HHsearch alignment for GI: 254780725 and conserved domain: COG1419

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion].
Probab=97.37  E-value=0.00047  Score=44.11  Aligned_cols=186  Identities=13%  Similarity=0.158  Sum_probs=98.0

Q ss_pred             CCCHHHHHHHHHCCCCEEEC----CCCC-HHHHHHHHHHCCCCCCCC-CCCCCEEEEEEECCCCCCHHHHHHHHHHHHH-
Q ss_conf             87189999999765626431----8999-899999763102332223-4567537999746988775689999999999-
Q gi|254780725|r  115 TNDVSLYRALISNHVSEYLI----EPLS-VADIINSISAIFTPQEEG-KGSSGCSISFIGSRGGVGSSTIAHNCAFSIA-  187 (427)
Q Consensus       115 ~~d~~l~r~l~r~Gv~dyl~----~P~~-~~~l~~ai~~~~~~~~~~-~~~~grvIav~g~KGGvGkTTiA~nLA~~LA-  187 (427)
T Consensus       151 ~~~~~~i~~~~~~~i~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~vi~LVG-PTGVGKTTTlAKLAar~~~  229 (407)
T COG1419         151 PTRLNLINELLRAGLELEILDMKDESYEDLRYFSEKLRKLLLSLIENLIVEQKRVIALVG-PTGVGKTTTLAKLAARYVM  229 (407)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEC-CCCCCHHHHHHHHHHHHHH
T ss_conf             046999999999756413331322222123217999999887644111124685799989-9887588799999999975


Q ss_pred             HHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCHHCCCHHHHHHH
Q ss_conf             62699499997879898603343899878988863184561243376532024898068724876120320799999998
Q gi|254780725|r  188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPV  267 (427)
Q Consensus       188 ~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~gL~lL~a~~~~~~~~~~~~~~l~~l  267 (427)
T Consensus       230 ~~~~~kVaiITtDtYRIGA~EQL-----k~Ya~im--------------------~vp~~---------vv~~~~el~~a  275 (407)
T COG1419         230 LKKKKKVAIITTDTYRIGAVEQL-----KTYADIM--------------------GVPLE---------VVYSPKELAEA  275 (407)
T ss_pred             HCCCCCEEEEEECCCHHHHHHHH-----HHHHHHH--------------------CCCEE---------EECCHHHHHHH
T ss_conf             32576068997144115289999-----9999986--------------------99559---------96399999999


Q ss_pred             HHHHHHCCCEEEECCCCCC--CHHH----HHHHHH--CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             9998512888997388888--9899----999862--0125435787768899999999999981987675389995658
Q gi|254780725|r  268 LDILEQIFPLVILDVPHVW--NSWT----QEVLTL--SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK  339 (427)
Q Consensus       268 l~~l~~~yd~VIiD~p~~~--~~~~----~~~L~~--AD~vviV~~p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~  339 (427)
T Consensus       276 i~~l~-~~d~ILVDTaGrs~~D~~~i~el~~~~~~~~~i~~~Lvlsat~-K~~dlkei~~~f~~~~i~----~~I~TKlD  349 (407)
T COG1419         276 IEALR-DCDVILVDTAGRSQYDKEKIEELKELIDVSHSIEVYLVLSATT-KYEDLKEIIKQFSLFPID----GLIFTKLD  349 (407)
T ss_pred             HHHHH-CCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCC-CHHHHHHHHHHHCCCCCC----EEEEECCC
T ss_conf             99853-1888999689988337899999999970356621799984576-468899999972458866----16897133


Q ss_pred             CC
Q ss_conf             98
Q gi|254780725|r  340 TP  341 (427)
Q Consensus       340 ~~  341 (427)
T Consensus       350 ET  351 (407)
T COG1419         350 ET  351 (407)
T ss_pred             CC
T ss_conf             56