BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] Length = 137 Score = 278 bits (712), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 137/137 (100%), Positives = 137/137 (100%) Query: 1 MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKEL 60 MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKEL Sbjct: 1 MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKEL 60 Query: 61 REAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFF 120 REAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFF Sbjct: 61 REAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFF 120 Query: 121 TFLCVSVSSALVFPRFF 137 TFLCVSVSSALVFPRFF Sbjct: 121 TFLCVSVSSALVFPRFF 137 >gi|254780370|ref|YP_003064783.1| argininosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 24.6 bits (52), Expect = 0.68, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 6/50 (12%) Query: 54 TKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCV 103 T + L+EA K +H T D L+S +GLP + HY G V Sbjct: 359 TVNKDRLQEAATK---SHSTA---TDLADWLVSHAGLPFREAHYITGCTV 402 >gi|254780241|ref|YP_003064654.1| preprotein translocase subunit SecY [Candidatus Liberibacter asiaticus str. psy62] Length = 444 Score = 23.5 bits (49), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 11/88 (12%) Query: 12 LITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNH 71 ++ SVF +A FY I ++ DN K + IP R L I + L Sbjct: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLK--KHGGFIPGIRPGDRTALH--IDYV-LTR 373 Query: 72 KAKIGNTKSI------DSLISCSGLPIS 93 +G + ++LI+ +G+P+S Sbjct: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVS 401 >gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62] Length = 329 Score = 21.9 bits (45), Expect = 3.9, Method: Compositional matrix adjust. Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 8/85 (9%) Query: 1 MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKEL 60 +FD + VS+F +YA+ + G+ + + K V +R I RK+ Sbjct: 8 LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKR--MKSVAVEREI------LRKQQ 59 Query: 61 REAIQKIELNHKAKIGNTKSIDSLI 85 ++QK + + + ++KS+ + + Sbjct: 60 ITSLQKDSASSRLRTRDSKSLRNFV 84 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.9 bits (45), Expect = 5.0, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Query: 22 YAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAK----IGN 77 + + +N+I P + + I T R EL + +I LN + +GN Sbjct: 14 FFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGN 73 Query: 78 TK 79 K Sbjct: 74 VK 75 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.139 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,114 Number of Sequences: 1233 Number of extensions: 3246 Number of successful extensions: 16 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 7 length of query: 137 length of database: 328,796 effective HSP length: 65 effective length of query: 72 effective length of database: 248,651 effective search space: 17902872 effective search space used: 17902872 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 34 (17.7 bits)