HHsearch alignment for GI: 254780725 and conserved domain: COG1763

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism].
Probab=96.31  E-value=0.037  Score=32.47  Aligned_cols=98  Identities=12%  Similarity=0.122  Sum_probs=57.2

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCC
Q ss_conf             53799974698877568999999999962699499997879898603343899878988863184561243376532024
Q gi|254780725|r  161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY  240 (427)
Q Consensus       161 grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~  240 (427)
T Consensus         2 ~~Il~ivG~k-~SGKTTLie~lv~~L~~-~G~rVa~iKH~hh~~~~----D~~GkDs--------~r~~~---------a   58 (161)
T COG1763           2 MKILGIVGYK-NSGKTTLIEKLVRKLKA-RGYRVATVKHAHHDFDL----DKPGKDT--------YRHRK---------A   58 (161)
T ss_pred             CCEEEEEECC-CCCHHHHHHHHHHHHHH-CCCEEEEEEECCCCCCC----CCCCCCC--------CHHHC---------C
T ss_conf             7289999627-99734289999999975-79379999865877777----8898766--------10003---------5


Q ss_pred             CCCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             89806872487612032079999999899985128889973
Q gi|254780725|r  241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD  281 (427)
Q Consensus       241 ~~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD  281 (427)
T Consensus        59 Ga~~~v~~s~~~~~~~~~~~~~~L~~vl~~l~~~~D~vLVE   99 (161)
T COG1763          59 GADQVVVASDHRTALMTRTPDRDLDAVLSRLDPLLDLVLVE   99 (161)
T ss_pred             CCCEEEEECCCEEEEEEECCCCCHHHHHHHCCCCCCEEEEE
T ss_conf             66349995597899998268768999997427556799995