELLAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  +
Sbjct: 245 SAETRMSAWILGLLPVVVGGIIIMFNAAYVMSMWRDPSGKMLMMAAFGLEVMGSLMLARL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|187926430|ref|YP_001892775.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|241665917|ref|YP_002984276.1| type II secretion system protein [Ralstonia pickettii 12D]
 gi|187728184|gb|ACD29348.1| type II secretion system protein [Ralstonia pickettii 12J]
 gi|240867944|gb|ACS65604.1| type II secretion system protein [Ralstonia pickettii 12D]
          Length = 308

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 83/182 (45%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
           +  +K   + L   P  LD +VR +  G  V  A       +  P+R+    + + Q  G
Sbjct: 125 NRTRKMNERLLQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEQPLRNCLTAITQMQRAG 184

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQAL 122
             L  ++  + R   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ AL
Sbjct: 185 KDLDAAVLTVGRQYRVNELILLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQRELFAL 244

Query: 123 SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLM 182
           S E + SAWIIG LP  V  ++   +  Y+  +  DP G  L+  A    ++G +++  +
Sbjct: 245 SAETRLSAWIIGLLPVVVGGVIIMFNAAYIMSMWRDPFGKTLILTAFGMEVLGAVMLARL 304

Query: 183 IN 184
             
Sbjct: 305 AK 306


>gi|294338834|emb|CAZ87168.1| type 4 fimbrial assembly protein [Thiomonas sp. 3As]
          Length = 406

 Score = 81.7 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 54/184 (29%), Gaps = 10/184 (5%)

Query: 1   MKHLIKKR----TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRRV 55
           +  + K+R     A    D       +   ++AG+P+  +  ++        +      +
Sbjct: 49  VTKVKKRRLTSGKAIKAKDISTFTRQMSTMIKAGVPLLQSFDIVGRGHPNPNMARLIMDI 108

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G SLS +  +  +             +    +  G L   L  L+        +
Sbjct: 109 RGDVETGTSLSNAFRKHPK-----YFDALYCNLVEAGETAGMLELVLDRLATYQEKSLAI 163

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           ++K+++      A   +   +   +   V        +          L+ VA +   + 
Sbjct: 164 RSKIKSALTYPIAVMVVAFVVVSIIMLFVVPVFTDVFSQFGASLPAPTLMVVAISNFFVH 223

Query: 176 IMVM 179
              +
Sbjct: 224 YWYI 227



 Score = 38.9 bits (89), Expect = 0.34,   Method: Composition-based stats.
 Identities = 18/135 (13%), Positives = 45/135 (33%), Gaps = 7/135 (5%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVR-SEFRRVIETQHLGLSLSESISRMV 73
                   +     AG+P+ +A+  + G + + V      ++ +    G SL+ S+    
Sbjct: 271 ALARWTRTLATMFGAGVPLVEALDAVGGAAGNIVYLRATEKIQQDVSTGTSLTTSMQTQG 330

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
            + P          ++   +  G+L   L+  + I     +   K  +  +E     ++ 
Sbjct: 331 VFPP------LVIQLTSIGEESGSLDSMLSKAADIYEAEVDELVKNLSALLEPIIIVFLG 384

Query: 134 GSLPFCVSTLVYFTS 148
             +   V  +     
Sbjct: 385 VIIGGLVVAMYLPIF 399


>gi|121610838|ref|YP_998645.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121555478|gb|ABM59627.1| type II secretion system protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 407

 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 57/182 (31%), Gaps = 10/182 (5%)

Query: 3   HLIKKRTAKFLD----DFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIE 57
            + ++R          D       +   ++AG+P+  +  ++    ++  V      +  
Sbjct: 53  KIKERRMRSGKKVKPKDIALFTRQLATMMKAGVPLLQSFDIVGRGSTNPSVTKLLNDIRS 112

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G SLS +     +       +     +    +  G L   L  L+  +   + +K+
Sbjct: 113 DIETGTSLSGAFRHYPK-----YFNELYCNLVEAGETAGILESLLDRLATYMEKTEAIKS 167

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++++  M   A   +   +   +   V             D     LL +A +   +   
Sbjct: 168 RIKSALMYPSAVLCVAFVVVSLIMVFVIPAFKEVFTSFGADLPPPTLLVMAISETFVHWW 227

Query: 178 VM 179
            +
Sbjct: 228 WL 229



 Score = 36.3 bits (82), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 41/131 (31%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G + + V +    ++ +    G SL+ ++        
Sbjct: 277 WTRTLSTMFAAGVPLVEALDSVGGAAGNSVYASVTDKIQQEVSTGTSLTVAMGNA----- 331

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +       +      +  ME     ++   + 
Sbjct: 332 -NIFPTMVLQMCAIGEETGSIDHMLGKAADFYEAEVDTMVAGISSLMEPIIIVFLGCLIG 390

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 391 GIVISMYLPIF 401


>gi|167648147|ref|YP_001685810.1| type II secretion system protein [Caulobacter sp. K31]
 gi|167350577|gb|ABZ73312.1| type II secretion system protein [Caulobacter sp. K31]
          Length = 328

 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 65/158 (41%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIE 57
           + ++ +KR    +  FP+ALD+++  V +G+ +  A+A +  +       +  E   +  
Sbjct: 163 ISNIAQKRRESIVAAFPDALDLMLICVESGMSIEAAIAKVGAEVGGASIELAEELSLLTA 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   + R      +    T +    + G  L  AL  +++  RD +   A
Sbjct: 223 ELSYLPERRLAYEGLARRTNHPGIRSVVTAMIQAERYGTPLGAALRVMAKENRDLRLSAA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A ++ AK +  +I      +  ++    P  +N++
Sbjct: 283 EKKAAALPAKLTVPMILFFLPVLFIVI--MGPAAINIM 318


>gi|254475205|ref|ZP_05088591.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
 gi|214029448|gb|EEB70283.1| type II/IV secretion system protein, TadC subfamily [Ruegeria sp.
           R11]
          Length = 327

 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 71/160 (44%), Gaps = 3/160 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I++R  +    FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V  
Sbjct: 165 ITRRIEERKQEITSGFPDALDMMLVCVEAGQSLDQAIVRVAKELHASYPALAEEFEVVAY 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q+VS F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 225 EMKAGKEKDKVLRDMGTRCGVQDVSSFVTVMIQSATFGTSIADALRVYAGEMRDKRVMRA 284

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +  A  +  K +   +      +  ++   S   +  L N
Sbjct: 285 EEAANKLPTKMTLATMTLTVPPLLIILVGPSAQGIANLGN 324


>gi|300697739|ref|YP_003748400.1| type II secretion system protein [Ralstonia solanacearum CFBP2957]
 gi|299074463|emb|CBJ54013.1| Type II secretion system protein [Ralstonia solanacearum CFBP2957]
          Length = 318

 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 82/181 (45%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
             ++   + +   P  LD +VR +  G  V  A       +  P+R+      + Q  G 
Sbjct: 136 RTRRMNERLMQQLPGFLDGVVRLMSIGSAVPAAFQAASANTEPPLRTCLALTTQLQRAGK 195

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
            L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ ALS
Sbjct: 196 DLDAAVLAVGQLYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDREQAQKELLALS 255

Query: 124 MEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            E + SAWI+G LP  V  ++   +  Y+  +  DP G ML+  A    ++G +++  + 
Sbjct: 256 AETRLSAWILGLLPVVVGGIIIMFNATYVMSMWRDPVGKMLMMAAFGLEVMGSLMLARLA 315

Query: 184 N 184
            
Sbjct: 316 K 316


>gi|259418040|ref|ZP_05741959.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
 gi|259346946|gb|EEW58760.1| type II secretion system protein [Silicibacter sp. TrichCH4B]
          Length = 323

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 67/149 (44%), Gaps = 3/149 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I++R       FP+ALD+++  V AG  +  A+  +  +   S   +  EF  V  
Sbjct: 164 ITRRIEERKQAITRAFPDALDMMLVCVEAGQSLDQAIVRVGKELRASYPELAEEFEIVAY 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q+V+ F TV+   +  G ++++AL   +  +RD++ M+A
Sbjct: 224 EMKAGKEKDKVLRDMGTRCGVQDVASFVTVMIQSAAFGTSIADALRVYAGEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYF 146
           +  A  +  K +   +G     +  ++  
Sbjct: 284 EEAANKLPTKMTLATMGLTVPPLLAILIA 312


>gi|126737249|ref|ZP_01752984.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721834|gb|EBA18537.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 322

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 70/162 (43%), Gaps = 3/162 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +   +++R  K    FP++LD+++  V AG  +  ++  +  +       +  EF  V +
Sbjct: 160 VTRRVEERRQKIEQGFPDSLDMMLVCVEAGQSLDQSIVRVATELRASFPDLAYEFEIVAQ 219

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q++S F TV+      G ++++AL   +  +RD++ M+A
Sbjct: 220 EMKAGKDKEKVLRDMGTRCGVQDISSFVTVMIQSQSFGTSIADALRVYAGEMRDKRVMRA 279

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP 159
           +  A  +  K +   +      +  ++   S   +  + N  
Sbjct: 280 EEAANKLPVKMTLATMMLTVPPLLIILVGPSVQGILNMGNTG 321


>gi|83718164|ref|YP_440464.1| hypothetical protein BTH_II2276 [Burkholderia thailandensis E264]
 gi|83651989|gb|ABC36053.1| membrane protein, putative [Burkholderia thailandensis E264]
          Length = 296

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   I  R    ++DFP+ALD++   V AGL +  A+  +  +    S  V  E   ++ 
Sbjct: 131 LARRIASRQRMIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLL 190

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +      ++V  FS ++    + G ++  +L  LS  LR ++ M+A
Sbjct: 191 EMRSGFTKEAALRNLALRTGAEDVDAFSAMLIQADRFGTSIGASLRVLSDTLRTQRRMRA 250

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +        I    P  ++ L+          L+    G
Sbjct: 251 EERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTLLPTMAG 295


>gi|86137998|ref|ZP_01056574.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
 gi|85825590|gb|EAQ45789.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseobacter sp. MED193]
          Length = 326

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 70/160 (43%), Gaps = 3/160 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   I +R  +    FP++LD+++  V AG  +  ++  +  +   S   +  EF  V  
Sbjct: 164 VTRRIAERKEEIEAGFPDSLDMMLVCVEAGQSLDQSIVRVASELKASYPQLDYEFDIVAH 223

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G    + +  M     +Q++S F TV+   +  G +++EAL   +  +RD++ M+A
Sbjct: 224 EMKAGKDKEKVLRDMGTRCGVQDISSFVTVMIQSAAFGTSIAEALRVYASEMRDKRVMRA 283

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLIN 157
           +  A  +  K +   +      +  ++   S   +  + N
Sbjct: 284 EEAANKLPVKMTLATMMLTVPPLLIILVGPSVKNIMNMGN 323


>gi|269836553|ref|YP_003318781.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785816|gb|ACZ37959.1| type II secretion system protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 307

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 73/157 (46%), Gaps = 1/157 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + + IK+R +  +   P+A+D++  SV AGL    A+  +V +  + +  EF R++    
Sbjct: 150 LGNRIKRRKSAIIRALPDAIDLLTISVEAGLGFDPALQRVVEKWDNELTREFARMLSEIR 209

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S  E++  +     + +++ F + +    QLG ++++ L   S+ +R R+  +A+ Q
Sbjct: 210 MGQSRREALRDLAERTNVDDLNVFVSAVVQADQLGVSITQVLRVQSKQMRMRRRQRAEEQ 269

Query: 121 ALSMEAKA-SAWIIGSLPFCVSTLVYFTSPGYMNVLI 156
           A     K     +    P     L+    P   +  +
Sbjct: 270 AHKAPVKMIFPMVFLIFPALYIVLLGPAVPIVWDAFM 306


>gi|310640813|ref|YP_003945571.1| flp pilus assembly protein tadb-like protein [Paenibacillus
           polymyxa SC2]
 gi|309245763|gb|ADO55330.1| Flp pilus assembly protein TadB-like protein [Paenibacillus
           polymyxa SC2]
          Length = 263

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 80/193 (41%), Gaps = 8/193 (4%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS-------SDPVRSEFRR 54
           K L+++R +     F  AL  +  S+ AG  V +     V             +  EF  
Sbjct: 72  KFLLQRRRSALSIQFKQALYSLSSSLSAGRSVENGFREAVEDLRLLSPDGDHDLIFEFNI 131

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +     +G  +  ++  + R   +++++ F+ V +   + GG+L E +   S ++ ++  
Sbjct: 132 ITACLEIGQPVEAALQDLARRAQIEDITNFADVFAACKRTGGDLVEVVRRASSVIGEKLE 191

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           ++ ++  +  + +  + ++ + PF     +  T+  YM  L     G +L       +  
Sbjct: 192 IQQEIGVMIAQKRFESRVMFAAPFLFVLFMTVTAGDYMMPLY-SGTGMILSTFCLLVLGG 250

Query: 175 GIMVMRLMINFDV 187
            ++ +  ++  +V
Sbjct: 251 CLVWINHIMKIEV 263


>gi|219850073|ref|YP_002464506.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
 gi|219544332|gb|ACL26070.1| type II secretion system protein [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 72/163 (44%), Gaps = 1/163 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   IK+R    L   P+ALD++  SV AGL    A+  +  +  + +  EF+RV++   
Sbjct: 147 LDRKIKERKKNILKALPDALDLLCISVEAGLAFDLALQRVAQKWDNELSHEFQRVLQDIR 206

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LG +  E++  M     +++V  F + +    QLG ++S+ L   S  LR R+  +A+  
Sbjct: 207 LGRTRREALRDMAARTGVEDVQTFVSAVIQADQLGVSMSKILRIQSDQLRTRRRQRAEEA 266

Query: 121 ALSMEAKA-SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           A     K     +    P     ++    P  M+ L     G 
Sbjct: 267 AQKAPVKMLIPMVFLIFPALFVVILGPAVPRIMSALGVMNSGM 309


>gi|298345275|ref|YP_003717962.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
 gi|298235336|gb|ADI66468.1| type II secretion system protein [Mobiluncus curtisii ATCC 43063]
          Length = 295

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 75/175 (42%), Gaps = 3/175 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
             +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + 
Sbjct: 116 KAWPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILK 175

Query: 74  RYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
           R +           + + +Q  G +L   L +L  +LR  +  + +V A        A +
Sbjct: 176 RELADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARL 235

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             + P+ +  L+  + PG + V  + P G M+L V A    +  ++M  +   +V
Sbjct: 236 AAASPWIILALL-LSRPGTLEV-YSTPVGSMILLVGALVSALAYLMMLRLGRLEV 288


>gi|239917279|ref|YP_002956837.1| Flp pilus assembly protein TadB [Micrococcus luteus NCTC 2665]
 gi|281414243|ref|ZP_06245985.1| Flp pilus assembly protein TadB [Micrococcus luteus NCTC 2665]
 gi|239838486|gb|ACS30283.1| Flp pilus assembly protein TadB [Micrococcus luteus NCTC 2665]
          Length = 285

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 70/183 (38%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R+    + +P+A+D    ++RAGL + +A+  +     + +R  F++      
Sbjct: 94  LSWQARRRSTALRELWPDAIDHARSAIRAGLTLPEALIQLGETGPEGLREPFQQFARDYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G    +++ R+   M           + +  +  G ++   L  LS  LR    ++A++
Sbjct: 154 AGARFVDALDRLKARMADPVADRLVVSLRLTREVGGADIGRLLQTLSEFLRQDARIRAEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +    P+ V  L+                G  +L       ++   VM
Sbjct: 214 EARQSWTVNAARLAVCAPWLVLLLLGT--QPAAVAAYRSAAGGAVLLAGMVASVVCYRVM 271

Query: 180 RLM 182
             +
Sbjct: 272 LRI 274


>gi|315655695|ref|ZP_07908593.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
 gi|315489759|gb|EFU79386.1| type II secretion system protein [Mobiluncus curtisii ATCC 51333]
          Length = 295

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 75/175 (42%), Gaps = 3/175 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
             +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + 
Sbjct: 116 KAWPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILK 175

Query: 74  RYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
           R +           + + +Q  G +L   L +L  +LR  +  + +V A        A +
Sbjct: 176 RELADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARL 235

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             + P+ +  L+  + PG + V  + P G M+L V A    +  ++M  +   +V
Sbjct: 236 AAASPWIILALL-LSRPGTLEV-YSTPVGSMILLVGALVSALAYLMMLRLGRLEV 288


>gi|148557757|ref|YP_001265339.1| type II secretion system protein [Sphingomonas wittichii RW1]
 gi|148502947|gb|ABQ71201.1| type II secretion system protein [Sphingomonas wittichii RW1]
          Length = 330

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 60/148 (40%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +K+LI KR        P+ALD++V    AGL V  A   +  +   +   +  EF     
Sbjct: 170 VKNLITKRQQAIRKALPDALDLLVICAEAGLSVDLAFNRVARELSKAYPELGDEFALTAI 229

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   + + + L  +    T +    + G  L+ AL  LS   R  + M+A
Sbjct: 230 ELGFLTDRRQAFENLAQRVNLDSIRGVVTTMIQTEKYGTPLAAALRVLSAEFRHERMMRA 289

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 290 EEKAARLPAIMTVPLIMFILPVLFIVIL 317


>gi|313906428|ref|ZP_07839765.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
 gi|313468729|gb|EFR64094.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
          Length = 238

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 71/190 (37%), Gaps = 6/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS------DPVRSEFRRVIE 57
           L  KR       F + L  +  ++ AG  V + V              D +  E   ++ 
Sbjct: 49  LAWKRKQLLHYHFRDFLAALHTAMLAGYSVENGVKQAAKDLERLYGSSDVLCVELHDILR 108

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
             H    +      + R   L+++  F+ ++S+  + GGN++  L    R L  + + K 
Sbjct: 109 QMHFQKPVEVLFRDLGRRSGLEDIRNFAEILSIAKRTGGNMNMILQCTWRNLCGKIDTKQ 168

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIM 177
           ++  +    K    ++  +P  +   +  T  G++  +  +P G +++ V          
Sbjct: 169 EIDTMIAARKYEQKLMSLMPAGIILYLRLTFQGFIERMYGNPAGVLVMTVCLGVYAGAYF 228

Query: 178 VMRLMINFDV 187
             + + +  V
Sbjct: 229 FGKKLTDIRV 238


>gi|148655544|ref|YP_001275749.1| type II secretion system protein [Roseiflexus sp. RS-1]
 gi|148567654|gb|ABQ89799.1| type II secretion system protein [Roseiflexus sp. RS-1]
          Length = 299

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 58/146 (39%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           ++  +K+R        P+ LD++   V AG+    A+ ++V +   P+  E  R++    
Sbjct: 137 LRGRVKQRQHAITVALPDLLDMLAVCVSAGMGFDIALTLLVERGEGPLYEEMGRMLHELQ 196

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    ++   +        +  F   +    +LG  ++  L   +  +R  +  +A+ +
Sbjct: 197 MGAPREQAFRNLAARNSSDALRGFIDALLQAEELGSPIATTLERQAEDIRTGRRYRAREE 256

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYF 146
                 K +  ++  +   V  L+  
Sbjct: 257 GAKAATKITLIVVVLVTPSVLCLIIA 282


>gi|293189315|ref|ZP_06608038.1| putative bacterial type II secretion system protein F domain
           protein [Actinomyces odontolyticus F0309]
 gi|292821778|gb|EFF80714.1| putative bacterial type II secretion system protein F domain
           protein [Actinomyces odontolyticus F0309]
          Length = 291

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 66/177 (37%), Gaps = 3/177 (1%)

Query: 10  AKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESI 69
                 +P  +D +V  VRAG  +   +  +  +   PVR  F               ++
Sbjct: 107 KTVRAAWPEVIDAMVSGVRAGTALPQVLCDLADEGPVPVRFAFEAFSRDYSANGRFELAL 166

Query: 70  SRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA 128
             M   +           + +     G +L+  L +L+ +LR+   ++ +++A       
Sbjct: 167 DTMKETVADPVADRIVEALRIARSVGGADLTRLLQDLASLLREDARVRGELEARQSWTVG 226

Query: 129 SAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
           +A +  + P+ V  L+     G    + N P G  +L   A   +I  ++M+ M   
Sbjct: 227 AARLGLAAPWVVLLLLS--GGGASAHVWNSPGGVAVLCSGAGICVIAYLIMKAMGRL 281


>gi|149186259|ref|ZP_01864573.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
 gi|148830290|gb|EDL48727.1| hypothetical protein ED21_31019 [Erythrobacter sp. SD-21]
          Length = 329

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 60/148 (40%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + ++  KRT       P+ALD++V    AGL V  A   +  +   +   +  EF     
Sbjct: 169 LSNIASKRTDAIRKGLPDALDLLVICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAI 228

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +   + L+ V    T +    + G  L+ AL  LS   R+ + M+A
Sbjct: 229 ELSFLNERKKAFDNLAYRVNLEAVKGVVTTMVQTERYGTPLASALRVLSAEFRNERMMRA 288

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 289 EEKAARLPAIMTVPLIMFILPVLFIVIL 316


>gi|114764951|ref|ZP_01444124.1| Putative Flp pilus assembly protein TadC [Pelagibaca bermudensis
           HTCC2601]
 gi|114542663|gb|EAU45687.1| Putative Flp pilus assembly protein TadC [Roseovarius sp. HTCC2601]
          Length = 323

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 70/148 (47%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   +++R  +  + FP+ALD+++  V AG  +  ++  +  +   S   +  EF  +  
Sbjct: 161 ITKRVEERKKQIEEGFPDALDMMLVCVEAGQSLDQSIVRVSKEIRASYAALADEFEIISH 220

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   +  ++ M     + +VS F TV++  S  G ++++AL   +  +RD++ M+A
Sbjct: 221 EMKAGKDKASVLNDMGERCGVADVSSFVTVLNQASTFGTSIADALRIYASEMRDKRVMRA 280

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  +  K +   +      +  ++ 
Sbjct: 281 EEKANKLPTKMTLTTMMLTVPPLLIILV 308


>gi|239629081|ref|ZP_04672112.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239519227|gb|EEQ59093.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 227

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 78/192 (40%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD------PVRSEFRRV 55
           + L ++R  +    F   + ++   + AG  + + +A+  G+          +  EF  +
Sbjct: 36  RDLRQERIRQLGLQFKEGILVLASYLGAGYSLENGLAMCTGELEGIYGKQGMITEEFSTL 95

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                +   +   +        L++V  F+ V +   + GG L   +   + I+RD+  +
Sbjct: 96  TNGVRMNRPVELLLMEFGARSGLEDVDHFAQVFAAARRSGGELVGIINYTAGIIRDKVQV 155

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + ++  ++        I+  +PF +   +  TS G+  V+     G  ++ +  A  L  
Sbjct: 156 QEEIHTMTAARVFEQKIMNGIPFLIVLYIDLTSLGFFRVMYETMMGRAVMTICLAVYLGA 215

Query: 176 IMVMRLMINFDV 187
            M+ + ++  +V
Sbjct: 216 WMLSKKILEIEV 227


>gi|329847258|ref|ZP_08262286.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
 gi|328842321|gb|EGF91890.1| bacterial type II secretion system protein F domain protein
           [Asticcacaulis biprosthecum C19]
          Length = 343

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 59/148 (39%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD---PVRSEFRRVIE 57
           + +   KR    +  FP+ALD+++  V AG+ +  A+  +  +      P+  E   ++ 
Sbjct: 165 ISNTASKRRQSIVAAFPDALDLLLICVEAGMSIETALHKVSQEIGGTSIPLAEEMSLLVA 224

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++     +      +    T +    + G  L  AL  +++  R+ +   A
Sbjct: 225 ELSYLPERRQAYEGFSKRTSHPGIKSVCTAMIQAEKYGTPLGTALRVMAKENRELRLSAA 284

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++ A+ +  +I      +  ++ 
Sbjct: 285 EKKAAALPAQLTVPMIVFFLPVLFVVIL 312


>gi|297171607|gb|ADI22603.1| type II secretory pathway, component PulF [uncultured
           verrucomicrobium HF0500_16O23]
          Length = 417

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 67/187 (35%), Gaps = 12/187 (6%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVA-VIVGQSSDPVRSEFRRVIETQ 59
           ++   ++R    L D  N    +   ++AG+P++ A+  +    S    +S   +++   
Sbjct: 64  VRRFGRRRKKPKLQDLANFTRQLANLLKAGMPLTGALNSMTSLDSDGIPKSVCAQLLADV 123

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G +LS S+ +     P          +    +  G++ E L  L+        ++ K+
Sbjct: 124 REGRTLSVSMGKFPEIFPD-----MYLNMVKAGESSGSMVEVLKRLADHYERFAEVRQKI 178

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHML---LGVAAAFMLIGI 176
            +  +      +++G     +   + +  P +M +         L   +    +      
Sbjct: 179 ISALVYPV---FVMGLGFLLIFVFMSYILPKFMTIFKGMKVQLPLSTRILEGMSGFFENW 235

Query: 177 MVMRLMI 183
             + L+I
Sbjct: 236 WWLVLII 242


>gi|291537187|emb|CBL10299.1| hypothetical protein ROI_34750 [Roseburia intestinalis M50/1]
          Length = 245

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
                +R  K + +F +A+  +  ++ AG  +  A      +          +  E  ++
Sbjct: 54  NKKRDERAKKLMIEFRDAIQTVAAALLAGYSIEHAWKEAEREIMDLYGKEAMITKELIQM 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                L  ++ E +  +     ++E+  F+ +     + GG+  + +   +  +  +  +
Sbjct: 114 NAEIKLNRNVEEILHDLAVRSGVEEIQSFAEIFGFAKRSGGDFPQIIRTTAARISAKIEV 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + +V  +    K    I+  +PF +   +   S  +++ L  +  G +++  A    +  
Sbjct: 174 EREVDTVIAGKKLEGKIMSVMPFFILAYLNLASGEFIDPLYGNLAGVLVMSAALLVFVGA 233

Query: 176 IMVMRLMINFDV 187
           + + R + +  V
Sbjct: 234 MAINRRISDIRV 245


>gi|315656391|ref|ZP_07909280.1| type II secretion system protein [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|315492950|gb|EFU82552.1| type II secretion system protein [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 295

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 74/175 (42%), Gaps = 3/175 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
             +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + 
Sbjct: 116 KAWPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILK 175

Query: 74  RYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
             +           + + +Q  G +L   L +L  +LR  +  + +V A        A +
Sbjct: 176 HELADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARL 235

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             + P+ +  L+  + PG +  + + P G M+L V A    +  ++M  +   +V
Sbjct: 236 AAASPWIILALL-LSRPGTLE-MYSTPVGSMILLVGALVSALAYLMMLRLGRLEV 288


>gi|154482610|ref|ZP_02025058.1| hypothetical protein EUBVEN_00277 [Eubacterium ventriosum ATCC
           27560]
 gi|149736510|gb|EDM52396.1| hypothetical protein EUBVEN_00277 [Eubacterium ventriosum ATCC
           27560]
          Length = 238

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/187 (13%), Positives = 69/187 (36%), Gaps = 6/187 (3%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIETQH 60
           +  A+F   +   L  +   +  G  V + +     +          + SE R +     
Sbjct: 52  RAKAEFEHQYKEMLVALKDGIVTGYSVENGLKESYREMVNIYGYDGLICSELRLMTSRLK 111

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           L   +            L+    F    S+  + GGN++  +  +   +  ++++K ++ 
Sbjct: 112 LNTPIEIVFKDFAERTDLESAHMFYNTFSIAQKSGGNMNNVIKRVIENIVLKESVKEEIN 171

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
               + K    I+  +P  +   +   SPG+++++     G++++ V     L+  +   
Sbjct: 172 VAINDKKLEQRIMTVIPLLLIGYISMASPGFLDIMYKSIMGNIVMTVCLIVYLLAYLWSE 231

Query: 181 LMINFDV 187
            ++   +
Sbjct: 232 KIVKVSI 238


>gi|289706420|ref|ZP_06502778.1| type II secretion system F domain protein [Micrococcus luteus SK58]
 gi|289556915|gb|EFD50248.1| type II secretion system F domain protein [Micrococcus luteus SK58]
          Length = 285

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 69/183 (37%), Gaps = 3/183 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +    ++R+    + +P+A+D    ++RAGL + +A+  +     + +R  F+       
Sbjct: 94  LSWQARRRSTALRELWPDAIDHARSAIRAGLTLPEALIQLGETGPEGLREPFQHFARDYR 153

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKV 119
            G    +++ R+   M           + +  +  G ++   L  LS  LR    ++A++
Sbjct: 154 AGARFVDALDRLKARMADPVADRLVVSLRLTREVGGADIGRLLQTLSEFLRQDARIRAEL 213

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +A       +A +    P+ V  L+                G  +L       ++   VM
Sbjct: 214 EARQSWTVNAARLAVCAPWLVLLLLGT--QPAAVAAYRSAAGGAVLLAGMVASVVCYRVM 271

Query: 180 RLM 182
             +
Sbjct: 272 LRI 274


>gi|160900921|ref|YP_001566503.1| type II secretion system protein [Delftia acidovorans SPH-1]
 gi|160366505|gb|ABX38118.1| type II secretion system protein [Delftia acidovorans SPH-1]
          Length = 405

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 58/185 (31%), Gaps = 11/185 (5%)

Query: 1   MKHLIKKRT----AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRR 54
           +   IKKR      K    D       +   ++AG+P+  A  ++    ++  V      
Sbjct: 48  LPSKIKKRRTRGGKKIKPKDIALFTRQMATMMKAGVPLLQAFDIVGRGNTNPSVTRLLAD 107

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           +      G SL+ +  +                +    +  G L   L  L+  +   + 
Sbjct: 108 IRSDVETGTSLNAAYRKHPL-----YFDSLYCNLVEAGEAAGILEALLDRLATYMEKTEA 162

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +K+K+++  M   +   +   +   +   V        +    D     L  +  + + +
Sbjct: 163 IKSKIKSALMYPISVVVVAFIVVTIIMLFVIPAFKDVFSSFGADLPAPTLFVMGVSDIFV 222

Query: 175 GIMVM 179
               +
Sbjct: 223 QWWWV 227



 Score = 35.9 bits (81), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/131 (9%), Positives = 41/131 (31%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G   +    +   ++ +    G SL+ +++       
Sbjct: 275 WTRTLSTMFAAGVPLVEALDSVGGASGNAIYANATEKIQQEVSTGTSLTVAMTNA----- 329

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G++   L   +    +  +      +  ME     ++   + 
Sbjct: 330 -NVFPSMVLQMCAIGEESGSIDHMLGKAADFYEEEVDDMVAGLSSLMEPIIIVFLGTLIG 388

Query: 138 FCVSTLVYFTS 148
             V ++     
Sbjct: 389 GIVVSMYLPIF 399


>gi|225872758|ref|YP_002754215.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225793390|gb|ACO33480.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 299

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 67/157 (42%), Gaps = 5/157 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  +K R  +     P+A+D++V  V AGL +  A+  +  +   S   +  EF ++  
Sbjct: 136 LERKVKGRRHRISRSMPDAIDLLVICVDAGLGLDQAMLRVGQELAVSHPEINEEFLQINR 195

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
            Q  G    ++         L E+  F +++    + G  ++ AL   S  +R ++   A
Sbjct: 196 EQRAGRPRVDAWKGFAERTRLPEIQNFVSMLVQTERFGTPITRALNTFSDSMRLKRKQIA 255

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           + +A     K    ++  +  C+  ++    P ++ +
Sbjct: 256 EEKAAKTTVKMLFPLVLFIFPCIFIVL--LGPAFITI 290


>gi|254486075|ref|ZP_05099280.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
 gi|214042944|gb|EEB83582.1| type II/IV secretion system protein, TadC subfamily [Roseobacter
           sp. GAI101]
          Length = 308

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 67/149 (44%), Gaps = 3/149 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +   ++KR  +    FP+ALD+++  V AG  +  ++  +  +   S   +  EF  V  
Sbjct: 149 VTKRVEKRKEEITRGFPDALDMMLVCVEAGQSLDQSIVRVAKELHASYPALAEEFEVVAY 208

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      ++ M     +Q+VS F TV+   +  G ++S+AL   +  +RD++ M+A
Sbjct: 209 EMKAGKDKVGVLTDMGDRCGVQDVSSFVTVLCQSAAFGTSISDALRVYAEEMRDKRVMRA 268

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYF 146
           +  A  +  K +   +      +  ++  
Sbjct: 269 EEAANKLPTKMTLATMMLTVPPLLIILVA 297


>gi|220913386|ref|YP_002488695.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
 gi|219860264|gb|ACL40606.1| type II secretion system protein [Arthrobacter chlorophenolicus A6]
          Length = 291

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 63/156 (40%), Gaps = 1/156 (0%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++  +KR      + PNALD ++ SV+AGL    A+         P+  E  R ++   
Sbjct: 135 LRNRAQKRREAIRLELPNALDQMLISVQAGLGFETAMGRAGENGRGPLAEELIRTLQDIQ 194

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G S  E+   +   + +  V  F   +      G  ++  L   ++ +R ++   A+  
Sbjct: 195 VGRSRKEAYLALSERVDVPSVRTFVRAVVQADAYGIAIANVLKTQAKDMRIKRRQLAEEH 254

Query: 121 ALSMEAKA-SAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           A+ M  K     I   LP     L+       M+V 
Sbjct: 255 AMKMPVKMLFPLIFFILPTLFIVLLGPAVLQIMSVF 290


>gi|85373127|ref|YP_457189.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
 gi|84786210|gb|ABC62392.1| hypothetical protein ELI_01500 [Erythrobacter litoralis HTCC2594]
          Length = 331

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 60/148 (40%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           +K+   KRT       P+ALD++V    AGL V  A   +  +   +   +  EF     
Sbjct: 171 LKNKAAKRTDAIRKGLPDALDLLVICAEAGLTVDAAFNRVAKELGRAYPELGDEFALTAI 230

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +   + L+ V    T +    + G  L+ AL  LS   R+ + M+A
Sbjct: 231 ELSFLTERKQAFDNLAYRVDLEAVKGVVTTMVQTERYGTPLASALRVLSAEFRNERMMRA 290

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 291 EEKAARLPAIMTVPLILFILPVLFIVIL 318


>gi|124265701|ref|YP_001019705.1| pilus tip-associated protein [Methylibium petroleiphilum PM1]
 gi|124258476|gb|ABM93470.1| Pilus tip-associated protein [Methylibium petroleiphilum PM1]
          Length = 408

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 54/184 (29%), Gaps = 10/184 (5%)

Query: 1   MKHLIKKRT---AKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRV 55
           +  + K+R          D       I   +RAG+P+  +  ++    ++  V      +
Sbjct: 52  VNKVKKRRMSGGKSIKPKDIAIFTRQIATMMRAGVPLLQSFDIVARGSTNPRVTKLLTDI 111

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G SLS +  +                +    +  G L   L  L+        +
Sbjct: 112 RSDIETGTSLSSAFRKHPL-----YFDALYCNLVEAGEAAGILETLLERLATYQEKTLEI 166

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           K K+++  +   A   +   +   +   V             D     L  ++ + + + 
Sbjct: 167 KRKIKSALIYPVAVLVVAFVVVAVIMIFVIPAFKEVFTSFGADLPAPTLFVMSMSEIFVS 226

Query: 176 IMVM 179
              +
Sbjct: 227 YWWL 230



 Score = 37.8 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 41/137 (29%), Gaps = 5/137 (3%)

Query: 12  FLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISR 71
           F          +     AG+P+ +A+  + G S + V +E      T+ +   +S   + 
Sbjct: 271 FKSAVARWTRTLATMFAAGVPLVEALDSVGGASGNAVFAE-----ATEQIQKDVSTGTAL 325

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                           ++   +  G L   L+  +       +   K  +  +E      
Sbjct: 326 TTSMQATGIFPVMVLQMAAIGEESGALDHMLSKAAEFYEAEVDEAVKGLSSLLEPIIIVV 385

Query: 132 IIGSLPFCVSTLVYFTS 148
           +   +   V ++     
Sbjct: 386 LGTIIGGIVVSMYLPIF 402


>gi|254473723|ref|ZP_05087118.1| type II secretion system protein [Pseudovibrio sp. JE062]
 gi|211957109|gb|EEA92314.1| type II secretion system protein [Pseudovibrio sp. JE062]
          Length = 324

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           +++ + KR       +P+A+D+++  V +G+ +  A   +  +       +  E      
Sbjct: 166 VQNKVMKRQESIRLAWPDAMDLMLICVESGMSIEAAFKKVAEEVGPQSTALAEELILANA 225

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +     L  V      +S   + G  +  AL  LS   R  +  +A
Sbjct: 226 ELSYLDERRKAYQNLAERTGLDGVKNVVVALSQAEKYGTPIGYALRVLSEESRQERMQEA 285

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYF 146
           + +A ++  K +  ++      +  ++  
Sbjct: 286 ERKAAALPPKLTVPMMLFFLPVLFIVLIA 314


>gi|261379321|ref|ZP_05983894.1| 3-isopropylmalate dehydrogenase [Neisseria subflava NJ9703]
 gi|284797758|gb|EFC53105.1| 3-isopropylmalate dehydrogenase [Neisseria subflava NJ9703]
          Length = 413

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 63/187 (33%), Gaps = 7/187 (3%)

Query: 1   MKHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIET 58
           +  +   R  +   +D       +   ++AGLP+  A  ++    S+  +     +V   
Sbjct: 59  ISKVKTARKRRITQEDITVFTRQLATMMKAGLPLMQAFEIVARGHSNPSMTEMLMQVRSD 118

Query: 59  QHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAK 118
              G +L +S S+  +         F   +    + GG L   L  L+      + +K K
Sbjct: 119 VEQGSALGKSFSKYPK-----YFDRFYCNLVSAGESGGVLESLLDKLAVYKEKTQAIKKK 173

Query: 119 VQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           V+       A   +  +L F +   V          +  +      L +  + + +    
Sbjct: 174 VKTALTYPIAIIVVAIALIFIMMMFVLPAFKEVYANMGAELPSLTQLVMNLSDLFVDYGW 233

Query: 179 MRLMINF 185
           + +++  
Sbjct: 234 IMIILLI 240


>gi|253998298|ref|YP_003050361.1| type II secretion system protein [Methylovorus sp. SIP3-4]
 gi|313200371|ref|YP_004039029.1| type II secretion system protein [Methylovorus sp. MP688]
 gi|253984977|gb|ACT49834.1| type II secretion system protein [Methylovorus sp. SIP3-4]
 gi|312439687|gb|ADQ83793.1| type II secretion system protein [Methylovorus sp. MP688]
          Length = 403

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 50/167 (29%), Gaps = 6/167 (3%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISR 71
             D       +   ++AG+P+  A  ++    ++  V      +      G SLS++  +
Sbjct: 63  EKDVTLFTRQLATMMKAGVPLLQAFEIVGKGHNNPAVSKLLGDIKSDVETGSSLSQAFRK 122

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
                           +    +  G L   L  L+        +K+K+++      +   
Sbjct: 123 YPL-----YFDALYCNLVGAGEQAGILDSLLDRLATYKEKILAIKSKIKSALFYPVSIIV 177

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +   +   +   V        +    D     L+ +A +   +    
Sbjct: 178 VAFIITAVIMIFVIPAFKELFSSFGADLPAPTLIVMAISDFFVEYWW 224



 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/142 (13%), Positives = 45/142 (31%), Gaps = 11/142 (7%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSE-FRRVIETQHLGLSLS 66
           R A            +     AG+P+ +A+  + G S + V  E  +++      G SL+
Sbjct: 266 RKATIAR----FARTLSTMFAAGVPLVEALDSVAGASGNRVYYEATKQIQSEISTGTSLT 321

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  +      +        +    +  G L   L+ ++       +   +  +  ME 
Sbjct: 322 VAMQNV------EVFPNMVLQMVAIGEESGALDSMLSKVADFYEAEVDDAVEALSSLMEP 375

Query: 127 KASAWIIGSLPFCVSTLVYFTS 148
                +   +   V  +     
Sbjct: 376 IIMVVLGTLIGGLVIAMYLPIF 397


>gi|167840869|ref|ZP_02467553.1| hypothetical protein Bpse38_29619 [Burkholderia thailandensis
           MSMB43]
          Length = 279

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 73/157 (46%), Gaps = 5/157 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   I+ R  K ++DFP+ALD++   V AGL +  A+  +  +    S  V  E   ++ 
Sbjct: 114 LSRHIRLRQRKIIEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPIVADELGLMLL 173

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +      ++V  F  ++    + G ++  +L  LS  LR ++ M+A
Sbjct: 174 EIRSGFAKDAALRNLALRTGAEDVDAFCAMLIQADRFGTSIGASLRVLSDTLRTQRRMRA 233

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNV 154
           + +A  +  K    +I  +   + T++    P ++++
Sbjct: 234 EERAAKIALKLLFPLIFCIFPALLTVL--LGPAFIHI 268


>gi|320008843|gb|ADW03693.1| Type II secretion system F domain protein [Streptomyces
           flavogriseus ATCC 33331]
          Length = 295

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 28/141 (19%), Positives = 58/141 (41%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            ++KR        P+ LD++   V AGL    A+  +  +   P   E R  +    +G+
Sbjct: 137 AVRKRRDDIDRTLPDFLDVLAVVVSAGLGFRQALDRVAEKYQGPWSDELRITLRQMDMGV 196

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S  ++   + R    ++V+ F T +    +LG  + + L  ++  +R      A+ +A  
Sbjct: 197 SRRQAFDELRRRNDSEQVAMFVTALQQGEELGAPIVDTLIAIANDMRRTDAQNARRKAAK 256

Query: 124 MEAKASAWIIGSLPFCVSTLV 144
              KA+  +   +      L+
Sbjct: 257 AVPKATLMVTTFMIPATMILM 277


>gi|111220777|ref|YP_711571.1| hypothetical protein FRAAL1320 [Frankia alni ACN14a]
 gi|111148309|emb|CAJ59981.1| conserved hypothetical protein; putative membrane protein [Frankia
           alni ACN14a]
          Length = 357

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 70/184 (38%), Gaps = 3/184 (1%)

Query: 3   HLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLG 62
                R     + +P+ +D +  +VRAG+ + + +A +  +    +R  F R  E     
Sbjct: 96  RRRHGRIHDLRELWPDVVDNLASAVRAGMSLPEGLAAVGVRGPVQLRPAFTRFGEDYSAT 155

Query: 63  LSLSESISRMVRYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQA 121
            S S  + R+   +           + +  +  G +L   L  LS  LR+    +A+++ 
Sbjct: 156 GSFSTCLDRLADELADPVADRIIESLRMAREVGGTDLGRLLRTLSTFLREDARTRAELET 215

Query: 122 LSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRL 181
                  +A +  + P+ V  L+            + P G ++L V      +  ++M+ 
Sbjct: 216 RQGWTVNAARLALAAPWIVLLLLATRGQNVQA--YDSPTGVLVLVVGGGVSALAYLLMKR 273

Query: 182 MINF 185
           +   
Sbjct: 274 IGRL 277


>gi|218887822|ref|YP_002437143.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758776|gb|ACL09675.1| type II secretion system protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 326

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 69/158 (43%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   IK R    ++  P+ALD++V  V AG+ +  A + +  +    +  +  E   VI 
Sbjct: 163 LSRRIKARRLDIINSLPDALDLLVVCVEAGMGLDQAFSRVAREMAATNPVLAEELNLVIL 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G S +E++  +   + L++V+   T+I      G ++S  L   S  +R  +  +A
Sbjct: 223 ELRAGKSRAEALKNLAARVALEDVNSLVTLIVQADAFGTSISSTLRVYSDTMRTTRFQRA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           +  A  M  K    ++  +   +   V    P ++ ++
Sbjct: 283 EEIAAKMPVKLLFPLVFCILPALF--VTIMGPAFIKLM 318


>gi|291540421|emb|CBL13532.1| hypothetical protein RO1_32050 [Roseburia intestinalis XB6B4]
          Length = 245

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
                +R  K + +F +A+  +  ++ AG  +  A      +          +  E  ++
Sbjct: 54  NKKRDERAKKLMIEFRDAIQAVAAALLAGYSIEHAWKEAEREIMDLYGKEAMITKELIQM 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                L  ++ E +  +     ++E+  F+ +     + GG+  + +   +  +  +  +
Sbjct: 114 NAEIKLNRNVEEILHDLAVRSGVEEIQSFAEIFGFAKRSGGDFPQIIRTTAARISAKIEV 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + +V  +    K    I+  +PF +   +   S  +++ L  +  G +++  A    +  
Sbjct: 174 EREVDTVIAGKKLEGKIMSVMPFFILAYLNLASGEFIDPLYGNLAGVLVMSAALLVFVGA 233

Query: 176 IMVMRLMINFDV 187
           + + R + +  V
Sbjct: 234 MAINRRISDIRV 245


>gi|86159245|ref|YP_466030.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775756|gb|ABC82593.1| type II secretion system protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 306

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 66/165 (40%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           ++  ++ R  +     P+ALD++V  V AGL +  A+  +  +   +   +  E R V  
Sbjct: 140 LRARVQARQTQLDRSLPDALDLLVTCVEAGLGLDSALQRVSDEVALAHPLLSKELRLVFL 199

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G++   +  RM       E+   S  ++     G ++  AL   +  +R R+  +A
Sbjct: 200 EVKAGIARISAFRRMAERTGAPELRSLSATLAQTELFGTSVGAALRIQAEGIRIRRMHRA 259

Query: 118 KVQALSMEAKAS-AWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +  K S   ++  LP   + ++          L     G
Sbjct: 260 EEKAAYVSVKMSLPLVLCILPCVFAVVLGPAVVNMAERLFPLLGG 304


>gi|255658710|ref|ZP_05404119.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
 gi|260849099|gb|EEX69106.1| putative type II secretion system protein [Mitsuokella multacida
           DSM 20544]
          Length = 307

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 66/146 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I++R  +     P  LD++  SV+AGL    A++ I  +   P   E RR+ +   
Sbjct: 152 LNTTIQRRQKQIEHQLPEVLDLLCVSVQAGLSFDAALSKITARMKGPFIDECRRMQDDIR 211

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G+    ++  M     L++VS F T I    +LG ++ + L N +  +R+R+    K Q
Sbjct: 212 MGVVRRTAMRSMADRCGLEDVSLFMTSIIQAERLGTSMGKTLKNQADNIRERRRQYVKAQ 271

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYF 146
           A+    K    ++  +   +  +   
Sbjct: 272 AMKAPVKIVFPLVLFIFPAIFVVTLV 297


>gi|222084474|ref|YP_002543003.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721922|gb|ACM25078.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 325

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 63/158 (39%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           + + + KR       +P+ALD+++  V +G+ +   +  +  +    S  +  E      
Sbjct: 167 ISNRVTKRQKSIKRAWPDALDLMLICVESGISIEAGMRRVSEEMAEQSPALAEEMVLTTA 226

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +     ++ V   +  +    + G  +S+AL  +++  RD +  +A
Sbjct: 227 ELSFLQDRRTAFDNLAARTQIEIVKSVTQALIQAERYGTPVSQALRVMAQEGRDERMNEA 286

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A ++  K +  +I      +  ++    P  + V+
Sbjct: 287 EKKAAALPPKLTVPMIVFFLPVLMAVI--LGPAIIQVM 322


>gi|296134880|ref|YP_003642122.1| Type II secretion system F domain protein [Thiomonas intermedia
           K12]
 gi|295795002|gb|ADG29792.1| Type II secretion system F domain protein [Thiomonas intermedia
           K12]
          Length = 406

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 54/184 (29%), Gaps = 10/184 (5%)

Query: 1   MKHLIKKR----TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRRV 55
           +  + K+R     A    D       +   ++AG+P+  +  ++        +      +
Sbjct: 49  VTKVKKRRLTSGKAIKAKDISTFTRQMSTMIKAGVPLLQSFDIVGRGHPNPNMARLIMDI 108

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                 G SLS +  +  +             +    +  G L   L  L+        +
Sbjct: 109 RGDVETGTSLSNAFRKHPK-----YFDALYCNLVEAGETAGMLELVLDRLATYQEKSLAI 163

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           ++K+++      A   +   +   +   V        +          L+ VA +   + 
Sbjct: 164 RSKIKSALTYPIAVMVVAFVVVSIIMLFVVPVFTDVFSQFGASLPAPTLMVVAMSNFFVH 223

Query: 176 IMVM 179
              +
Sbjct: 224 YWYI 227



 Score = 38.9 bits (89), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/135 (13%), Positives = 45/135 (33%), Gaps = 7/135 (5%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVR-SEFRRVIETQHLGLSLSESISRMV 73
                   +     AG+P+ +A+  + G + + V      ++ +    G SL+ S+    
Sbjct: 271 ALARWTRTLATMFGAGVPLVEALDAVGGAAGNIVYLRATEKIQQDVSTGTSLTTSMQTQG 330

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
            + P          ++   +  G+L   L+  + I     +   K  +  +E     ++ 
Sbjct: 331 VFPP------LVIQLTSIGEESGSLDSMLSKAADIYEAEVDELVKNLSALLEPIIIVFLG 384

Query: 134 GSLPFCVSTLVYFTS 148
             +   V  +     
Sbjct: 385 VIIGGLVVAMYLPIF 399


>gi|302877538|ref|YP_003846102.1| Type II secretion system F domain [Gallionella capsiferriformans
           ES-2]
 gi|302580327|gb|ADL54338.1| Type II secretion system F domain [Gallionella capsiferriformans
           ES-2]
          Length = 403

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 50/179 (27%), Gaps = 6/179 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQ 59
           +K       A    D       +   ++AG+P+  A  ++     +  V      +    
Sbjct: 51  IKRARSSAKAITQKDITLFTRQLATMLKAGVPLLQAFDIVGKGHHNPSVSRLLFSIKTDI 110

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G SL ++  +                +    +  G L   L  L+        +K+K+
Sbjct: 111 ETGSSLQQAFKKHPL-----YFDDLYCNLIGAGESAGILDSLLERLATYQEKILAIKSKI 165

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           ++      +   +   +   +   V        +    D     L  +A +   +    
Sbjct: 166 KSALFYPVSIIVVAFIITAVIMIFVIPAFKELFSSFGADLPAPTLFIMAISDFFVSYWW 224



 Score = 40.9 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 40/129 (31%), Gaps = 7/129 (5%)

Query: 21  DIIVRSVRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLSESISRMVRYMPLQ 79
             +     AG+P+ +A   + G + + V     + +      G SL+ ++         +
Sbjct: 275 RTLSTMFAAGVPLVEAFNSVAGAAGNAVYFDATKSIQREVSTGNSLTVAMQN------TE 328

Query: 80  EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFC 139
                   +    +  G+L   L+ ++       +   +  +  ME      +   +   
Sbjct: 329 VFPSMVIQMVSIGEEAGSLDAMLSKVADFYEAEVDDAVEALSSLMEPIIMVVLGTLIGGM 388

Query: 140 VSTLVYFTS 148
           V  +     
Sbjct: 389 VVAMYLPIF 397


>gi|15679697|ref|NP_276815.1| hypothetical protein MTH1703 [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622834|gb|AAB86175.1| unknown [Methanothermobacter thermautotrophicus str. Delta H]
          Length = 359

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 74/178 (41%), Gaps = 2/178 (1%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLS 66
           KR+++   + P AL  +   +++GL + D++  +       +  EF R +E    G +  
Sbjct: 178 KRSSEASRELPFALRQMATELKSGLGLHDSMRSVAMSGYGALSEEFARTLEEIKYGETTE 237

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++  M   +    +      I+     GG+LS+ L  ++  +     MK K  +  + +
Sbjct: 238 NALIEMSNRIESDGLKRAVYQITRTLNSGGDLSKTLNVIADDIAYEMRMKLKDYSQKLNS 297

Query: 127 KASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI--MVMRLM 182
               ++  ++   V  LV   +   +   +  P   +++ +    ML+G    +++ +
Sbjct: 298 FTMIYMFLAILGPVIFLVMLLAAATVMGSVLPPIAIIMIYLFLFPMLVGFMAFMIKRL 355


>gi|307332439|ref|ZP_07611503.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306881908|gb|EFN13030.1| Type II secretion system F domain protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 295

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 57/143 (39%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGL 63
            +++R        P+ LD++   V AGL    A+  +  +   P   E R  +    +G+
Sbjct: 137 AVRERKDAIERTLPDFLDVLAVVVSAGLSFRQALDRVAEKYEGPWADELRITLRQMDMGV 196

Query: 64  SLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
           S   +   + +    ++V+ F T +    +LG  + E L  ++  +R      A+ +A  
Sbjct: 197 SRRHAFEELRKRNDSEQVAQFVTALQQGEELGAPIVETLIAIANDMRRTDAQNARRRAAR 256

Query: 124 MEAKASAWIIGSLPFCVSTLVYF 146
              KA+  I   +      L+  
Sbjct: 257 AVPKATMVITTFMVPGTMVLLVA 279


>gi|238917898|ref|YP_002931415.1| hypothetical protein EUBELI_01985 [Eubacterium eligens ATCC 27750]
 gi|238873258|gb|ACR72968.1| Hypothetical protein EUBELI_01985 [Eubacterium eligens ATCC 27750]
          Length = 235

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 22/193 (11%), Positives = 84/193 (43%), Gaps = 7/193 (3%)

Query: 2   KHLIKKRTAKF-LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ------SSDPVRSEFRR 54
           + + + +  +     F + +  +  ++  G  + +A +  + +      S   +  +F+ 
Sbjct: 43  RRIAEAKKKRILTKQFKDGIMAVSFALNVGYSIENAFSQAIDELILLYGSEADIVMKFKN 102

Query: 55  VIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN 114
           ++   +   +L + ++   +   ++++ +F+ V     + GG+L   + N + I++ +  
Sbjct: 103 IVVRINQNENLEDILNDFAKECKIEDIMYFAEVFRYAKRSGGDLISIIRNTADIIQQKTE 162

Query: 115 MKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174
           +  +V+ +    +    ++ ++P  +   +  T+  ++  L  +  G +++       LI
Sbjct: 163 VATEVETIVSGKRMEQKVMSAIPALIILYLKVTAREFVEPLYGNLSGVLIMTCCLGVYLI 222

Query: 175 GIMVMRLMINFDV 187
             +  + ++N +V
Sbjct: 223 SNVWSKRIVNIEV 235


>gi|284031222|ref|YP_003381153.1| type II secretion system protein [Kribbella flavida DSM 17836]
 gi|283810515|gb|ADB32354.1| type II secretion system protein [Kribbella flavida DSM 17836]
          Length = 301

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 71/183 (38%), Gaps = 2/183 (1%)

Query: 6   KKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSL 65
           ++R  + LD      + +  ++   + +  A+      ++  ++     +++   +   L
Sbjct: 94  ERRAIERLDALATWTEALRDTIAGAVGLEQAIPATAVNAAPAIKPGLNLLVDRLRIREPL 153

Query: 66  SESISRMVRYMPLQEVSFFSTVISVQ-SQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
             ++ R    +           + +     G  L E L+ L+   R+  +++ KV A   
Sbjct: 154 PSALMRFADDLDDPSADLIVAALVLNARLRGPGLREVLSALADSAREELDVRRKVAAERR 213

Query: 125 EAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
             + S  ++ ++   V+  +   +P Y+        G  +L +  A   +G++ +R +  
Sbjct: 214 STRRSVQVVVAITLLVAAALVLFNPAYVEP-YTSFVGQFVLFLVIALYAVGLVWLRKLAK 272

Query: 185 FDV 187
            +V
Sbjct: 273 IEV 275


>gi|89095464|ref|ZP_01168374.1| type II secretion system protein [Oceanospirillum sp. MED92]
 gi|89080267|gb|EAR59529.1| type II secretion system protein [Oceanospirillum sp. MED92]
          Length = 406

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 18/170 (10%), Positives = 52/170 (30%), Gaps = 6/170 (3%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-VRSEFRRVIETQHLGLSLSESISRMV 73
           D       +   +++G+P+   + +  G      ++     +    + G+ LS ++++  
Sbjct: 68  DIAFFTRQMATMLKSGVPLLQGLEITAGGVDKQKLKDIIYEIKNDVNGGIDLSNALAKHP 127

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWII 133
            +            +    +  G L   L  ++      +++KAK++       A   + 
Sbjct: 128 DH-----FDDLYCNLVSAGEQSGALETMLDRIATYKEKLESLKAKIKKALTYPTAVVIVG 182

Query: 134 GSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
             +   +   V             D     L  +  +        + L+ 
Sbjct: 183 IVVSAILLVKVVPQFESVFQNFGADLPAFTLFVIGLSETAQKWWWIALIA 232



 Score = 34.7 bits (78), Expect = 6.1,   Method: Composition-based stats.
 Identities = 13/136 (9%), Positives = 36/136 (26%), Gaps = 5/136 (3%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRM 72
                     +  +  AG+P+ +A+    G S + +            +   +S   S  
Sbjct: 270 NASIARFARTLATTFAAGVPLVNALESAAGASGNALYR-----DAIIQIKNGVSTGQSLK 324

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
                       +  +    +  G+L   L  ++    +  +      +  +E      +
Sbjct: 325 DAVTMTGIFPNMTVQMIAIGEEAGSLEMMLEKVADFYEELVDNAVDNLSSLLEPLIMVVL 384

Query: 133 IGSLPFCVSTLVYFTS 148
              +   V  +     
Sbjct: 385 GVLVGGLVIAMYLPIF 400


>gi|326388860|ref|ZP_08210442.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206460|gb|EGD57295.1| type II secretion system protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 339

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 61/148 (41%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + +LI KRT       P+ALD++V    AGL +  A + +  +   +   +  EF     
Sbjct: 176 VANLIGKRTNAIRKGLPDALDLLVICAEAGLTIDAAFSRVARELGRAYPELGDEFSLTAI 235

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +   + L+ +    T +    + G  L+ AL  LS   R+ + M+A
Sbjct: 236 ELSFLTERRSAFENLAYRVNLESMRGVVTTMIQTERYGTPLASALRVLSAEFRNERMMRA 295

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 296 EEKAARLPAIMTIPLILFILPTLFVVIL 323


>gi|309778766|ref|ZP_07673539.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308922474|gb|EFP68098.1| type II secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 308

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 84/184 (45%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           + +  +K   + L   P  LD +VR +  G  V  A       +  P+R+    + + Q 
Sbjct: 123 IWNRTRKINERLLAQLPGFLDGVVRLMSIGSAVPAAFQAASANTEQPLRNCLTAITQMQR 182

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
            G  L  ++  + +   + E+   S+V+ +  + GG     +   +  +RDR+  + ++ 
Sbjct: 183 AGKDLDAAVLTVGQQYRVNELVLLSSVLRLALRYGGRADIVMERTAAFMRDRQQAQRELF 242

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           ALS E + SAWIIG LP  V  ++   +  Y+  +  DP G  L+  A    ++G +++ 
Sbjct: 243 ALSAETRLSAWIIGLLPVVVGGVIIMFNAAYIMSMWRDPFGKTLILTAFGMEVLGAVMLA 302

Query: 181 LMIN 184
            +  
Sbjct: 303 RLAK 306


>gi|73542645|ref|YP_297165.1| type II secretion system protein [Ralstonia eutropha JMP134]
 gi|72120058|gb|AAZ62321.1| type II secretion system protein [Ralstonia eutropha JMP134]
          Length = 424

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 56/168 (33%), Gaps = 6/168 (3%)

Query: 13  LDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISR 71
             D       +   ++AG+P+  ++ +I    ++         +      G S++ +  R
Sbjct: 84  EKDIAYFTRQLSTMLKAGIPLLQSIDIIARGHANPNFTQLLSDIRFDIESGSSMAAAFRR 143

Query: 72  MVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAW 131
             R             +    + GG L   L  LS  +     +K+++++  +   A   
Sbjct: 144 HPR-----YFDTLYCNLIDAGEQGGILDSLLERLSLYMEKTIALKSQIKSAMIYPIAVLT 198

Query: 132 IIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           +  ++   +   V     G  +    +     L+ +A +   +    +
Sbjct: 199 VAFAVTVILMLFVIPAFKGVFSSFGANLPAPTLVVIAISDFFVAYWYI 246


>gi|13474665|ref|NP_106234.1| hypothetical protein mlr5604 [Mesorhizobium loti MAFF303099]
 gi|14025420|dbj|BAB52020.1| mlr5604 [Mesorhizobium loti MAFF303099]
          Length = 339

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 58/148 (39%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           + +   KR       +P+ALD+++  V +G+ V  A+  +  +       +  EF     
Sbjct: 169 VNNRATKRKQSIQMAWPDALDLMLICVESGMSVEAALRKVADEIGAQSVALAEEFILTNA 228

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                    ++   +     L+ V   S  +    + G  ++ AL  L+   RD++   A
Sbjct: 229 ELSYLQERKQAYENLANRTGLESVKSVSQALVQAERYGTPVAHALRVLAAESRDQRMNAA 288

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +  +I      +  ++ 
Sbjct: 289 EKKAAALPPKLTVPMILFFLPVLFAIIL 316


>gi|300690359|ref|YP_003751354.1| type IV pilus assembly transmembrane protein [Ralstonia
           solanacearum PSI07]
 gi|299077419|emb|CBJ50045.1| type IV pilus assembly transmembrane protein [Ralstonia
           solanacearum PSI07]
          Length = 421

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/180 (12%), Positives = 56/180 (31%), Gaps = 7/180 (3%)

Query: 2   KHLIKKRTAKFL-DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQ 59
           K     R  K    D       +   ++AG+P+  +V +I    ++         +    
Sbjct: 69  KRRRAARGKKITPKDIAYFTRQLSTMLKAGVPLLQSVDIIARGHANPNFTQLLTEIRVDI 128

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G S++++  R  +             +    + GG L   L  LS  +     +KA++
Sbjct: 129 ESGSSMAQAFRRHPK-----YFDSLYCNLIDAGEQGGILDALLERLSLYMEKSIALKAQI 183

Query: 120 QALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVM 179
           ++  +   +   +   +   +   V     G             L+ +  +   +    +
Sbjct: 184 KSAMIYPISVLTVAFLVTVVLMIFVVPAFKGVFASFGATLPAPTLVVMGISDFFVQWWYI 243


>gi|254504440|ref|ZP_05116591.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
 gi|222440511|gb|EEE47190.1| Bacterial type II secretion system protein F domain [Labrenzia
           alexandrii DFL-11]
          Length = 324

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 55/159 (34%), Gaps = 4/159 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP---VRSEFRRVIE 57
           +K+ I KR       +P+ALD+++  V +G+ +  A   +  +       +  E      
Sbjct: 166 LKNQIDKRKLGIQRAWPDALDLMLICVESGMSIEAAFQKVAEEIGAQSVELAEELSLTTA 225

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   + +   +  V      +    + G  +  A+ N++   R  +   A
Sbjct: 226 ELSYLSERRMAYENLAKRTGVDGVKNVMMALIQAERYGTPVGTAIRNMADDTRAERMQFA 285

Query: 118 KVQALSMEAK-ASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A S+  K     I+  LP     ++       M   
Sbjct: 286 EQKAASLPPKLTVPMIMFFLPVLFFVILTPAVIQAMGAF 324


>gi|82703469|ref|YP_413035.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
 gi|82411534|gb|ABB75643.1| type II secretion system protein [Nitrosospira multiformis ATCC
           25196]
          Length = 313

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 68/166 (40%), Gaps = 4/166 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +  L+ +R  +  + FP+A+D++   V AGL +  A+  +  +    S  + SE   V  
Sbjct: 148 LGRLVLQRKRELFESFPDAIDLMTVCVEAGLGLDAAMVRVAEEMRLRSKALASELHLVSL 207

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +  +++  +     ++E+    +++    + G +++ +L   S  LR  + ++A
Sbjct: 208 ELRAGRTREQALRNLAMRTGVEEIEALVSMLVQADRFGTSVAASLRVHSDTLRTTRRLRA 267

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGH 162
           +  A  +        I    P  +  L+         VL+    G 
Sbjct: 268 EEAAAKIALKLLFPLIFFIFPSLLLVLMGPAFINIYRVLLPTLGGQ 313


>gi|88801096|ref|ZP_01116643.1| Type II secretory pathway, component PulF [Reinekea sp. MED297]
 gi|88776175|gb|EAR07403.1| Type II secretory pathway, component PulF [Reinekea sp. MED297]
          Length = 407

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/197 (11%), Positives = 62/197 (31%), Gaps = 14/197 (7%)

Query: 1   MKHLIKKR--------TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF 52
           +K L KKR             +D       +   ++AG+P+  +  ++     +P  +E 
Sbjct: 47  VKKLQKKRADINLFGGKKVKTEDIAVFTRQMATMMKAGVPLMRSFEIVAEGLDNPKMAEL 106

Query: 53  RRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDR 112
              ++    G                +        +    +  G L   L  ++      
Sbjct: 107 VTSMKNNVAGGG----SFGSALRQHPKYFDDLYCSLIESGEQAGALETMLDRVAIYKEKS 162

Query: 113 KNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDP--RGHMLLGVAAA 170
           + +K KV++          +   +   +   V  T     +    D      +++ ++++
Sbjct: 163 EAVKKKVKSAMKYPATVLVVAAIVTIILLLKVVPTFAEMFSNFGADLPVPTQIVMNMSSS 222

Query: 171 FMLIGIMVMRLMINFDV 187
               GI+   +++   +
Sbjct: 223 LQENGIIWGSIILAIAI 239



 Score = 37.8 bits (86), Expect = 0.75,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 40/128 (31%), Gaps = 5/128 (3%)

Query: 21  DIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQE 80
             +  +  AG+P+  A+    G +S  +  E   +     +      + S        + 
Sbjct: 279 RTLSTTFAAGVPLVQALESAAG-ASGNIVYESAIMQVRNEVETGSELATS----MKDTEV 333

Query: 81  VSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCV 140
                  +    +  G L + L   + I  +  + + +     ME    A++   +   V
Sbjct: 334 FPSMLVQMVSIGEQSGALDDMLGKAAIIYEEEVDNQVEGLTAMMEPMIMAFLGVVVGGLV 393

Query: 141 STLVYFTS 148
            ++     
Sbjct: 394 VSMYLPIF 401


>gi|74318387|ref|YP_316127.1| type IV pilus assembly protein PilC [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057882|gb|AAZ98322.1| type IV pilus assembly protein PilC [Thiobacillus denitrificans
           ATCC 25259]
          Length = 407

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/171 (12%), Positives = 52/171 (30%), Gaps = 6/171 (3%)

Query: 9   TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSE 67
                 D       +   ++AG+P+  +  ++    S+  ++     +      G SL++
Sbjct: 62  KRITEKDVALFTRQLATMMKAGVPLLQSFEIVARGHSNPSMQRLLMEIKADIEKGSSLTQ 121

Query: 68  SISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAK 127
           S +R                +    +  G L   L  L+        +K K+++      
Sbjct: 122 SFARHPL-----YFDALFCNLVGAGEAAGILEAVLDRLAVYKEKILAIKGKIKSALFYPV 176

Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
           +   +   +   +   V        +    D  G  L+ +A +   +    
Sbjct: 177 SIIVVAFVITAIIMIFVIPAFKELFSSFGTDLPGPTLVVMAISDFFVTWWW 227



 Score = 39.3 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 43/131 (32%), Gaps = 7/131 (5%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSE-FRRVIETQHLGLSLSESISRMVRYMP 77
               +     AG+P+ +A+  + G S + V  E  +++      G +L+ ++    R   
Sbjct: 276 WTRTLSTMFAAGVPLVEALESVAGASGNQVFVEATQKIRGEVATGTALTVAMQNSGR--- 332

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     ++   +  G+L   L  ++       +   +  +  ME      +   + 
Sbjct: 333 ---FPNMVLQMAAIGEESGSLDAMLGKVADFYESEVDDAVEALSSLMEPLIMVVLGTLIG 389

Query: 138 FCVSTLVYFTS 148
             V  +     
Sbjct: 390 GMVIAMYLPIF 400


>gi|91776494|ref|YP_546250.1| type II secretion system protein [Methylobacillus flagellatus KT]
 gi|91710481|gb|ABE50409.1| type II secretion system protein [Methylobacillus flagellatus KT]
          Length = 402

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/161 (11%), Positives = 48/161 (29%), Gaps = 6/161 (3%)

Query: 19  ALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMP 77
               +   ++AG+P+  A  ++    S+  V      +      G SLS++  +      
Sbjct: 68  FTRQLATMMKAGVPLLQAFDIVGKGHSNPAVSKLLGDIKADVETGSSLSQAFRKYPL--- 124

Query: 78  LQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLP 137
                     +    +  G L   L  L+        +K K+++      +   +   + 
Sbjct: 125 --YFDNLFCNLVGAGEQAGILDSLLDRLATYKEKILAIKGKIKSALFYPISIIVVAFVIT 182

Query: 138 FCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMV 178
             +   V        +    D     ++ +A +   +    
Sbjct: 183 AVIMIFVIPAFKELFSSFGADLPAPTVMVMAISDFFVDYWW 223



 Score = 42.4 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 19/142 (13%), Positives = 42/142 (29%), Gaps = 11/142 (7%)

Query: 8   RTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLS 66
           R A            +     AG+P+ +A+  + G S + V     ++V      G SL+
Sbjct: 265 RKATIAR----FSRTLSTMFAAGVPLVEALDSVAGASGNRVYHDATKKVQSEISTGASLT 320

Query: 67  ESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEA 126
            ++         +        +    +  G L   L  ++       +   +  +  ME 
Sbjct: 321 VAMQN------TEVFPNMVLQMVAIGEESGALDSMLGKVADFYEGEVDDAVEALSSLMEP 374

Query: 127 KASAWIIGSLPFCVSTLVYFTS 148
                +   +   V  +     
Sbjct: 375 IIMVVLGTLIGGLVIAMYLPIF 396


>gi|304405043|ref|ZP_07386703.1| Type II secretion system F domain protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304345922|gb|EFM11756.1| Type II secretion system F domain protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 274

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 86/190 (45%), Gaps = 7/190 (3%)

Query: 4   LIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA-------VAVIVGQSSDPVRSEFRRVI 56
           L++KR  +    F  AL  +  S+ AG  V +A       + ++    +  +  EF  + 
Sbjct: 84  LLEKRRVRLQLQFKEALYSVTSSLAAGRSVENAFIAAEADLQLLYPGGTADIVREFAMIR 143

Query: 57  ETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMK 116
                G +L   +S+      L+E++ F  V S   + GG+L + +   S+++ ++ +++
Sbjct: 144 HRMENGETLESGLSQFANRAQLEEITQFVDVFSTCKRTGGDLVDVIRRTSQVIGEKLDIQ 203

Query: 117 AKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGI 176
            ++  +  + +  + I+ ++PF     +   +P Y   L + P G++LL +     +   
Sbjct: 204 QEIAVMLAQKRFESRILTAVPFVFIAGLNLAAPDYTGPLYSSPLGYVLLTLLLLGFVGCG 263

Query: 177 MVMRLMINFD 186
            ++R ++   
Sbjct: 264 ALIRKLMMIR 273


>gi|256824883|ref|YP_003148843.1| Flp pilus assembly protein TadB [Kytococcus sedentarius DSM 20547]
 gi|256688276|gb|ACV06078.1| Flp pilus assembly protein TadB [Kytococcus sedentarius DSM 20547]
          Length = 286

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 66/173 (38%), Gaps = 3/173 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
           D +P+ +D +   VRAG+ + +A+A +  +  + +R  F               S+  + 
Sbjct: 108 DAWPDCVDHVASGVRAGMALPEALAQLAVRGPEELRPAFAGFAHDYRATGRFHVSLDALK 167

Query: 74  RYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
             +           + +  +  G +L   L  LS  LR+  + +++++A       +A +
Sbjct: 168 ERLSDPVADRLVESLRIAREVGGSDLGVVLRTLSSFLREEAHTRSEMEARQSWTVNAARL 227

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINF 185
             + P+ V  ++            N   G ++L +     +   ++M  +   
Sbjct: 228 GLAAPWIVLAMLATRGDSLAA--YNSTTGALVLVLGGLVSVGAYLLMMRLGRI 278


>gi|302391033|ref|YP_003826853.1| type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203110|gb|ADL11788.1| Type II secretion system F domain protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 306

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 74/155 (47%), Gaps = 2/155 (1%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +   I +R  K     P+ LD++  SV AGL    A+  +V + + P+  EF R+++   
Sbjct: 148 LSKKISERQKKMQQALPDVLDLLTVSVEAGLGFDSALVRVVDKIAGPISEEFERLLQEIR 207

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           +G    +++  +     +++++ F T I    +LG ++ + L   S+ +R ++  +A+ Q
Sbjct: 208 MGKPRRDAMRDLGERTNVEDLTNFITAIVQADKLGVSIGKVLRVQSKQIRQKRRQRAEAQ 267

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           A+    K    ++  +   +  ++    P  + V+
Sbjct: 268 AMKAPIKMLLPLVFFIFPTLFIIL--LGPAAIKVM 300


>gi|304390832|ref|ZP_07372784.1| type II secretion system protein [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|304325715|gb|EFL92961.1| type II secretion system protein [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 295

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 74/175 (42%), Gaps = 3/175 (1%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMV 73
             +PN +D +V  VRAGL + + +  +  ++   +R  F         G +L  S+  + 
Sbjct: 116 KAWPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRAGGNLDASLKILK 175

Query: 74  RYMPLQEVSFFSTVISVQSQ-LGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
             +           + + +Q  G +L   L +L  +LR  +  + +V A        A +
Sbjct: 176 HELADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEVLARQSWTVTGARL 235

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV 187
             + P+ +  L+  + PG + V  + P G M+L V A    +  ++M  +   +V
Sbjct: 236 AAASPWIILALL-LSRPGTLEV-YSTPVGSMILLVGALVSALAYLMMLRLGRLEV 288


>gi|257784835|ref|YP_003180052.1| type II secretion system protein [Atopobium parvulum DSM 20469]
 gi|257473342|gb|ACV51461.1| type II secretion system protein [Atopobium parvulum DSM 20469]
          Length = 272

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 70/174 (40%), Gaps = 1/174 (0%)

Query: 11  KFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESIS 70
           +     P+    I  ++ +GL +S ++  +   +   V   F         G  + E+I 
Sbjct: 96  EIAHMMPSIFRTIAVALGSGLTLSQSIEYVSKHTEGVVSESFCIADMQIKCGFPIEEAIE 155

Query: 71  RMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130
            +   +    V+  ++ + +  + G  L   L   + ++  ++  +  +   + + + SA
Sbjct: 156 DLAERLDAPGVNLLASALVISHRTGSPLKNLLQKTAELVELQEKNQRLIATKTAQVRLSA 215

Query: 131 WIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMIN 184
            I+  LP  +  ++   SP +   L   P G +   +A     I ++++R ++ 
Sbjct: 216 RIVCLLPVVLLIILSLVSPDFQKGLF-TPSGVICTVIAMIMDCIALLIIRSIMK 268


>gi|240143494|ref|ZP_04742095.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
 gi|257204528|gb|EEV02813.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
          Length = 245

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 2   KHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRV 55
                +R  K + +F +A+  +  ++ AG  +  A      +          +  E  ++
Sbjct: 54  NKKRDERAKKLMIEFRDAIQAVAAALLAGYSIEHAWKEAEREIMDLYGKEAMITKELIQM 113

Query: 56  IETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNM 115
                L  ++ E +  +     ++E+  F+ +     + GG+  + +   +  +  +  +
Sbjct: 114 NAEIKLNRNVEEILHDLAVRSGVEEIQSFAEIFGFAKRSGGDFPQIIRTTAARISAKIEV 173

Query: 116 KAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIG 175
           + +V  +    K    I+  +PF +   +   S  +++ L  +  G +++  A    +  
Sbjct: 174 EREVDTVIAGKKLEGKIMSVMPFFILAYLNLASREFIDPLYGNLAGVLVMSAALLVFVGA 233

Query: 176 IMVMRLMINFDV 187
           + + R + +  V
Sbjct: 234 MAINRRISDIRV 245


>gi|85705157|ref|ZP_01036257.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
 gi|85670479|gb|EAQ25340.1| type II/IV secretion system protein, TadC subfamily protein
           [Roseovarius sp. 217]
          Length = 325

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 69/158 (43%), Gaps = 5/158 (3%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +    +KR  +  D FP++LD+++  + AG  +  ++  +  +       +  EF  V  
Sbjct: 162 ITKRQQKRQEEIQDGFPDSLDMMLVCIEAGQSMDQSIIRVASEMRASYPALAEEFEIVSL 221

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G      ++ M     +Q+++ F TV+      G ++ EAL   +  +RD++ M+A
Sbjct: 222 QIKAGRDKPSVLNEMAERCGVQDITSFVTVMVQSQTFGTSIGEALRVYAAEMRDKRVMRA 281

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVL 155
           + +A  +  K +   +      +  ++    P  + ++
Sbjct: 282 EEKANKLPTKMTLATMMLTVPPLLIIL--VGPSVLGIM 317


>gi|209551764|ref|YP_002283681.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537520|gb|ACI57455.1| type II secretion system protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 328

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 62/148 (41%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           + + + KR       +P+ALD+++  V +G+ +  A+  +  +    S P+  E      
Sbjct: 170 ISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPPLAEEMVLTTA 229

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     ++  +     ++ V   +  +    + G  +++AL  L++  RD +  +A
Sbjct: 230 ELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEGRDERMNEA 289

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +  +I      +  ++ 
Sbjct: 290 EKKAAALPPKLTVPMILFFLPVLIAVIL 317


>gi|325678292|ref|ZP_08157920.1| type II secretion system protein F domain protein [Ruminococcus
           albus 8]
 gi|324110055|gb|EGC04243.1| type II secretion system protein F domain protein [Ruminococcus
           albus 8]
          Length = 303

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 77/187 (41%), Gaps = 7/187 (3%)

Query: 7   KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS------SDPVRSEFRRVIETQH 60
           KR       F + LD +  SV +G     A                 +  E   +++ Q 
Sbjct: 118 KRRNDIRRQFMDLLDALAASVASGSNAIKAFEAAKEDLVLQYGEDSIIVQELTLILDGQK 177

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
             + +S S+    +   ++E+  F+ V  +  + GG+ S+ + +   IL  + N++ +++
Sbjct: 178 NFIDISASLIDFGKRSGIKEIESFAQVFELSHRKGGDFSKVIRDSYEILYSKINIEMEIE 237

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
                 +    I+ ++PF +  ++   SP +       P G + + V    ++I  ++ R
Sbjct: 238 TKIAATRNELNIMLAMPFILVGMMKSMSPDF-AYNFRTPTGALGITVGLVIVVISYLLGR 296

Query: 181 LMINFDV 187
            + + +V
Sbjct: 297 KITSIEV 303


>gi|242311994|ref|ZP_04811011.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254265316|ref|ZP_04956181.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
 gi|242135233|gb|EES21636.1| type II secretion system protein [Burkholderia pseudomallei 1106b]
 gi|254216318|gb|EET05703.1| type II secretion system protein [Burkholderia pseudomallei 1710a]
          Length = 313

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   I  R    ++DFP+ALD++   V AGL +  A+  +  +    S  V  E   ++ 
Sbjct: 148 LARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLL 207

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +      ++V  FST++    + G ++  +L  LS  LR ++ M+A
Sbjct: 208 EMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRA 267

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +        I    P  ++ L+          L+    G
Sbjct: 268 EERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTLLPTMAG 312


>gi|254441173|ref|ZP_05054666.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
 gi|198251251|gb|EDY75566.1| Bacterial type II secretion system protein F domain [Octadecabacter
           antarcticus 307]
          Length = 326

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 69/148 (46%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS---DPVRSEFRRVIE 57
           +     +R  + ++ FP++LD+++  V AG  +  ++  +  +       +  E++ V  
Sbjct: 163 VGKRQAERQLEMINGFPDSLDMMLVCVEAGQSLDQSIIRVAHELKSGFPALAEEYQMVSH 222

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G   ++ +  M     + ++S F TV+    Q G +++EAL   S  +RD++ M+A
Sbjct: 223 EMKAGKDKTQVLRDMAERTGVADISSFVTVLIQSQQFGTSIAEALRVFSAEMRDKRVMRA 282

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A ++  K +   +      +  ++ 
Sbjct: 283 EEKANTLPTKMTLATMLLTVPPLLIILI 310


>gi|53723215|ref|YP_112200.1| hypothetical protein BPSS2198 [Burkholderia pseudomallei K96243]
 gi|76819357|ref|YP_336475.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|126455503|ref|YP_001076997.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|167744183|ref|ZP_02416957.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167821382|ref|ZP_02453062.1| type II secretion system protein [Burkholderia pseudomallei 91]
 gi|167829724|ref|ZP_02461195.1| type II secretion system protein [Burkholderia pseudomallei 9]
 gi|167851191|ref|ZP_02476699.1| type II secretion system protein [Burkholderia pseudomallei B7210]
 gi|167899821|ref|ZP_02487222.1| type II secretion system protein [Burkholderia pseudomallei 7894]
 gi|167916485|ref|ZP_02503576.1| type II secretion system protein [Burkholderia pseudomallei 112]
 gi|167924342|ref|ZP_02511433.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
 gi|217424204|ref|ZP_03455703.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|226194113|ref|ZP_03789713.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237510430|ref|ZP_04523145.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254182575|ref|ZP_04889169.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|254187127|ref|ZP_04893642.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254192523|ref|ZP_04898962.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|254296491|ref|ZP_04963947.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|52213629|emb|CAH39683.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76583830|gb|ABA53304.1| Bacterial type II secretion system protein, probably involved in
           Flp pilus synthesis [Burkholderia pseudomallei 1710b]
 gi|126229271|gb|ABN92684.1| type II secretion system protein [Burkholderia pseudomallei 1106a]
 gi|157806389|gb|EDO83559.1| type II secretion system protein [Burkholderia pseudomallei 406e]
 gi|157934810|gb|EDO90480.1| type II secretion system protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169649281|gb|EDS81974.1| type II secretion system protein [Burkholderia pseudomallei S13]
 gi|184213110|gb|EDU10153.1| type II secretion system protein [Burkholderia pseudomallei 1655]
 gi|217392669|gb|EEC32692.1| type II secretion system protein [Burkholderia pseudomallei 576]
 gi|225933806|gb|EEH29793.1| type II secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002635|gb|EEP52059.1| type II secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 319

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 4/165 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +   I  R    ++DFP+ALD++   V AGL +  A+  +  +    S  V  E   ++ 
Sbjct: 154 LARRIAARQRMIVEDFPDALDLLTVCVEAGLGLDAALTKVADELRLRSPVVADELGLMLL 213

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
               G +   ++  +      ++V  FST++    + G ++  +L  LS  LR ++ M+A
Sbjct: 214 EMRSGFTKETALRNLALRTGAEDVDAFSTMLIQADRFGTSIGASLRVLSDTLRTQRRMRA 273

Query: 118 KVQALSME-AKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRG 161
           + +A  +        I    P  ++ L+          L+    G
Sbjct: 274 EERAAKIALKLLFPLIFCIFPALLTVLLGPAFIHIYRTLLPTMAG 318


>gi|293606487|ref|ZP_06688845.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815110|gb|EFF74233.1| type II secretion system protein [Achromobacter piechaudii ATCC
           43553]
          Length = 307

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 74/184 (40%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +     KR  + +   P  LD IVR +  G  +  A       + +P+R           
Sbjct: 122 LWLRADKRRRRMIGQLPAFLDNIVRLITIGNSMGAAFQTAAATTDEPLREVVETAASLSR 181

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
               L  ++ ++ R   L+E+   + V+S+  + GG   + L  ++  +RD    + ++ 
Sbjct: 182 SAKELDAALVQVSRMYGLKELYMVAAVVSLAMRFGGRSDQVLERMAAFMRDVAQARNELT 241

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           A S E + SAWI+  LP  ++  +   +      L  DP G  +L  A    + G   + 
Sbjct: 242 ASSAEVRLSAWILALLPVGIAGFIIVANNKLFMGLWEDPLGFKMLLTAVVLQIGGCYWLY 301

Query: 181 LMIN 184
            M  
Sbjct: 302 RMAK 305


>gi|294012437|ref|YP_003545897.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
 gi|292675767|dbj|BAI97285.1| Flp pilus assembly protein TadC [Sphingobium japonicum UT26S]
          Length = 330

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 60/148 (40%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQ---SSDPVRSEFRRVIE 57
           + + I+KR+A      P+ALD++V    AGL V  A + +  +   +   +  EF     
Sbjct: 172 IDNKIQKRSAAIRKGLPDALDLLVICAEAGLTVDAAFSRVARELGKAYPELGDEFHLTAI 231

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
                     +   +   + L  +    T +    + G  L+ AL  LS   R  + M+A
Sbjct: 232 ELSFLTERRMAFENLATRVKLDAIKGVVTTMIQTEKYGTPLASALRVLSAEFRHERMMRA 291

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A  + A  +  +I  +   +  ++ 
Sbjct: 292 EEKAARLPAIMTVPLILFILPTLFVVIL 319


>gi|327543264|gb|EGF29697.1| flp pilus assembly protein TadC [Rhodopirellula baltica WH47]
          Length = 328

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 63/148 (42%), Gaps = 3/148 (2%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS---SDPVRSEFRRVIE 57
           +  +  KR  K     P+ALD++V  V AGL +  A+  +  +       +  EF     
Sbjct: 168 LGFMASKRREKIFLGLPDALDLMVVCVEAGLGLDQALRKVAEEMQKSHKAIGEEFSISNH 227

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKA 117
              LG   SE +S +     + ++   ++++    + G ++++AL   S  +R ++   A
Sbjct: 228 QLQLGSPRSEVLSGLGYRSGVDDLKQLASILIQADKFGSSVAQALRVQSDSMRTKRRQIA 287

Query: 118 KVQALSMEAKASAWIIGSLPFCVSTLVY 145
           + +A     K    ++  +   +  ++ 
Sbjct: 288 EEKAAKTAVKMIFPLVLFIFPGIFVVLV 315


>gi|119472644|ref|ZP_01614635.1| type IV pilus biogenesis protein PilC [Alteromonadales bacterium
           TW-7]
 gi|119444848|gb|EAW26149.1| type IV pilus biogenesis protein PilC [Alteromonadales bacterium
           TW-7]
          Length = 409

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 54/171 (31%), Gaps = 6/171 (3%)

Query: 14  DDFPNALDIIVRSVRAGLPVSDAVAVIVG-QSSDPVRSEFRRVIETQHLGLSLSESISRM 72
            D       I   + AG+P+  A+ +I    ++  V      + +    G  LS+++ + 
Sbjct: 70  KDIALVTRQIATMLMAGVPLIQAIEMIGTGSTNKSVGKLMETIGDEVKAGQPLSQALRKH 129

Query: 73  VRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWI 132
            R             +    +  G L +    ++      + +K+K++       +   I
Sbjct: 130 PR-----YFDDLYCDLVASGEQSGALDKIFDRVALYKEKSEALKSKIKKAMFYPISVLVI 184

Query: 133 IGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMI 183
            G +   +   V        +    +     L  +  +  +     M L+ 
Sbjct: 185 AGIVTSILLIFVVPQFQDIFSGFGAELPAFTLFVIGISEFMQAYWWMILIA 235



 Score = 35.1 bits (79), Expect = 4.4,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 40/129 (31%), Gaps = 7/129 (5%)

Query: 21  DIIVRSVRAGLPVSDAVAVIVGQSSDPVRS-EFRRVIETQHLGLSLSESISRMVRYMPLQ 79
             +  +  AG+P+ DA+    G S + V       +      G  ++ ++         +
Sbjct: 281 RTLSTTFAAGVPLVDALDSAAGASGNAVYRYAILDIKAEVSSGNQMNWAMRN------SK 334

Query: 80  EVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFC 139
                   +    +  G+L   LA ++ I     +      +  +E    A +   +   
Sbjct: 335 IFPDMVIQMVAIGEESGSLDGMLAKVATIYEQEVDDAVDGLSSLLEPLIMAVLGVLVGGL 394

Query: 140 VSTLVYFTS 148
           +  +     
Sbjct: 395 IVAMYLPIF 403


>gi|326205012|ref|ZP_