HHsearch alignment for GI: 254780725 and conserved domain: COG1192

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].
Probab=99.97  E-value=1.6e-29  Score=200.75  Aligned_cols=239  Identities=22%  Similarity=0.304  Sum_probs=175.1

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCC--CCHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             5379997469887756899999999996269949999787989860334389987--89888631845612433765320
Q gi|254780725|r  161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI--NSISDAIYPVGRIDKAFVSRLPV  238 (427)
Q Consensus       161 grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~--~~l~d~l~~~~rlD~~~l~~~l~  238 (427)
T Consensus         2 ~~iI~v~n~KGGvGKTT~a~nLa~~La~~~~~kVLliDlDpQ-~s~t~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~   78 (259)
T COG1192           2 MKIIAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQ-GSLTSWLGLRPDLEGDLYNLLSGLKER--PDILDYTV   78 (259)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC-CCHHHHHCCCCCCCCCHHHHHHCCCCC--CCHHHCCC
T ss_conf             769999857888519999999999999838997899978999-417778466643231036676323332--21022034


Q ss_pred             CCCCCEEEEECCCCCCC--HHCC----CHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHH
Q ss_conf             24898068724876120--3207----99999998999851288899738888898999998620125435787768899
Q gi|254780725|r  239 FYAENLSILTAPAMLSR--TYDF----DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR  312 (427)
Q Consensus       239 ~~~~gL~lL~a~~~~~~--~~~~----~~~~l~~ll~~l~~~yd~VIiD~p~~~~~~~~~~L~~AD~vviV~~p~~~slr  312 (427)
T Consensus        79 -~~~~l~~ip~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~yD~iiID~pp~l~~l~~nal~asd~vliP~~~~~~~~~  157 (259)
T COG1192          79 -VIEGLDLIPSNIDLAEGAEIELNAVAKELLLKRLLDPVKDDYDYIIIDTPPSLGVLTLNALAAADHVLIPVQPEFLDLE  157 (259)
T ss_pred             -CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCEEECCCCCHHHHH
T ss_conf             -4567312357600010045665421178999999752026999899899986167779999982755670475086898


Q ss_pred             HHHHHHHHHHHC---CCCC-CCCEEEEECCCCCCC-CHHHHHHHHHHHCCC-EEEEECCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             999999999981---9876-753899956589875-200599999984895-3799068799999988479618988899
Q gi|254780725|r  313 NSKNLIDVLKKL---RPAD-KPPYLVLNQVKTPKK-PEISISDFCAPLGIT-PSAIIPFDGAVFGMSANSGKMIHEVDPK  386 (427)
Q Consensus       313 ~a~~ll~~l~~~---~~~~-~~~~iVlNr~~~~~~-~~i~~~~~~~~lg~~-~~~~IP~D~~~~~~A~~~G~pi~e~~p~  386 (427)
T Consensus       158 ~l~~~~~~i~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~-~~~~a~~~g~~~~~~~~~  236 (259)
T COG1192         158 GLEQLLNTLEDLLKLRRNKLIVVGILITRFDSRTKLADEVLQELKQLLGDPVLKTKIPRRV-AYREAAAEGKPLYEYDPK  236 (259)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCH-HHHHHHHCCCCEEEECCC
T ss_conf             8999999999999852453232567435347420157899999997514311114476532-688788749801550787


Q ss_pred             CHHHHHHHHHHHHHHCCC
Q ss_conf             989999999999985221
Q gi|254780725|r  387 SAIANLLVDFSRVLMGRV  404 (427)
Q Consensus       387 s~~a~~~~~La~~i~gr~  404 (427)
T Consensus       237 ~~~~~~~~~~~~e~~~~~  254 (259)
T COG1192         237 SKAAEEYYELAKELLEEL  254 (259)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             557999999999999975