>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.30 E-value=0.00095 Score=44.81 Aligned_cols=81 Identities=23% Similarity=0.193 Sum_probs=52.3 Q ss_pred HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCC-CCCCEEEEEEECCCCCCCCCCHHHHHHHHHH Q ss_conf 986225884899818888888999999830387676799964213125-6787567787416666530001899998752 Q gi|254780724|r 244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL-QQPHVVRLETRPPNIEGEGEITMRDLVKNCL 322 (483) Q Consensus 244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l-~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aL 322 (483) T Consensus 22 s~~v~~Ge~~~iiGpSGsGKSTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~r~ig~vfQ~~~Lf--p~ltV~eNi~~~l 99 (239) T cd03296 22 SLDIPSGELVALLGPSGSGKTTLLRLIAGLERPDSGTILFGGEDATDVPVQERNVGFVFQHYALF--RHMTVFDNVAFGL 99 (239) T ss_pred EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCC--CCCCHHHHHHHHH T ss_conf 86988998999999999779999999976999986399999999999996567767981782106--7996999998799 Q ss_pred HCCC Q ss_conf 0599 Q gi|254780724|r 323 RMRP 326 (483) Q Consensus 323 R~~P 326 (483) T Consensus 100 ~~~~ 103 (239) T cd03296 100 RVKP 103 (239) T ss_pred HHCC T ss_conf 7335

HHsearch alignment for GI: 254780724 and conserved domain: cd03296