>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

Probab=97.66 E-value=0.00026 Score=48.69 Aligned_cols=77 Identities=18% Similarity=0.144 Sum_probs=53.1 Q ss_pred HCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCC Q ss_conf 22588489981888888899999983038767679996421312567875677874166665300018999987520599 Q gi|254780724|r 247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326 (483) Q Consensus 247 v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~P 326 (483) T Consensus 22 v~~GEiv~ilGpNGaGKSTllk~i~G~l~p~~G~i~~~g~~~-----------~~~pq~~~LSGGqrQRv~iAral~~~p 90 (177) T cd03222 22 VKEGEVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEWDGITP-----------VYKPQYIDLSGGELQRVAIAAALLRNA 90 (177) T ss_pred CCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCCCE-----------ECCCCCCCCCHHHHHHHHHHHHHHCCC T ss_conf 589989999899999999999999688678899466668612-----------215551507989999999999982399 Q ss_pred CEEEECCC Q ss_conf 88996575 Q gi|254780724|r 327 ERIILGEV 334 (483) Q Consensus 327 D~IiVGEi 334 (483) T Consensus 91 ~lllLDEP 98 (177) T cd03222 91 TFYLFDEP 98 (177) T ss_pred CEEEECCC T ss_conf 99997488

HHsearch alignment for GI: 254780724 and conserved domain: cd03222