HHsearch alignment for GI: 254780725 and conserved domain: COG3706

>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms].
Probab=96.26  E-value=0.016  Score=34.60  Aligned_cols=86  Identities=12%  Similarity=0.205  Sum_probs=67.6

Q ss_pred             CCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHH
Q ss_conf             69989999998618998499998059876778899988853289980899816871899999997656264318999899
Q gi|254780725|r   62 RGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD  141 (427)
Q Consensus        62 ~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~  141 (427)
T Consensus        18 a~~g~~~l~~~~~~~-~~~~lld~~m~~~~~~~~~~~lk~--~~~~-~v~~t~~~~~~~~~~~~~~~~~~~l~~~~~~~~   93 (435)
T COG3706          18 AKKGLIALAILLDHK-PDYKLLDVMMPGMDGFELCRRLKA--EPAT-VVMVTALDDSAPRVRGLKAGADDFLTKPVNDSQ   93 (435)
T ss_pred             CCCHHHHHHHHHCCC-CCEEEEECCCCCCCCHHHHHHHHC--CCCC-EEEEEECCCCCCCHHHHHHHHHHHCCCCCCHHH
T ss_conf             254277999974489-874874100688673019987635--8751-699860378777556776313441367777177


Q ss_pred             HHHHHHHCCC
Q ss_conf             9997631023
Q gi|254780725|r  142 IINSISAIFT  151 (427)
Q Consensus       142 l~~ai~~~~~  151 (427)
T Consensus        94 ~~~r~~~l~~  103 (435)
T COG3706          94 LFLRAKSLVR  103 (435)
T ss_pred             HHHHHHHHCC
T ss_conf             8875266314