HHsearch alignment for GI: 254780725 and conserved domain: COG1493

>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms].
Probab=92.02  E-value=0.88  Score=23.98  Aligned_cols=89  Identities=15%  Similarity=0.244  Sum_probs=61.3

Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCC--HHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCCC-CCCCCCCCEEEEEEE--
Q ss_conf             899988853289980899816871--899999997656264318999899999763102332-223456753799974--
Q gi|254780725|r   94 SALEPLAEVCDSGTKVIVIGDTND--VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ-EEGKGSSGCSISFIG--  168 (427)
Q Consensus        94 ~~l~~la~~~~p~~~Vivig~~~d--~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~~-~~~~~~~grvIav~g--  168 (427)
T Consensus        69 ~r~~~i~~~~~~~~P~iI~sk~~~~p~~l~~~a~~~~~p-il~s~~~ts~l~~~l~~yL~~~lA~~~~vHGvl~~I~GvG  147 (308)
T COG1493          69 ERKKRIGKLFSLDTPALIVSKGLPIPEELLDAAKKYNIP-ILTSKLSTSELSFTLTNYLSRPLAERVNVHGVLLDIFGVG  147 (308)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHCCCC-EEEECCHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEEEE
T ss_conf             589999997476997799978999978999998870996-6985331899999999986131052025546899994258


Q ss_pred             ----CCCCCCHHHHHHHHH
Q ss_conf             ----698877568999999
Q gi|254780725|r  169 ----SRGGVGSSTIAHNCA  183 (427)
Q Consensus       169 ----~KGGvGkTTiA~nLA  183 (427)
T Consensus       148 VLItG~SG~GKSElALeLi  166 (308)
T COG1493         148 VLITGPSGAGKSELALELI  166 (308)
T ss_pred             EEEECCCCCCHHHHHHHHH
T ss_conf             9998789887768999999