RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >gnl|CDD|147186 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein. This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing. Length = 241 Score = 28.5 bits (64), Expect = 0.58 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 43 VRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISK 94 R T + R+++LR +++ E HK+K N +I+ + L S Sbjct: 43 YRQPG-QGTEDELRKRDLRAELEEAERAHKSKKENKLAIEDGDKSTNLEASN 93 >gnl|CDD|145277 pfam02009, Rifin_STEVOR, Rifin/stevor family. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens. Length = 289 Score = 27.3 bits (61), Expect = 1.6 Identities = 19/77 (24%), Positives = 27/77 (35%), Gaps = 10/77 (12%) Query: 63 AIQK-IELNHKAKIGNTKSIDSLI------SCSGLPISKQHYYIGSCVIGFI--CGVLSL 113 AIQK IE A + K + + SG+ I+ +Y +IG I Sbjct: 130 AIQKGIEAGIAAGLKKLKGLGKYVVILKLRCTSGI-INASNYSAPLTLIGAIAAKAATIC 188 Query: 114 TLSSSFFTFLCVSVSSA 130 SS+ C S Sbjct: 189 VASSANEGSKCCFSSKI 205 >gnl|CDD|32053 COG1868, FliM, Flagellar motor switch protein [Cell motility and secretion]. Length = 332 Score = 26.4 bits (58), Expect = 2.9 Identities = 9/26 (34%), Positives = 18/26 (69%) Query: 54 TKRRKELREAIQKIELNHKAKIGNTK 79 + RKELR+ +Q++E+ +A++G Sbjct: 240 PEWRKELRQQVQRVEVELEARLGEIS 265 >gnl|CDD|37247 KOG2036, KOG2036, KOG2036, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]. Length = 1011 Score = 26.1 bits (57), Expect = 3.7 Identities = 10/49 (20%), Positives = 18/49 (36%) Query: 34 SKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSID 82 K+ + DRV +L EA ++ E + K K+ + Sbjct: 902 EKAIEETLPREKDRVNEPTPVSLEDDLEEAAKEAEEQMREKQKELKAEE 950 >gnl|CDD|147654 pfam05600, DUF773, Protein of unknown function (DUF773). This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown. Length = 506 Score = 25.8 bits (57), Expect = 4.3 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Query: 54 TKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISK 94 T++R+E RE +E I T+ + LI ISK Sbjct: 458 TEKRQEAREEQSSLEPKLDLLIEKTRELQKLIEAD---ISK 495 >gnl|CDD|37642 KOG2431, KOG2431, KOG2431, 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism]. Length = 546 Score = 25.7 bits (56), Expect = 4.6 Identities = 7/39 (17%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 6 SWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVR 44 WF++ ++ +F L ++ N NP + + + + + Sbjct: 10 KWFILFILAFLLFVLL-LLYINPANPAELPNPQSGQKTK 47 >gnl|CDD|32366 COG2183, Tex, Transcriptional accessory protein [Transcription]. Length = 780 Score = 25.2 bits (55), Expect = 5.4 Identities = 7/47 (14%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Query: 34 SKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAK---IGN 77 + D K++ + P + + ++ + +K + IGN Sbjct: 346 AVVDDTGKLLDTATIYPHPPVNQSDKAEATLKDLIRKYKVELIAIGN 392 >gnl|CDD|30369 COG0019, LysA, Diaminopimelate decarboxylase [Amino acid transport and metabolism]. Length = 394 Score = 24.9 bits (54), Expect = 7.9 Identities = 4/24 (16%), Positives = 12/24 (50%) Query: 43 VRADRVIPTANTKRRKELREAIQK 66 +R++ + K +E+ A++ Sbjct: 94 FPPERIVFSGPAKSEEEIAFALEL 117 >gnl|CDD|36896 KOG1683, KOG1683, KOG1683, Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism]. Length = 380 Score = 24.9 bits (54), Expect = 8.1 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 38 DNAKVVRADRVIP--TANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQ 95 D AD VI + + + EL ++++K+E + NT S+D + +GL + Sbjct: 63 DYTGFANADMVIEAVFEDLELKHELFKSLEKVEPPKCIRGSNTSSLDINVISAGL--DRP 120 Query: 96 HYYIGS 101 +G Sbjct: 121 EMVVGM 126 >gnl|CDD|31310 COG1113, AnsP, Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism]. Length = 462 Score = 24.8 bits (54), Expect = 8.2 Identities = 9/39 (23%), Positives = 15/39 (38%) Query: 99 IGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF 137 + S V+ + VL+ L F + S L+F Sbjct: 340 LLSAVVLLLGVVLNYILPEKVFELVTSSSGLGLLFVWLM 378 >gnl|CDD|143501 cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase. Diaminopimelate decarboxylase (DapDC, EC 4.1.1.20) participates in the last step of lysine biosynthesis. It converts meso-2,6-diaminoheptanedioate to L-lysine. It is a fold type III PLP-dependent enzyme that contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. DapDC exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Length = 373 Score = 24.8 bits (55), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 43 VRADRVIPTANTKRRKELREAIQK 66 +R++ T N K +EL A++ Sbjct: 70 FPPERIVFTGNGKSDEELELALEL 93 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.139 0.418 Gapped Lambda K H 0.267 0.0736 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,589,937 Number of extensions: 73845 Number of successful extensions: 424 Number of sequences better than 10.0: 1 Number of HSP's gapped: 423 Number of HSP's successfully gapped: 39 Length of query: 137 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 53 Effective length of database: 4,448,581 Effective search space: 235774793 Effective search space used: 235774793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (23.8 bits)