HHsearch alignment for GI: 254780725 and conserved domain: COG3598

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair].
Probab=94.33  E-value=0.38  Score=26.18  Aligned_cols=47  Identities=23%  Similarity=0.337  Sum_probs=31.6

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHH---CC------CCEEEEECCCCCCCC
Q ss_conf             6753799974698877568999999999962---69------949999787989860
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASV---FA------METLLADLDLPYGTA  206 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~---~~------~~VlLvDlDl~~g~~  206 (427)
T Consensus        87 r~g-~~~~~~gdsg~GKttllL~l~IalaaG~~lfG~~v~epGkvlyvslEl~re~~  142 (402)
T COG3598          87 RKG-YVSILYGDSGVGKTTLLLYLCIALAAGKNLFGNKVKEPGKVLYVSLELYREDI  142 (402)
T ss_pred             HCC-EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCHHHH
T ss_conf             517-05898448862376899999999986477745335588807999822686889