HHsearch alignment for GI: 254780725 and conserved domain: COG3437

>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms].
Probab=98.75  E-value=2.3e-07  Score=64.50  Aligned_cols=115  Identities=17%  Similarity=0.292  Sum_probs=91.6

Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHHHHCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             30599983898999999988641100202237306998999999861899849999805987677889998885328998
Q gi|254780725|r   28 RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT  107 (427)
Q Consensus        28 ~~~~~~f~~~~~~~~~~~~~~~drr~~~~~~~v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~  107 (427)
T Consensus        14 ~~~vl~vDD~~~~~~~~~~lL---~~~~y~v~-~ae~g~~a~kl~~~~~-~dlvllD~~mp~mdg~ev~~~lk~~-~p~t   87 (360)
T COG3437          14 KLTVLLVDDEPDNLEALRQLL---RMIGYRVI-EAENGEEALKLLQEEP-PDLVLLDVRMPEMDGAEVLNKLKAM-SPST   87 (360)
T ss_pred             CCEEEEECCCHHHHHHHHHHH---HHCCCCEE-EECCCHHHHHHHCCCC-CCEEEEECCCCCCCHHHHHHHHHHC-CCCC
T ss_conf             014889658666899999999---74264146-4147507788751168-8567764257776599999998724-9765


Q ss_pred             E---EEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHH
Q ss_conf             0---8998168718999999976562643189998999997631
Q gi|254780725|r  108 K---VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISA  148 (427)
Q Consensus       108 ~---Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~  148 (427)
T Consensus        88 ~~ip~i~lT~~~d~~~~~~~~~~g~~dyl~KP~~~~~l~~rv~~  131 (360)
T COG3437          88 RRIPVILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSS  131 (360)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             65325998605876999999972477775288988999999999