RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >2avt_A DNA polymerase III beta subunit; beta clamp, sliding clamp, replication, transferase; HET: DNA; 2.00A {Streptococcus pyogenes} PDB: 2awa_A* (A:140-204,A:253-378) Length = 191 Score = 29.7 bits (67), Expect = 0.13 Identities = 9/36 (25%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Query: 38 DNAKVVRADRVIPTANTKR----RKELREAIQKIEL 69 + VV DR++ T + LR A+++ L Sbjct: 58 ADFMVVLPDRLLMTEFETEVVFNTQSLRHAMERAFL 93 >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initiative; 2.31A {Geobacillus stearothermophilus} (A:1-175,A:282-450) Length = 344 Score = 29.2 bits (65), Expect = 0.21 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Query: 23 AIFYNVINPGDSKSQDNAKVVRADRVIPTANT------KRRKELREAIQKIELNHKAK 74 A N NP ++ + + ++V+ T + KEL E + L K Sbjct: 146 AWLINFTNPAGXVTEAVLRYTKQEKVVGLCGTRAEVVQQLEKELFELYKDPNLAIKPP 203 >1xva_A Glycine N-methyltransferase; HET: SAM; 2.20A {Escherichia coli} (A:1-39,A:177-245) Length = 108 Score = 24.8 bits (54), Expect = 4.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 75 IGNTKSIDSLISCSGLPISKQHYYIGSCVI 104 IG+T+S D ++S P K YY Sbjct: 34 IGDTRSYDYILSTGCAPPGKNIYYKSDLTK 63 >2owl_A Recombination-associated protein RDGC; replication, RECA; 2.40A {Escherichia coli} (A:) Length = 303 Score = 24.7 bits (54), Expect = 4.5 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 47 RVIPTANTKRRKELREAIQKIELNHKAKIGNTK 79 +++P+ K + L I K+E K+ T+ Sbjct: 73 KILPSPVIK--QALEAKIAKLEAEQARKLKKTE 103 >1rz2_A Conserved hypothetical protein BA4783; sortase B protein, B. anthracis, structural genomics, PSI, protein structure initiative; 1.60A {Bacillus anthracis str} (A:) Length = 254 Score = 24.0 bits (51), Expect = 7.0 Identities = 10/74 (13%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Query: 5 NSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNA--KVVRADRVIPTANTKRRKELRE 62 +F L V + F Y+++ D + P + E+R+ Sbjct: 10 KIFFQRILTVVFLGTFFYSVYELGDIFMDYYENRKVMAEAQNIYEKSPMEEQSQDGEVRK 69 Query: 63 AIQKIELNHKAKIG 76 + ++ ++ +G Sbjct: 70 QFKALQQINQEIVG 83 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.327 0.139 0.418 Gapped Lambda K H 0.267 0.0678 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 978,727 Number of extensions: 38070 Number of successful extensions: 104 Number of sequences better than 10.0: 1 Number of HSP's gapped: 104 Number of HSP's successfully gapped: 9 Length of query: 137 Length of database: 4,956,049 Length adjustment: 80 Effective length of query: 57 Effective length of database: 2,251,649 Effective search space: 128343993 Effective search space used: 128343993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.1 bits)